LOCUS       AJ309861                 638 bp    mRNA    linear   HUM 17-MAR-2003
DEFINITION  Homo sapiens partial mRNA for putative protein kinase WNK4 (PRKWNK4
            gene).
ACCESSION   AJ309861
VERSION     AJ309861.1
KEYWORDS    PRKWNK4 gene; protein kinase WNK4.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 638)
  AUTHORS   Jordan,P.
  JOURNAL   Submitted (22-FEB-2001) to the INSDC. Jordan P., Centro de Genetica
            Humana, Instituto Nacional de Saude "Dr. Ricardo Jorge", Avenida
            Padre Cruz, Lisboa, 1649-016, PORTUGAL.
REFERENCE   3
  AUTHORS   Verissimo,F. and  Jordan,P.
  TITLE     WNK kinases, a novel protein kinase subfamily in multi-cellular
            organisms
  JOURNAL   Oncogene 20(39), 5562-5569(2001).
   PUBMED   11571656
FEATURES             Location/Qualifiers
     source          1..638
                     /db_xref="H-InvDB:HIT000247048"
                     /organism="Homo sapiens"
                     /chromosome="17"
                     /mol_type="mRNA"
                     /tissue_type="colon"
                     /db_xref="taxon:9606"
     CDS             <1..>638
                     /codon_start=1
                     /gene="PRKWNK4"
                     /product="putative protein kinase WNK4"
                     /db_xref="GOA:Q96J92"
                     /db_xref="H-InvDB:HIT000247048.13"
                     /db_xref="HGNC:HGNC:14544"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR024678"
                     /db_xref="PDB:2V3S"
                     /db_xref="UniProtKB/Swiss-Prot:Q96J92"
                     /protein_id="CAC32991.1"
                     /translation="TRKLSRAERQRFSEEVEMLKGLQHPNIVRFYDSWKSVLRGQVCI
                     VLVTELMTSGTLKTYLRRFREMKPRVLQRWSRQILRGLHFLHSRVPPILHRDLKCDNV
                     FITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDEAVDVYAFGMCML
                     EMATSEYPYSECQNAAQIYRKVTSGRKPNSFHKVKIPEVKEIIEGCIRTDKN"
BASE COUNT          141 a          183 c          191 g          123 t
ORIGIN
        1 actcggaaac tgtctagagc tgagcggcag cgcttctcag aggaggtgga gatgctcaag
       61 gggctgcagc accccaacat cgtccgcttc tatgattcgt ggaagtcggt gctgaggggc
      121 caggtttgca tcgtgctggt caccgaactc atgacctcgg gcacgctcaa gacgtacctg
      181 aggcggttcc gggagatgaa gccgcgggtc cttcagcgct ggagccgcca aatcctgcgg
      241 ggacttcatt tcctacactc ccgggttcct cccatcctgc accgggatct caagtgcgac
      301 aatgtcttta tcacgggacc tactggctct gtcaaaatcg gggacctggg cctggccacg
      361 ctcaagcgcg cctcctttgc caagagtgtc atcgggaccc cggaattcat ggcccccgag
      421 atgtacgagg aaaagtacga tgaggccgtg gacgtgtacg cgttcggcat gtgcatgctg
      481 gagatggcca cctctgagta cccgtactcc gagtgccaga atgccgcgca aatctaccgc
      541 aaggtcactt cgggcagaaa gccgaacagc ttccacaagg tgaagatacc cgaggtgaag
      601 gagatcattg aaggctgcat ccgcacggat aagaacga
//