LOCUS       AJ297583                 793 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Homo sapiens partial mRNA for MHC class II antigen (HLA-DRB1 gene),
            DRB1*1402 allele.
ACCESSION   AJ297583
VERSION     AJ297583.1
KEYWORDS    HLA-DRB1 gene; HLA-DRB1*1402 allele; human leucocyte antigen DRB1;
            major histocompatibility complex; MHC class II antigen.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 793)
  AUTHORS   Corell,A.
  JOURNAL   Submitted (15-AUG-2000) to the INSDC. Corell A., HLA Informatics
            Group, Anthony Nolan Research Institute, The Royal Free Hospital,
            Pond Street, Hampstead, NW3 2QG London, UNITED KINGDOM.
REFERENCE   2
  AUTHORS   Corell,A., Cox,S.T., Soteriou,B., Ramon,D., Madrigal,J.A. and 
            Marsh,S.G.E.
  TITLE     Complete cDNA sequences of the HLA-DRB1*14011, *1402, *1403 and
            *1404 alleles
  JOURNAL   Tissue Antigens 59(1), 66-69(2002).
   PUBMED   11972886
FEATURES             Location/Qualifiers
     source          1..793
                     /organism="Homo sapiens"
                     /chromosome="6"
                     /map="6p21.3"
                     /mol_type="mRNA"
                     /country="Venezuela"
                     /sex="female"
                     /haplotype="HLA-A*02, B*15, DRB1*14"
                     /clone="AMALA-S8"
                     /cell_line="AMALA"
                     /cell_type="EBV transformed B lymphocytes"
                     /tissue_lib="ECACC"
                     /db_xref="taxon:9606"
     CDS             1..>793
                     /gene="HLA-DRB1"
                     /product="MHC class II antigen"
                     /function="antigen presenting molecule"
                     /note="DRB1*1402 allele"
                     /db_xref="GOA:Q9GIY3"
                     /db_xref="HGNC:HGNC:4948"
                     /db_xref="IMGT/HLA:DRB1*14:02"
                     /db_xref="InterPro:IPR000353"
                     /db_xref="InterPro:IPR003006"
                     /db_xref="InterPro:IPR003597"
                     /db_xref="InterPro:IPR007110"
                     /db_xref="InterPro:IPR011162"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR014745"
                     /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
                     /protein_id="CAC08823.1"
                     /translation="MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTSEC
                     HFFNGTERVRFLERYFHNQEENVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRA
                     AVDTYCRHNYGVGESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRW
                     FRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWR
                     ARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGF"
     sig_peptide     1..87
                     /gene="HLA-DRB1"
                     /note="DRB1*1402 allele"
     mat_peptide     88..>793
                     /gene="HLA-DRB1"
                     /product="MHC class II antigen"
                     /note="DRB1*1402 allele"
BASE COUNT          169 a          201 c          257 g          166 t
ORIGIN
        1 atggtgtgtc tgaggctccc tggaggctcc tgcatggcag ttctgacagt gacactgatg
       61 gtgctgagct ccccactggc tttggctggg gacaccagac cacgtttctt ggagtactct
      121 acgtctgagt gtcatttctt caatgggacg gagcgggtgc ggttcctgga gagatacttc
      181 cataaccagg aggagaacgt gcgcttcgac agcgacgtgg gggagtaccg ggcggtgacg
      241 gagctggggc ggcctgatgc cgagtactgg aacagccaga aggacctcct ggagcagagg
      301 cgggccgcgg tggacaccta ctgcagacac aactacgggg ttggtgagag cttcacagtg
      361 cagcggcgag tccatcctaa ggtgactgtg tatccttcaa agacccagcc cctgcagcac
      421 cacaacctcc tggtctgttc tgtgagtggt ttctatccag gcagcattga agtcaggtgg
      481 ttccggaatg gccaggaaga gaagactggg gtggtgtcca caggcctgat ccacaatgga
      541 gactggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaggtttac
      601 acctgccaag tggagcaccc aagcgtgaca agccctctca cagtggaatg gagagcacgg
      661 tctgaatctg cacagagcaa gatgctgagt ggagtcgggg gctttgtgct gggcctgctc
      721 ttccttgggg ccgggctgtt catctacttc aggaatcaga aaggacactc tggacttcag
      781 ccaagaggat tcc
//