LOCUS       AJ272197                 830 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Homo sapiens partial mRNA for hypothetical protein, 830bp.
ACCESSION   AJ272197
VERSION     AJ272197.1
KEYWORDS    ORF1.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 830)
  AUTHORS   Jenne D.E.
  JOURNAL   Submitted (14-FEB-2000) to the INSDC. Jenne D.E., Neuroimmunology,
            Max-Planck-Institute of Neurobiology, Am Klopferspitz 18A, D-82152
            Martinsried, GERMANY.
REFERENCE   3
  AUTHORS   Jenne D.E., Tinschert S., Stegmann E., Reimann H., Nurnberg P.
  TITLE     A common set of at least 11 functional genes is lost in the
            majority of NF1 patients with gross deletions
  JOURNAL   Genomics 66(1), 93-97(2000).
   PUBMED   10843809
COMMENT     related sequence A28260
FEATURES             Location/Qualifiers
     source          1..830
                     /db_xref="H-InvDB:HIT000246242"
                     /organism="Homo sapiens"
                     /chromosome="17"
                     /map="17q11.2"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             <1..621
                     /codon_start=1
                     /product="hypothetical protein"
                     /note="ORF1"
                     /db_xref="GOA:Q9NYH9"
                     /db_xref="H-InvDB:HIT000246242.11"
                     /db_xref="HGNC:HGNC:18279"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013949"
                     /db_xref="UniProtKB/Swiss-Prot:Q9NYH9"
                     /protein_id="CAB77268.1"
                     /translation="AVAGTELFRDSGTMWQLKLQVLIESKSPDIAMLFEEAFVHLKPQ
                     VCLPLWISWAEWSEGAKSQEDTEAVFKKALLAVIGADSVTLKNKYLDWAYRSGGYKKA
                     RAVFKSLQESRPFSVDFFRKMIQFEKEQESCNMANIREYYERALREFGSADSDLWMDY
                     MKEELNHPLGRPENCGQIYWRAMKMLQGESAEAFVAKHAMHQTGHL"
BASE COUNT          265 a          136 c          207 g          222 t
ORIGIN      
        1 gcagtagctg gaactgaatt gtttagagac tctgggacaa tgtggcagct gaagctgcag
       61 gtgctgatcg agtcaaagag ccctgacata gccatgcttt ttgaagaagc ctttgtgcac
      121 ctgaaacccc aggtttgtct gccattgtgg atttcctggg cagagtggag tgaaggtgcc
      181 aaaagccaag aagacactga ggcagtcttt aagaaagctc tcttagctgt cataggtgcc
      241 gactcagtaa ccctgaagaa taagtacctg gattgggctt atcgaagtgg tggctacaaa
      301 aaggccagag ctgtgtttaa aagtttacag gagagccgac cattttcagt tgactttttc
      361 aggaaaatga ttcagtttga aaaggagcaa gaatcctgca atatggcgaa cataagagaa
      421 tattatgaga gagctttgag agagtttgga tccgcagatt ctgatctttg gatggattat
      481 atgaaagaag aattgaacca cccccttggt agacctgaga actgtggaca gatctactgg
      541 cgagcgatga aaatgttgca gggagagtca gcagaggcat ttgtagctaa acatgctatg
      601 catcagactg gccatttatg aagatgaaga atacagtcag ctttgtgaaa tagtattgca
      661 agcaagcccc gtgggcaaat ttgtattgag tccatctgta atttgctcag tgatggcaga
      721 caagatggct gtctggtttt gagacacact ttaattttat gttaacttgt taaatctttt
      781 taaaaattaa aaaattttta tgattgagaa aaaaaaaaaa aaaaaaaaaa
//