LOCUS       AJ243874                3504 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Homo sapiens mRNA for oligophrenin-4 (OPHN4 gene).
ACCESSION   AJ243874
VERSION     AJ243874.1
KEYWORDS    IL-1 receptor family; oligophrenin-4; OPHN4 gene.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3504)
  AUTHORS   Carrie,A.
  JOURNAL   Submitted (22-JUL-1999) to the INSDC. Carrie A., CHU Cochin, INSERM
            U 129, 24 rue du Fbg St Jacques, Paris, 75014, FRANCE.
REFERENCE   2
  AUTHORS   Carrie,A., Jun,L., Bienvenu,T. and  Vinet,M.
  TITLE     A new member of the IL-1 receptor family highly expressed in
            hippocampus and involved in X-linked mental retardation
  JOURNAL   Nat Genet 23(1), 25-31(1999).
   PUBMED   10471494
FEATURES             Location/Qualifiers
     source          1..3504
                     /db_xref="H-InvDB:HIT000245553"
                     /organism="Homo sapiens"
                     /chromosome="X"
                     /map="Xp21.3"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             511..2601
                     /gene="OPHN4"
                     /product="oligophrenin-4"
                     /function="putative role in interleukin-mediated signal
                     transduction pathways"
                     /db_xref="GOA:Q9NZN1"
                     /db_xref="H-InvDB:HIT000245553.15"
                     /db_xref="HGNC:HGNC:5996"
                     /db_xref="InterPro:IPR000157"
                     /db_xref="InterPro:IPR003598"
                     /db_xref="InterPro:IPR003599"
                     /db_xref="InterPro:IPR007110"
                     /db_xref="InterPro:IPR013098"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR015621"
                     /db_xref="PDB:1T3G"
                     /db_xref="PDB:4M92"
                     /db_xref="UniProtKB/Swiss-Prot:Q9NZN1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /protein_id="CAB56046.1"
                     /translation="MKAPIPHLILLYATFTQSLKVVTKRGSADGCTDWSIDIKKYQVL
                     VGEPVRIKCALFYGYIRTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDS
                     IWFRPTLLQDSGLYACVIRNSTYCMKVSISLTVGENDTGLCYNSKMKYFEKAELSKSK
                     EISCRDIEDFLLPTREPEILWYKECRTKTWRPSIVFKRDTLLIREVREDDIGNYTCEL
                     KYGGFVVRRTTELTVTAPLTDKPPKLLYPMESKLTIQETQLGDSANLTCRAFFGYSGD
                     VSPLIYWMKGEKFIEDLDENRVWESDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSC
                     YVENGNGRRHASVLLHKRELMYTVELAGGLGAILLLLVCLVTIYKCYKIEIMLFYRNH
                     FGAEELDGDNKDYDAYLSYTKVDPDQWNQETGEEERFALEILPDMLEKHYGYKLFIPD
                     RDLIPTGTYIEDVARCVDQSKRLIIVMTPNYVVRRGWSIFELETRLRNMLVTGEIKVI
                     LIECSELRGIMNYQEVEALKHTIKLLTVIKWHGPKCNKLNSKFWKRLQYEMPFKRIEP
                     ITHEQALDVSEQGPFGELQTVSAISMAAATSTALATAHPDLRSTFHNTYHSQMRQKHY
                     YRSYEYDVPPTGTLPLTSIGNQHTYCNIPMTLINGQRPQTKSSREQNPDEAHTNSAIL
                     PLLPRETSISSVIW"
BASE COUNT         1052 a          709 c          751 g          992 t
ORIGIN
        1 ggttgaaagg ctgcatgtac tcagaagatt tgcaagcaac actccaattc ttgtcataga
       61 gctcgcagac ttctcactta tcggcttttt tccttcctta ttttttaaga attattctta
      121 ttttcccctc tctttttctg ctctctcctc tctcagtctc tccttttcta tctgcctctt
      181 catttttctc ctagtctgtt ttttttttcc cggctctgca cctggattgt atcttcagca
      241 aacaatcggg cactttgaga actaactgga gacagtcttg tagggaagat ctgtatggaa
      301 ttatctgctt ttatggtgaa cttggcattt gtgaatggga atcttgttca caatattaat
      361 tgctagcaaa aacaagaaaa agaacacagg agtaaaacgt ggatttttct gaatacgcat
      421 tgtgatgacc agcaattacc ttaccgacta atatccagag gagaataatt tggaagactg
      481 ttgtggggaa cagcctttaa gagctggaag atgaaagctc cgattccaca cttgattctc
      541 ttatacgcta cttttactca gagtttgaag gttgtgacca aaagaggctc cgccgatgga
      601 tgcactgact ggtctatcga tatcaagaaa tatcaagttt tggtgggaga gcctgttcga
      661 atcaaatgtg cactctttta tggttatatc agaacaaatt actcccttgc ccaaagtgct
      721 ggactcagtt tgatgtggta caaaagttct ggtcctggag actttgaaga gccaatagcc
      781 tttgacggaa gtagaatgag caaagaagaa gactccattt ggttccggcc aacattgcta
      841 caggacagtg gtctctacgc ctgtgtcatc agaaactcca cttactgtat gaaagtatcc
      901 atctcactga cagtgggtga aaatgacact ggactctgct ataattccaa gatgaagtat
      961 tttgaaaaag ctgaacttag caaaagcaag gaaatttcat gccgtgacat agaggatttt
     1021 ctactgccaa ccagagaacc tgaaatcctt tggtacaagg aatgcaggac aaaaacatgg
     1081 aggccaagta ttgtattcaa aagagatact ctgcttataa gagaagtcag agaagatgac
     1141 attggaaatt atacctgtga attaaaatat ggaggctttg ttgtgagaag aactactgaa
     1201 ttaactgtta cagcccctct gactgataag ccacccaagc ttttgtatcc tatggaaagt
     1261 aaactgacaa ttcaggagac ccagctgggt gactctgcta atctaacctg cagagctttc
     1321 tttgggtaca gcggagatgt cagtccttta atttactgga tgaaaggaga aaaatttatt
     1381 gaagatctgg atgaaaatcg agtttgggaa agtgacatta gaattcttaa ggagcatctt
     1441 ggggaacagg aagtttccat ctcattaatt gtggactctg tggaagaagg tgacttggga
     1501 aattactcct gttatgttga aaatggaaat ggacgtcgac acgccagcgt tctccttcat
     1561 aaacgagagc taatgtacac agtggaactt gctggaggcc ttggtgctat actcttgctg
     1621 cttgtatgtt tggtgaccat ctacaagtgt tacaagatag aaatcatgct cttctacagg
     1681 aatcattttg gagctgaaga gctcgatgga gacaataaag attatgatgc atacttatca
     1741 tacaccaaag tggatcctga ccagtggaat caagagactg gggaagaaga acgttttgcc
     1801 cttgaaatcc tacctgatat gcttgaaaag cattatggat ataagttgtt tataccagat
     1861 agagatttaa tcccaactgg aacatacatt gaagatgtgg caagatgtgt agatcaaagc
     1921 aagcggctga ttattgtcat gaccccaaat tacgtagtta gaaggggctg gagcatcttt
     1981 gagctggaaa ccagacttcg aaatatgctt gtgactggag aaattaaagt gattctaatt
     2041 gaatgcagtg aactgagagg aattatgaac taccaggagg tggaggccct gaagcacacc
     2101 atcaagctcc tgacggtcat taaatggcat ggaccaaaat gcaacaagtt gaactccaag
     2161 ttctggaaac gtttacagta tgaaatgcct tttaagagga tagaacccat tacacatgag
     2221 caggctttag atgtcagtga gcaagggcct tttggggagc tgcagactgt ctcggccatt
     2281 tccatggccg cggccacctc cacagctcta gccactgccc atccagatct ccgttctacc
     2341 tttcacaaca cgtaccattc acaaatgcgt cagaaacact actaccgaag ctatgagtac
     2401 gacgtacctc ctaccggcac cctgcctctt acctccatag gcaatcagca tacctactgt
     2461 aacatcccta tgacactcat caacgggcag cggccacaga caaaatcgag cagggagcag
     2521 aatccagatg aggcccacac aaacagtgcc atcctgccgc tgttgccaag ggagaccagt
     2581 atatccagtg tgatatggtg acagaaaagc aagggacatc ccgtccctgg gaggttgagt
     2641 ggaatctgca gtccagtgcc tggaactaaa tcctcgactg ctgctgttaa aaaacatgca
     2701 ttagaatctc tagaacacga ggaaaaacag ggtcttgtac atatgttttt tggaatttct
     2761 ttgtagcatc agtgtcctcc tgttttacca tgtcttttac cattacattt tttgactttg
     2821 ttttatatgt cgttggaatt tgtaaattta catttttttt aaagaagaga ctgatgtgta
     2881 gatagaaaac cctttttttg cttcattagt ttagttttag aatgggtttt tattttattt
     2941 ccttttttaa aattttactt tgcttttaac atttccttgg ggtgcttgga caaatctatc
     3001 cgatgggaca aggagcaccg gattctttct cgggttctgc ctagcatcaa ctgggccacg
     3061 tcggccttca gagaacagtg caacaaatgc cagcattgcc attcggggga aaaaaaaaaa
     3121 aaaaaaaaaa agatgagaag aacacttgtt cataggaggg ccccaccagt cagagccctg
     3181 aatctcttcc ttgtcccacc tcattcccca cctctacctt tctaatggcg gcatgatgtg
     3241 taaactctgt gcaggggtgg gggcgggtct aactgtctta acattcaagt cactgctctt
     3301 cagaatacac tctagaccca aaggtgtgct aatcacttca cagtgaccac tacagagtac
     3361 taagaagaga agatcaaggg catgaaattg gggaagagtg ttatttccgt tttttaaatg
     3421 agttgatgta cccttatata tatatacata tatatataaa tataaatata tataaaaaca
     3481 acaaaacaaa acaaaaaaag aaaa
//