LOCUS       AJ133004                2248 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Homo sapiens mRNA for tMDC III sperm protein.
ACCESSION   AJ133004
VERSION     AJ133004.1
KEYWORDS    sperm protein; tMDC III gene.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2248)
  AUTHORS   Hall,L.
  JOURNAL   Submitted (08-APR-1999) to the INSDC. Hall L., Biochemistry,
            University of Bristol, School of Medical Sciences, University Walk,
            Bristol, BS8 1TD, UNITED KINGDOM.
REFERENCE   2
  AUTHORS   Hall,L., Frayne,J. and  Dimsey,E.A.
  TITLE     Nucleotide sequence of the human tMDC III sperm surface protein
            transcript.
  JOURNAL   Unpublished.
FEATURES             Location/Qualifiers
     source          1..2248
                     /db_xref="H-InvDB:HIT000244761"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /sex="male"
                     /dev_stage="adult"
                     /tissue_type="testis"
                     /db_xref="taxon:9606"
     CDS             1..2220
                     /gene="tMDC III"
                     /product="tMDC III protein"
                     /function="sperm surface protein"
                     /db_xref="GOA:Q9Y3Q7"
                     /db_xref="H-InvDB:HIT000244761.13"
                     /db_xref="HGNC:HGNC:196"
                     /db_xref="InterPro:IPR001590"
                     /db_xref="InterPro:IPR001762"
                     /db_xref="InterPro:IPR002870"
                     /db_xref="InterPro:IPR006586"
                     /db_xref="InterPro:IPR018358"
                     /db_xref="InterPro:IPR024079"
                     /db_xref="UniProtKB/Swiss-Prot:Q9Y3Q7"
                     /protein_id="CAB40812.1"
                     /translation="MFLLLALLTELGRLQAHEGSEGIFLHVTVPRKIKSNDSEVSERK
                     MIYIITIDGQPYTLHLGKQSFLPQNFLVYTYNETGSLHSVSPYFMMHCHYQGYAAEFP
                     NSFVTLSICSGLRGFLQFENISYGIEPVESSARFEHIIYQMKNNDPNVSILAVNYSHI
                     WQKDQPYKVPLNSQIKNLSKLLPQYLEIYIIVEKALYDYMGSEMMAVTQKIVQVIGLV
                     NTMFTQFKLTVILSSLELWSNENQISTSGDADDILQRFLAWKRDYLILRPHDIAYLLV
                     YRKHPKYVGATFPGTVCNKSYDAGIAMYPDAIGLEGFSVIIAQLLGLNVGLTYDDITQ
                     CFCLRATCIMNHEAVSASGRKIFSNCSMHDYRYFVSKFETKCLQKLSNLQPLHQNQPV
                     CGNGILESNEECDCGNKNECQFKKCCDYNTCKLKGSVKCGSGPCCTSKCELSIAGTPC
                     RKSIDPECDFTEYCNGTSSNCVPDTYALNGRLCKLGTAYCYNGQCQTTDNQCAKIFGK
                     GAQGAPFACFKEVNSLHERSENCGFKNSQPLPCERKDVLCGKLACVQPHKNANKSDAQ
                     STVYSYIQDHVCVSIATGSSMRSDGTDNAYVADGTMCGPEMYCVNKTCRKVHLMGYNC
                     NATTKCKGKGICNNFGNCQCFPGHRPPDCKFQFGSPGGSIDDGNFQKSGDFYTEKGYN
                     THWNNWFILSFCIFLPFFIVFTTVIFKRNEISKSCNRENAEYNRNSSVVSESDDVGH"
     misc_feature    535..1143
                     /function="metalloproteinase-like domain"
     misc_feature    1201..1428
                     /function="disintegrin-like domain"
     misc_feature    2053..2115
                     /function="transmembrane domain"
BASE COUNT          721 a          395 c          446 g          686 t
ORIGIN
        1 atgttccttc tcctcgccct cctcactgag cttggaagac tgcaagccca cgaaggttct
       61 gaaggaatat ttctgcatgt cacagttcca cggaagatta agtcaaatga cagtgaagtt
      121 tcagagagga agatgattta catcattaca attgatggac aaccttacac tctacatctc
      181 ggaaaacaat cattcttacc ccagaacttt ttggtttata catataatga aactggatct
      241 ttgcattctg tgtctccata ttttatgatg cattgccatt accaaggata tgctgccgaa
      301 tttccaaatt catttgtgac actcagtata tgttctggtc tcaggggatt tctccagttt
      361 gaaaatatca gttatggaat tgaaccagta gaatcttcag caagatttga gcatataatt
      421 tatcaaatga aaaataatga tccaaatgta tccattttag cagtaaatta cagtcatatt
      481 tggcagaaag accagcccta caaagttcct ttaaactcac agataaaaaa tctttcaaaa
      541 ctattacccc aatatctgga aatatacatt atagtggaaa aagctttgta tgattatatg
      601 ggatctgaaa tgatggctgt aacacaaaaa attgtccagg ttattgggct tgtcaacact
      661 atgtttaccc agttcaaatt gactgttata ctgtcttcct tggaattgtg gtcaaatgaa
      721 aaccagattt ccaccagtgg ggatgctgat gatatattac aaagattttt ggcatggaaa
      781 cgggactatc tcatcctacg gccccatgac atagcatact tacttgttta caggaaacat
      841 cctaaatatg tgggagcaac atttcctggc accgtatgca ataaaagcta tgatgcaggt
      901 attgctatgt atccagatgc aataggtttg gagggatttt cggttattat agctcaactg
      961 cttggcctta atgtaggatt aacatatgat gacatcactc agtgtttctg tctgagagct
     1021 acatgcatca tgaatcatga agcagtgagt gccagtggta gaaagatttt tagcaactgc
     1081 agcatgcacg actatagata ttttgtttca aaatttgaga ctaaatgcct tcagaagctt
     1141 tcaaatttgc aaccattaca tcaaaatcaa ccagtgtgtg gtaatgggat tttggaatcc
     1201 aatgaagaat gtgactgtgg taataaaaat gaatgtcaat ttaagaagtg ctgtgattat
     1261 aacacatgta aactgaaggg ctcagtaaaa tgtggttctg gaccatgttg tacatcaaag
     1321 tgtgagttgt caatagcagg cactccatgt agaaagagta ttgatccaga gtgtgatttt
     1381 acagagtact gcaatggaac ctctagtaat tgtgttcctg acacttatgc attgaatggc
     1441 cgtttgtgca agttgggaac tgcctattgc tataacggac aatgtcaaac tactgataac
     1501 cagtgtgcca agatatttgg aaaaggtgct caaggtgctc catttgcctg ttttaaagaa
     1561 gttaattctc tgcatgaaag atctgaaaac tgtggtttta aaaattcaca accattacct
     1621 tgtgaacgga aggatgttct ctgtggaaaa ttagcttgtg ttcagccaca taaaaatgct
     1681 aataaaagtg acgctcaatc tacagtttat tcatatattc aagaccatgt atgtgtatct
     1741 atagccactg gttcctccat gagatcagat ggaacagaca atgcctatgt ggctgatggc
     1801 accatgtgtg gtccagaaat gtactgtgta aataaaacct gcagaaaagt tcatttaatg
     1861 ggatataact gtaatgccac cacaaaatgc aaagggaaag ggatatgtaa taattttggt
     1921 aattgtcaat gcttccctgg acatagacct ccagattgta aattccagtt tggttcccca
     1981 gggggtagta ttgatgatgg aaattttcag aaatctggtg acttttatac tgaaaaaggc
     2041 tacaatacac actggaacaa ctggtttatt ctgagtttct gcatttttct gccgtttttc
     2101 atagttttca ccactgtgat ctttaaaaga aatgaaataa gtaaatcatg taacagagag
     2161 aatgcagagt ataatcgtaa ttcatccgtt gtatcagaaa gcgatgacgt gggacattaa
     2221 tattgcacag aacttccata gcaaataa
//