LOCUS       AJ008005                1202 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Homo sapiens PSN1 gene, alternative transcript.
ACCESSION   AJ008005
VERSION     AJ008005.1
KEYWORDS    minilin protein; PSN1 gene.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1202)
  AUTHORS   Palmer,M.S.
  JOURNAL   Submitted (04-AUG-1998) to the INSDC. Palmer M.S., Molecular
            Genetics, Imperial College School of Medicine, Norfolk Place,
            London, W2 1PG, UK.
REFERENCE   2
  AUTHORS   Powell,C.S., Gegg,M.E. and  Palmer,M.S.
  TITLE     Human presenilin 1 gene encodes an alternative protein-minilin
  JOURNAL   Unpublished.
FEATURES             Location/Qualifiers
     source          1..1202
                     /db_xref="H-InvDB:HIT000244192"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /cell_line="SH-SY5Y"
                     /cell_type="Neuroblastoma"
                     /db_xref="taxon:9606"
     CDS             219..773
                     /gene="PSN1"
                     /product="minilin"
                     /db_xref="GOA:P49768"
                     /db_xref="H-InvDB:HIT000244192.13"
                     /db_xref="HGNC:HGNC:9508"
                     /db_xref="InterPro:IPR001108"
                     /db_xref="InterPro:IPR002031"
                     /db_xref="InterPro:IPR006639"
                     /db_xref="PDB:2KR6"
                     /db_xref="UniProtKB/Swiss-Prot:P49768"
                     /protein_id="CAA07825.1"
                     /translation="MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSL
                     GHPEPLSNGRPQGNSRQVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATIKS
                     VSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYK
                     VSMRHRSLLSTLFFLWLGILVTVT"
     polyA_signal    1176..1181
                     /gene="PSN1"
     polyA_site      1195
                     /gene="PSN1"
                     /experiment="experimental evidence, no additional details
                     recorded"
BASE COUNT          371 a          243 c          282 g          306 t
ORIGIN
        1 tcacatcgga aacaaaacag cggctggtct ggaaggaacc tgagctacga cccgcggcgg
       61 cagcggggcg gcggggaagc gtatcctaat ctgggagcct gcaagtgaca acagcctttg
      121 cggtccttag acagcttggc ctggaggaga acacatgaaa gaaagaacct caagaggctt
      181 tgttttctgt gaaacagtat ttctatacag ttgctccaat gacagagtta cctgcaccgt
      241 tgtcctactt ccagaatgca cagatgtctg aggacaacca cctgagcaat actgtacgta
      301 gccagaatga caatagagaa cggcaggagc acaacgacag acggagcctt ggccaccctg
      361 agccattatc taatggacga ccccagggta actcccggca ggtggtggag caagatgagg
      421 aagaagatga ggagctgaca ttgaaatatg gcgccaagca tgtgatcatg ctctttgtcc
      481 ctgtgactct ctgcatggtg gtggtcgtgg ctaccattaa gtcagtcagc ttttataccc
      541 ggaaggatgg gcagctaatc tataccccat tcacagaaga taccgagact gtgggccaga
      601 gagccctgca ctcaattctg aatgctgcca tcatgatcag tgtcattgtt gtcatgacta
      661 tcctcctggt ggttctgtat aaatacaggt gctataaggt gagcatgaga cacagatctt
      721 tgctttccac cctgttcttc ttatggttgg gtattcttgt cacagtaact taactgatct
      781 aggaaagaaa aaatgttttg tcttctagag ataagttaat ttttagtttt cttcctcctc
      841 actgtggaac attcaaaaaa tacaaaaagg aagccaggtg catgtgtaat gccaggctca
      901 gaggctgagg caggaggatc gcttgggccc aggagttcac aagcagcttg ggcaacgtag
      961 caagaccctg cctctattaa agaaaacaaa aaacaaatat tggaagtatt ttatatgcat
     1021 ggaatctata tgtcatgaaa aaattagtgt aaaatatata tattatgatt agtatcaaga
     1081 tttagtgata atttatgtta ttttgggatt tcaatgcctt tttaggccat tgtctcaaaa
     1141 ataaaagcag aaaacaaaaa aagttgtaac tgaaaaataa acatttccat ataaaaaaaa
     1201 aa
//