LOCUS       AJ007669                2649 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Homo sapiens mRNA for Fanconi anemia group G.
ACCESSION   AJ007669
VERSION     AJ007669.1
KEYWORDS    Fanconi anemia.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2649)
  AUTHORS   Joenje,H.
  JOURNAL   Submitted (13-JUL-1998) to the INSDC. Joenje H., Dept. Human
            Genetics, Free University, Van der Boechorststraat 7, Amsterdam,
            NL-1081 BT, THE NETHERLANDS.
REFERENCE   2
  AUTHORS   De,Winter,J.P., Waisfisz,Q., Rooimans,M.A., Van,Berkel,C.G.M.,
            Bosnoyan-Collins,L., Alon,N., Carreau,M., Bender,O., Demuth,I.,
            Schindler,D., Pronk,J.C., Arwert,F., Hoehn,H., Digweed,M.,
            Buchwald,M. and  Joenje,H.
  TITLE     The Fanconi anaemia group G gene FANCG is identical with XRCC9.
  JOURNAL   Nat Genet 20(3), 281-283(1998).
   PUBMED   9806548
FEATURES             Location/Qualifiers
     source          1..2649
                     /db_xref="H-InvDB:HIT000244166"
                     /organism="Homo sapiens"
                     /map="9p13"
                     /mol_type="mRNA"
                     /clone="pFAG11"
                     /cell_line="HSC93"
                     /cell_type="Human lymphoblast"
                     /db_xref="taxon:9606"
     CDS             <492..2361
                     /codon_start=2
                     /gene="FAG"
                     /product="FAG protein"
                     /product="XRCC9 protein"
                     /note="alternate gene name XRCC9"
                     /db_xref="GOA:O15287"
                     /db_xref="H-InvDB:HIT000244166.15"
                     /db_xref="HGNC:HGNC:3588"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/Swiss-Prot:O15287"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /protein_id="CAA07602.1"
                     /translation="MSRQTTSVGSSCLDLWREKNDRLVRQAKVAQNSGLTLRRQQLAQ
                     DALEGLRGLLHSLQGLPAAVPVLPLELTVTCNFIILRASLAQGFTEDQAQDIQRSLER
                     VLETQEQQGPRLEQGLRELWDSVLRASCLLPELLSALHRLVGLQAALWLSADRLGDLA
                     LLLETLNGSQSGASKDLLLLLKTWSPPAEELDAPLTLQDAQGLKDVLLTAFAYRQGLQ
                     ELITGNPDKALSSLHEAASGLCPRPVLVQVYTALGSCHRKMGNPQRALLYLVAALKEG
                     SAWGPPLLEASRLYQQLGDTTAELESLELLVEALNVPCSSKAPQFLIEVELLLPPPDL
                     ASPLHCGTQSQTKHILASRCLQTGRAGDAAEHYLDLLALLLDSSEPRFSPPPSPPGPC
                     MPEVFLEAAVALIQAGRAQDALTLCEELLSRTSSLLPKMSRLWEDARKGTKELPYCPL
                     WVSATHLLQGQAWVQLGAQKVAISEFSRCLELLFRATPEEKEQGAAFNCEQGCKSDAA
                     LQQLRAAALISRGLEWVASGQDTKALQDFLLSVQMCPGNRDTYFHLLQTLKRLDRRDE
                     ATALWWRLEAQTKGSHEDALWSLPLYLESYLSWIRPSDRDAFLEEFRTSLPKSCDL"
BASE COUNT          551 a          756 c          773 g          569 t
ORIGIN
        1 aggaggacct gggggtgtgg cagcgaggaa gggccgagcc acggactgtg gggccgaaac
       61 tcgctcccgc ccaccctttc tcgaggctgt ggcctccgcg agagccgagc gggccgcacc
      121 gccggccgtg cgactgcccc agtcagacac gaccccggct tctagcccgc ctaagcctgt
      181 ttggggttgc tgactcgttt cctccccgag tttcccgcgg gaactaactc ttcaagagga
      241 ccaaccgcag cccagagctt cgcagacccg gccaaccaga ggcgaggttg agagcccggc
      301 gggccgcggg gagagagcgt cccatctgtc ctggaaagcc tgggcgggtg gattgggacc
      361 ccgagagaag caggggagct cggcggggtg cagaagtgcc caggcccctc cccgctgggg
      421 ttgggagctt gggcaggcca gcttcaccct tcctaagtcc gcttctggtc tccgggccca
      481 gcctcggcca ccatgtcccg ccagaccacc tctgtgggct ccagctgcct ggacctgtgg
      541 agggaaaaga atgaccggct cgttcgacag gccaaggtgg ctcagaactc cggtctgact
      601 ctgaggcgac agcagttggc tcaggatgca ctggaagggc tcagagggct cctccatagt
      661 ctgcaagggc tccctgcagc tgttcctgtt cttcccttgg agctgactgt cacctgcaac
      721 ttcattatcc tgagggcaag cttggcccag ggtttcacag aggatcaggc ccaggatatc
      781 cagcggagcc tagagagagt gctggagaca caggagcagc aggggcccag gttggaacag
      841 gggctcaggg agctgtggga ctctgtcctt cgtgcttcct gccttctgcc ggagctgctg
      901 tctgccctgc accgcctggt tggcctgcag gctgccctct ggttgagtgc tgaccgtctt
      961 ggggacctgg ccttgttact agagaccctg aatggcagcc agagtggagc ctctaaggat
     1021 ctgctgttac ttctgaaaac ttggagtccc ccagctgagg aattagatgc tccattgacc
     1081 ctgcaggatg cccagggatt gaaggatgtc ctcctgacag catttgccta ccgccaaggt
     1141 ctccaggagc tgatcacagg gaacccagac aaggcactaa gcagccttca tgaagcggcc
     1201 tcaggcctgt gtccacggcc tgtgttggtc caggtgtaca cagcactggg gtcctgtcac
     1261 cgtaagatgg gaaatccaca gagagcactg ttgtacttgg ttgcagccct gaaagaggga
     1321 tcagcctggg gtcctccact tctggaggcc tctaggctct atcagcaact gggggacaca
     1381 acagcagagc tggagagtct ggagctgcta gttgaggcct tgaatgtccc atgcagttcc
     1441 aaagccccgc agtttctcat tgaggtagaa ttactactgc caccacctga cctagcctca
     1501 ccccttcatt gtggcactca gagccagacc aagcacatac tagcaagcag gtgcctacag
     1561 acggggaggg caggagacgc tgcagagcat tacttggacc tgctggccct gttgctggat
     1621 agctcggagc caaggttctc cccacccccc tcccctccag ggccctgtat gcctgaggtg
     1681 tttttggagg cagcggtagc actgatccag gcaggcagag cccaagatgc cttgactcta
     1741 tgtgaggagt tgctcagccg cacatcatct ctgctaccca agatgtcccg gctgtgggaa
     1801 gatgccagaa aaggaaccaa ggaactgcca tactgcccac tctgggtctc tgccacccac
     1861 ctgcttcagg gccaggcctg ggttcaactg ggtgcccaaa aagtggcaat tagtgaattt
     1921 agcaggtgcc tcgagctgct cttccgggcc acacctgagg aaaaagaaca aggggcagct
     1981 ttcaactgtg agcagggatg taagtcagat gcggcactgc agcagcttcg ggcagccgcc
     2041 ctaattagtc gtggactgga atgggtagcc agcggccagg ataccaaagc cttacaggac
     2101 ttcctcctca gtgtgcagat gtgcccaggt aatcgagaca cttactttca cctgcttcag
     2161 actctgaaga ggctagatcg gagggatgag gccactgcac tctggtggag gctggaggcc
     2221 caaactaagg ggtcacatga agatgctctg tggtctctcc ccctgtacct agaaagctat
     2281 ttgagctgga tccgtccctc tgatcgtgac gccttccttg aagaatttcg gacatctctg
     2341 ccaaagtctt gtgacctgta gctgccacgt tttgaagagc ttgagctggg tccccagtgg
     2401 gctgtctctc tgtggggagg gctttctgct tcaccatcat taggaatgtg accattccta
     2461 tataattcct ggactggtga gattggtggt aggcctgtga aatttgccct agttactacc
     2521 attctcgttt tggaggaaac aatctctgcc accaccaagt cattgacttt gctcgaggca
     2581 ccttttttcc tgtttctcct tttctgttgt cgagtaaaat ttcatattta taaaaaaaaa
     2641 aaaaaaaaa
//