LOCUS       AJ005893                1113 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Homo sapiens mRNA for JM26 protein, complete CDS (clone
            LLOXNC01U138D3 (Baylor College)).
ACCESSION   AJ005893
VERSION     AJ005893.1
KEYWORDS    JM26 gene.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1113)
  AUTHORS   Strom,T.M., Nyakatura,G., Hellebrand,H., Drescher,B., Rosenthal,A.
            and  Meindl,A.
  TITLE     Transcription map in Xp11.23
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 1113)
  AUTHORS   Strom,T.M.
  JOURNAL   Submitted (30-APR-1998) to the INSDC. Abteilung Medizinische
            Genetik, Goethestr. 29, Muenchen 80336, Germany.
FEATURES             Location/Qualifiers
     source          1..1113
                     /db_xref="H-InvDB:HIT000244056"
                     /organism="Homo sapiens"
                     /chromosome="X"
                     /map="p11.23"
                     /mol_type="mRNA"
                     /clone="LLOXNC01U138D3 (Baylor College)"
                     /db_xref="taxon:9606"
     CDS             258..1055
                     /codon_start=1
                     /gene="JM26"
                     /db_xref="GOA:O60828"
                     /db_xref="H-InvDB:HIT000244056.12"
                     /db_xref="HGNC:HGNC:9330"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="UniProtKB/Swiss-Prot:O60828"
                     /protein_id="CAA06750.1"
                     /translation="MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATR
                     LEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEK
                     LDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRERGYDKVDRERERDRERD
                     RDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWS
                     TGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD"
BASE COUNT          274 a          303 c          332 g          204 t
ORIGIN
        1 gggagaggaa cagggccctg gagcacctgg tttcggggac agtagggttg gtgggagttg
       61 cgatgatatt gccacctacc tcttacatct tttagtgcgt atgttctgtc cacccagcta
      121 ctggttcatt tgagtagatc ggagtcagat gagtacatgt ttacgggagg cgcttggtta
      181 cgggatccag ataggaatct ttatctgagc tgcttgtcag tttgttcgtc tgtccctagg
      241 tctgtctgct atcagctatg ccgctgcccg ttgcgctgca gacccgcttg gccaagagag
      301 gcatcctcaa acatctggag cctgaaccag aggaagagat cattgccgag gactatgacg
      361 atgatcctgt ggactacgag gccaccaggt tggagggcct accaccaagc tggtacaagg
      421 tgttcgaccc ttcctgcggg ctcccttact actggaatgc agacacagac cttgtatcct
      481 ggctctcccc acatgacccc aactccgtgg ttaccaaatc ggccaagaag ctcagaagca
      541 gtaatgcaga tgctgaagaa aagttggacc ggagccatga caagtcggac aggggccatg
      601 acaagtcgga ccgcagccat gagaaactag acaggggcca cgacaagtca gaccggggcc
      661 acgacaagtc tgacagggat cgagagcgtg gctatgacaa ggtagacaga gagagagagc
      721 gagacaggga acgggatcgg gaccgcgggt atgacaaggc agaccgggaa gagggcaaag
      781 aacggcgcca ccatcgccgg gaggagctgg ctccctatcc caagagcaag aaggcagtaa
      841 gccgaaagga tgaagagtta gaccccatgg accctagctc atactcagac gccccccggg
      901 gcacgtggtc aacaggactc cccaagcgga atgaggccaa gactggcgct gacaccacag
      961 cagctgggcc cctcttccag cagcggccgt atccatcccc aggggctgtg ctccgggcca
     1021 atgcagaggc ctcccgaacc aagcagcagg attgaagctt cggcctccct ggccctgggt
     1081 taaaataaaa gctttctggt gatcctgccc acc
//