LOCUS       AJ001699                2180 bp    mRNA    linear   HUM 21-OCT-2008
DEFINITION  Homo sapiens mRNA for Brachyury (T) protein.
ACCESSION   AJ001699
VERSION     AJ001699.1
KEYWORDS    Brachyury (T); brachyury gene; T gene; T protein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2180)
  AUTHORS   Edwards,Y.
  JOURNAL   Submitted (29-SEP-1997) to the INSDC. Edwards Y., Dept of Biology,
            University College London, MRC Human Biochemical Genetics Unit,
            Wolfson House, 4 Stephenson Way, London, NW1 2HE, UNITED KINGDOM.
  REMARK    Revised by author 09-OCT-97
REFERENCE   2
  AUTHORS   Edwards,Y., Putt,W., Lekoape,K., Stott,D., Fox,M., Hopkinson,D. and
             Sowden,J.
  TITLE     The human homolog T of the mouse T(Brachyury) gene; gene structure,
            cDNA sequence, and assignment to chromosome 6q27
  JOURNAL   Genome Res. 6(3), 226-233(1996).
   PUBMED   8963900
FEATURES             Location/Qualifiers
     source          1..2180
                     /db_xref="H-InvDB:HIT000243893"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             160..1467
                     /codon_start=1
                     /gene="T (Brachyury)"
                     /product="Brachyury (T) protein"
                     /db_xref="GOA:O15178"
                     /db_xref="H-InvDB:HIT000243893.14"
                     /db_xref="HGNC:HGNC:11515"
                     /db_xref="InterPro:IPR001699"
                     /db_xref="InterPro:IPR002070"
                     /db_xref="InterPro:IPR008967"
                     /db_xref="InterPro:IPR018186"
                     /db_xref="UniProtKB/Swiss-Prot:O15178"
                     /protein_id="CAA04938.1"
                     /translation="MSSPGTESAGKSLQYRVDHLLSAVENELQAGSEKGDPTERELRV
                     GLEESELWLRFKELTNEMIVTKNGRRMFPVLKVNVSGLDPNAMYSFLLDFVAADNHRW
                     KYVNGEWVPGGKPEPQAPSCVYIHPDSPNFGAHWMKAPVSFSKVKLTNKLNGGGQIML
                     NSLHKYEPRIHIVRVGGPQRMITSHCFPETQFIAVTAYQNEEITALKIKYNPFAKAFL
                     DAKERSDHKEMMEEPGDSQQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSC
                     DRYPTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNWSSLGMPAHPSMLPV
                     SHNASPPTSSSQYPSLWSVSNGAVTPGSQAAAVSNGLGAQFFRGSPAHYTPLTHPVSA
                     PSSSGSPLYEGAAAATDIVDSQYDAAAQGRLIASWTPVSPPSM"
BASE COUNT          509 a          628 c          581 g          462 t
ORIGIN
        1 tcccgggtct gtgccgggac ccgggacccg ggagccgtcg caggtctcgg tccaaggggc
       61 cccttttctc ggaagggcgg cggccaagag cagggaaggt ggatctcagg tagcgagtct
      121 gggcttcggg gacggcgggg aggggagccg gacgggagga tgagctcccc tggcaccgag
      181 agcgcgggaa agagcctgca gtaccgagtg gaccacctgc tgagcgccgt ggagaatgag
      241 ctgcaggcgg gcagcgagaa gggcgacccc acagagcgcg aactgcgcgt gggcctggag
      301 gagagcgagc tgtggctgcg cttcaaggag ctcaccaatg agatgatcgt gaccaagaac
      361 ggcaggagga tgtttccggt gctgaaggtg aacgtgtctg gcctggaccc caacgccatg
      421 tactccttcc tgctggactt cgtggcggcg gacaaccacc gctggaagta cgtgaacggg
      481 gaatgggtgc cggggggcaa gccggagccg caggcgccca gctgcgtcta catccacccc
      541 gactcgccca acttcggggc ccactggatg aaggctcccg tctccttcag caaagtcaag
      601 ctcaccaaca agctcaacgg agggggccag atcatgctga actccttgca taagtatgag
      661 cctcgaatcc acatagtgag agttgggggt ccacagcgca tgatcaccag ccactgcttc
      721 cctgagaccc agttcatagc ggtgactgct tatcagaacg aggagatcac agctcttaaa
      781 attaagtaca atccatttgc aaaagctttc cttgatgcaa aggaaagaag tgatcacaaa
      841 gagatgatgg aggaacccgg agacagccag caacctgggt actcccaatg ggggtggctt
      901 cttcctggaa ccagcaccct gtgtccacct gcaaatcctc atcctcagtt tggaggtgcc
      961 ctctccctcc cctccacgca cagctgtgac aggtacccaa ccctgaggag ccaccggtcc
     1021 tcaccctacc ccagccccta tgctcatcgg aacaattctc caacctattc tgacaactca
     1081 cctgcatgtt tatccatgct gcaatcccat gacaattggt ccagccttgg aatgcctgcc
     1141 catcccagca tgctccccgt gagccacaat gccagcccac ctaccagctc cagtcagtac
     1201 cccagcctgt ggtctgtgag caacggcgcc gtcaccccgg gctcccaggc agcagccgtg
     1261 tccaacgggc tgggggccca gttcttccgg ggctcccccg cgcactacac acccctcacc
     1321 catccggtct cggcgccctc ttcctcggga tccccactgt acgaaggggc ggccgcggcc
     1381 acagacatcg tggacagcca gtacgacgcc gcagcccaag gccgcctcat agcctcatgg
     1441 acacctgtgt cgccaccttc catgtgaagc agcaaggccc aggtcccgaa agatgcagtg
     1501 actttttgtc gtggcagcca gtggtgactg gattgaccta ctaggtaccc agtggcagtc
     1561 tcaggttaag aaggaaatgc agcctcagta acttcctttt caaagcagtg gaggagcaca
     1621 cggacctttc cccagagccc ccagcatccc ttgctcacac ctgcagtagc ggtgctgtcc
     1681 aggtggctta cagatgaacc caactgtgga gatgatgcag ttggcccaac ctcactgacg
     1741 gtgaaaaaat gtttgccagg gtccagaaac tttttttggt ttatttctca tacagtgtat
     1801 tggcaacttt ggcacaccag aatttgtaaa ctccaccagt cctactttag tgagataaaa
     1861 agcacactct taatcttctt ccttgttgct ttcaagtagt tagagttgag ctgttaagga
     1921 cagaataaaa tcatagttga ggacagcagg ttttagttga attgaaaatt tgactgctct
     1981 gccccctaga atgtgtgtat tttaagcata tgtagctaat ctcttgtgtt aaactataac
     2041 tgtttcatat ttttcttttg acaaagtagc caaagacaat cagcagaaag cattttctgc
     2101 aaaataaacg caatatgcaa aatgtgattc gtccagttat tagtgaagcc cctccttttg
     2161 tgagtattta ctgtttattg
//