LOCUS       AF520698                2166 bp    mRNA    linear   HUM 29-JUL-2002
DEFINITION  Homo sapiens scotin mRNA, complete cds.
ACCESSION   AF520698
VERSION     AF520698.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2166)
  AUTHORS   Bourdon,J.C., Renzing,J., Robertson,P.L., Fernandes,K.N. and
            Lane,D.P.
  TITLE     Scotin, a novel p53-inducible proapoptotic protein located in the
            ER and the nuclear membrane
  JOURNAL   J. Cell Biol. 158 (2), 235-246 (2002)
   PUBMED   12135983
REFERENCE   2  (bases 1 to 2166)
  AUTHORS   Bourdon,J.C., Renzing,J. and Lane,D.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-JUN-2002) Surgery & Molecular Oncology, University of
            Dundee, Ninewells Hospital, Dundee DD1 9SY, UK
FEATURES             Location/Qualifiers
     source          1..2166
                     /db_xref="H-InvDB:HIT000081153"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="3"
                     /map="3p21.31"
     CDS             135..857
                     /note="pro-apoptotic protein; located in the endoplasmic
                     reticulum and the nuclear membrane; contains a putative
                     transmembrane domain"
                     /codon_start=1
                     /product="scotin"
                     /protein_id="AAM74232.1"
                     /db_xref="GI:21668105"
                     /translation="MTAPVPAPRILLPLLLLLLLTPPPGARGEVCMASRGLSLFPESC
                     PDFCCGTCDDQYCCSDVLKKFVWSEERCAVPEASVPASVEPVEQLGSALRFRPGYNDP
                     MSGFGATLAVGLTIFVLSVVTIIICFTCSCCCLYKTCRRPRPVVTTTTSTTVVHAPYP
                     QPPSVPPSYPGPSYQGYHTMPPQPGMPAAPYPMQYPPPYPAQPMGPPAYHETLAGGAA
                     APYPASQPPYNPAYMDAPKAAL"
BASE COUNT          360 a          676 c          618 g          512 t
ORIGIN      
        1 cggacagagg ttccgggaac cagccgggcc ggggcggggc ggggcgaggg agaggggcgg
       61 ccgcgcggat cactgaggct gtggcggcac tgcgcccggc gctcgcgtcc gtccgcccgt
      121 ccgcccgccc agccatgact gcgccggtcc ccgcgccgcg gatcctgttg ccgttgctgt
      181 tgctgctgct gctaacgccg cctccgggtg cacgtggtga ggtgtgtatg gcttcccgtg
      241 gactcagcct cttccccgag tcctgtccag atttctgctg tggtacctgt gatgaccaat
      301 actgctgctc tgacgtgctg aagaaatttg tgtggagcga ggaaaggtgt gctgtgcctg
      361 aggccagcgt gcctgccagt gtagagccgg tggagcagct gggctcggcg ctgaggtttc
      421 gccctggcta caacgacccc atgtcagggt tcggagcgac cttggccgtt ggcctgacca
      481 tctttgtgct gtctgtcgtc actatcatca tctgcttcac ctgctcctgc tgctgccttt
      541 acaagacgtg ccgccgacca cgtccggttg tcaccaccac cacatccacc actgtggtgc
      601 atgcccctta tcctcagcct ccaagtgtgc cgcccagcta ccctggacca agctaccagg
      661 gctaccacac catgccgcct cagccaggga tgccagcagc accctaccca atgcagtacc
      721 caccacctta cccagcccag cccatgggcc caccggccta ccacgagacc ctggctggag
      781 gagcagccgc gccctacccc gccagccagc ctccttacaa cccggcctac atggatgccc
      841 cgaaggcggc cctctgagca ttccctggcc tctctggctg ccacttggtt atgttgtgtg
      901 tgtgcgtgag tggtgtgcag gcgcggttcc ttacgcccca tgtgtgctgt gtgtgtccag
      961 gcacggttcc ttacgcccca tgtgtgctgt gtgtgtcctg cctgtatatg tggcttcctc
     1021 tgatgctgac aaggtgggga acaatccttg ccagagtggg ctgggaccag actttgttct
     1081 cttcctcacc tgaaattatg cttcctaaaa tctcaagcca aactcaaaga atggggtggt
     1141 ggggggcacc ctgtgaggtg gcccctgaga ggtgggggcc tctccagggc acatctggag
     1201 ttcttctcca gcttacccta gggtgaccaa gtagggcctg tcacaccagg gtggcgcagc
     1261 tttctgtgtg atgcagatgt gtcctggttt cggcagcgta gccagctgct gcttgaggcc
     1321 atggctcgtc cccggagttg ggggtacccg ttgcagagcc agggacatga tgcaggcgaa
     1381 gcttgggatc tggccaagtt ggactttgat cctttgggca gatgtcccat tgctccctgg
     1441 agcctgtcat gcctgttggg gatcaggcag cctcctgatg ccagaacacc tcaggcagag
     1501 ccctactcag ctgtacctgt ctgcctggac tgtcccctgt ccccgcatct cccctgggac
     1561 cagctggagg gccacatgca cacacagcct agctgccccc agggagctct gctgcccttg
     1621 ctggccctgc ccttcccaca ggtgagcagg gctcctgtcc accagcacac tcagttctct
     1681 tccctgcagt gttttcattt tattttagcc aaacattttg cctgttttct gtttcaaaca
     1741 tgatagttga tatgagactg aaacccctgg gttgtggagg gaaattggct cagagatgga
     1801 caacctggca actgtgagtc cctgcttccc gacaccagcc tcatggaata tgcaacaact
     1861 cctgtacccc agtccacggt gttctggcag cagggacacc tgggccaatg ggccatctgg
     1921 accaaaggtg gggtgtgggg ccctggatgg cagctctggc ccagacatga atacctcgtg
     1981 ttcctcctcc ctctattact gtttcaccag agctgtctta gctcaaatct gttgtgtttc
     2041 tgagtctagg gtctgtacac ttgtttataa taaatgcaat cgtttggagc tgctgccccc
     2101 tttcttcctg gcctcggctg ctggaattgg aatcaggctg tactctttcc atccatttgg
     2161 gcttct
//