LOCUS       AF432222                2100 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens CLL-associated antigen KW-9 mRNA, partial cds.
ACCESSION   AF432222
VERSION     AF432222.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2100)
  AUTHORS   Krackhardt,A.M., Witzens,M., Harig,S., Hodi,F.S., Zauls,A.J.,
            Chessia,M., Barrett,P. and Gribben,J.G.
  TITLE     Identification of novel tumor antigens in CLL by SEREX: Assessment
            of their potential as targets for immunotherapeutic approaches
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 2100)
  AUTHORS   Krackhardt,A.M., Witzens,M., Harig,S., Hodi,F.S., Zauls,A.J.,
            Chessia,M., Barrett,P. and Gribben,J.G.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-OCT-2001) Adult Oncology, Dana Farber Cancer
            Institute, 44, Binney Street, Boston, MA 02115, USA
FEATURES             Location/Qualifiers
     source          1..2100
                     /db_xref="H-InvDB:HIT000079608"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="20"
                     /map="20p11.21"
     CDS             <1..609
                     /note="similar to glycogen phosphorylase"
                     /codon_start=1
                     /product="CLL-associated antigen KW-9"
                     /protein_id="AAL99928.1"
                     /translation="KVIFLENYRVSLAEKVIPAADLSQQISTAGTEASGTGNMKFMLN
                     GALTIGTMDGANVEMAEEAGAENLFIFGLRVEDVEALDRKGYNAREYYDHLPELKQAV
                     DQISSGFFSPKEPDCFKDIVNMLMHHDRFKVFADYEAYMQCQAQVDQLYRNPKEWTKK
                     VIRNIACSGKFSSDRTITEYAREIWGVEPSDLQIPPPNIPRD"
BASE COUNT          417 a          599 c          613 g          471 t
ORIGIN      
        1 aaagtgatct tcctggagaa ctaccgtgtg tccttggctg agaaagtgat cccggccgct
       61 gatctgtcgc agcagatctc cactgcaggc accgaggcct caggcacagg caacatgaag
      121 ttcatgctca acggggccct caccatcggc accatggacg gcgccaacgt ggagatggcc
      181 gaggaggccg gggccgagaa cctcttcatc ttcggcctgc gggtggagga tgtcgaggcc
      241 ttggaccgga aagggtacaa tgccagggag tactacgacc acctgcccga gctgaagcag
      301 gccgtggacc agatcagcag tggctttttt tctcccaagg agccagactg cttcaaggac
      361 atcgtgaaca tgctgatgca ccatgacagg ttcaaggtgt ttgcagacta tgaagcctac
      421 atgcagtgcc aggcacaggt ggaccagctg taccggaacc ccaaggagtg gaccaagaag
      481 gtcatcagga acatcgcctg ctcgggcaag ttctccagtg accggaccat cacggagtat
      541 gcacgggaga tctggggtgt ggagccctcc gacctgcaga tcccgccccc caacatcccc
      601 cgggactagg cacaccctgc cttggcggga ccagcgggca tttgttttct tgctgacttt
      661 gcacctcttt ttttccccaa acactttgcc agccactggt ggtccctgct tttctgagta
      721 ccatgtttcc aggaggggcc atgggggtca gggtggtttt gagagagcag ggtaaggaag
      781 gaatgtgcta gaagtgctcc tagtttcttg taaaggaagc cagagttgac agtacaaagg
      841 gtcgtggcca gccctgcagc ttcagcacct gccccaccca gagtgggagt caggtggagc
      901 cacctgctgg gctcccccag aactttgcac acatcttgct atgtattagc cgatgtcttt
      961 agtgttgagc ctctggattc tggggtctgg gccagtggcc atagtgaagc ctgggaatga
     1021 gtgttactgc agcatctggg ctgccagcca cagggaaggg ccaagcccca tgtagcccca
     1081 gtcatcctgc ccagccctgc ctcctggcca tgccgggagg ggtcggatcc tctaggcatc
     1141 gccttcacag ccccctgccc cctgccctct gtcctggctc tgcacctggt atatgggtca
     1201 tggacccaga tggggctttc cctttgtagc catccaatgg gcattgtgtg ggtgcttgga
     1261 acccgggatg actgaggggg acactggagt gggtgcttgt gtctgctgtc tcagaggcct
     1321 tggtcaggat gaagttggct gacacagctt agcttggttt tgcttattca aaagagaaaa
     1381 taactacaca tggaaatgaa actagctgaa gccttttctt gttttagcaa ctgaaaattg
     1441 tacttggtca cttttgtgct tgaggaggcc cattttctgc ctggcagggg gcaggtctgt
     1501 gccctcccgc tgactcctgc tgtgtcctga ggtgcatttc ctgttgtaca cacaagggcc
     1561 aggctccatt ctccctccct ttccaccagt gccacagcct cgtctggaaa aaggaccagg
     1621 ggtcccggag gaacccattt gtgctctgct tggacagcag gcctggcact gggaggtggg
     1681 ggtgagcccc tcacagcctt gcccctcccc aaggctggca acctgcctcc cattgcccaa
     1741 gagagagggc agggaacagg ctactgtcct tccctgtgga attgccgaga aatctagcac
     1801 cttgcatgct ggatctgggc tgcggggagg ctctttttct ccctggcctc cagtgcccac
     1861 caggaggatc tgcgcacggt gcacagccca ccagagcact acagcctttt attgagtggg
     1921 gcaagtgctg ggctgtggtc gtgccctgac agcatcttcc ccaggcagcg gctctgtgga
     1981 ggaggccata ctcccctagt tggccactgg ggccaccacc ctgaccacca ctgtgcccct
     2041 cattgttact gccttgtgag ataaaaactg attaaacctt tgtggctgtg gttggctgac
//