LOCUS       AY244357                6496 bp    mRNA    linear   HUM 07-MAR-2006
DEFINITION  Homo sapiens alpha 1 type XXIV collagen precursor, mRNA, complete
            cds.
ACCESSION   AY244357 AF410793
VERSION     AY244357.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 6496)
  AUTHORS   Koch,M., Laub,F., Zhou,P., Hahn,R.A., Tanaka,S., Burgeson,R.E.,
            Gerecke,D.R., Ramirez,F. and Gordon,M.K.
  TITLE     Collagen XXIV, a vertebrate fibrillar collagen with structural
            features of invertebrate collagens: selective expression in
            developing cornea and bone
  JOURNAL   J. Biol. Chem. 278 (44), 43236-43244 (2003)
   PUBMED   12874293
REFERENCE   2  (bases 1 to 6496)
  AUTHORS   Matsuo,N., Tanaka,S., Gordon,M.K., Koch,M., Yoshioka,H. and
            Ramirez,F.
  TITLE     CREB-AP1 protein complexes regulate transcription of the collagen
            XXIV gene (Col24a1) in osteoblasts
  JOURNAL   J. Biol. Chem. 281 (9), 5445-5452 (2006)
   PUBMED   16373341
REFERENCE   3  (bases 1 to 6496)
  AUTHORS   Koch,M., Jin,W. and Burgeson,R.E.
  TITLE     Alpha 1(XXIV) Collagen, a New Member of the Collagen Subfamily
  JOURNAL   Unpublished
REFERENCE   4  (bases 1 to 6496)
  AUTHORS   Koch,M., Jin,W. and Burgeson,R.E.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-AUG-2001) CBRC, Mass General Hospital, 13th Street
            Bldg 149, Charlestown, MA 02129, USA
REFERENCE   5  (bases 1 to 6496)
  AUTHORS   Koch,M., Laub,F., Zhou,P., Hahn,R.A., Tanaka,S., Burgeson,R.E.,
            Gerecke,D.R., Ramirez,F. and Gordon,M.K.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-FEB-2003) Pharmacology and Toxicology, Rutgers, The
            State University of New Jersey, 170 Frelinghuysen Road, Piscataway,
            NJ 08854, USA
COMMENT     On Jul 1, 2003 this sequence version replaced gi:22652222.
FEATURES             Location/Qualifiers
     source          1..6496
                     /db_xref="H-InvDB:HIT000251179"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /tissue_type="cartilage"
     5'UTR           1..32
     CDS             33..5177
                     /note="COL24A1"
                     /codon_start=1
                     /product="alpha 1 type XXIV collagen precursor"
                     /protein_id="AAP80185.1"
                     /db_xref="GI:32364065"
                     /translation="MHLRAHRTRRGKVSPTAKTKSLLHFIVLCVAGVVVHAQEQGIDI
                     LHQLGLGGKDVRHSSPVTAVPSASTPLPQGVHLTESGVIFKNDAYIETPFVKILPVNL
                     GQPFTILTGLQSHRVNNAFLFSIRNKNRLQLGVQLLPKKLVVHIRGKQPAVFNYSVHD
                     EQWHSFAITIRNQSVSMFVECGKKYFSTETIPEVQTFDSNSVFTLGSMNNNSIHFEGI
                     VCQLDIIPSAEASADYCRYVKQQCRQADKYQPETSIPCTTLIPTKIPEHSPPPKLFAE
                     KVLSEDTFTEGKSIPNIIKNDSETVYKRQEHQISRSQLSSLQSGNVSAVDLTNHGIQA
                     KEMITEEDTQTNFSLSVTTHRISEAKMNTKEKFSSLLNMSDNITQHDDRVTGLSLFKK
                     MPSILPQIKQDTITNLKKAITANLHTNELMEMQPILNTSLHRVTNEPSVDNHLDLRKE
                     GEFYPDATYPIENSYETELYDYYYYEDLNTMLEMEYLRGPKGDTGPPGPPGPAGIPGP
                     SGKRGPRGIPGPHGNPGLPGLPGPKGPKGDPGFSPGQSVPGEKGDQGLSGLMGPPGMQ
                     GDKGLKGHPGLPGLPGEQGIPGFAGNIGSPGYPGRQGLAGPEGNPGPKGAQGFIGSPG
                     EAGQLGPEGERGIPGIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGL
                     RGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGYSGDKGAVGLP
                     GPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPG
                     PPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEGLKGEVGDQGNIGKIGETGP
                     VGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGAR
                     GPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQG
                     KPGLQGLPGSTGDRGLPGEPGLRGLQGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGD
                     VGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGEKGEMGLPGII
                     GPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKG
                     ARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPG
                     PRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGS
                     EGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIR
                     GGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQG
                     PCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHRGNTGPLGR
                     EGIIGPTGRTGPRGEKGFRGETGPQGPRGQPGPPGPPGAPGPRKQMDINAAIQALIES
                     NTALQMESYQNTEVTLIDHSEEIFKTLNYLSNLLHSIKNPLGTRDNPARICKDLLNCE
                     QKVSDGKYWIDPNLGCPSDAIEVFCNFSAGGQTCLPPVSVTKLEFGVGKVQMNFLHLL
                     SSEATHIITIHCLNTPRWTSTQTSGPGLPIGFKGWNGQIFKVNTLLEPKVLSDDCKIQ
                     DGSWHKATFLFHTQEPNQLPVIEVQKLPHLKTERKYYIDSSSVCFL"
     sig_peptide     33..146
     misc_feature    147..1676
                     /note="Region: N propeptide"
     misc_feature    1497..1658
                     /note="Region: minor triple helix"
     misc_feature    1677..4469
                     /note="Region: major triple helix"
     misc_feature    3621..3632
                     /note="Region: STLV imperfection in major triple helix"
     misc_feature    4470..5174
                     /note="Region: C propeptide"
     misc_feature    3621..3632
                     /note="STLV imperfection in major triple helix"
     3'UTR           5178..6496
BASE COUNT         2008 a         1273 c         1607 g         1608 t
ORIGIN      
        1 tgttttccgt tagcgctttg ctgcacggac aaatgcattt aagagcccac agaacaaggc
       61 gtggaaaagt ctcccccacg gcaaaaacga aatcacttct tcattttatt gtactatgtg
      121 tggctggggt ggttgttcat gcacaagaac aaggcataga tattcttcat caactaggcc
      181 ttggaggcaa agacgtaaga cactcatcac cagtgactgc tgtaccatca gcatctacac
      241 cgttacctca gggggtccat ttaacagaat caggagtcat ttttaaaaat gatgcttata
      301 tcgagacacc tttcgtgaaa attttaccag tcaacttggg gcagccgttt acaatattaa
      361 ctgggttaca gtcacatcgg gtgaacaatg catttctctt cagcattaga aataaaaata
      421 gactgcaatt aggagtacaa ttactaccta aaaaattagt agtacacatt agaggaaagc
      481 agcctgcagt tttcaactac agtgttcatg atgagcaatg gcactcattt gccattacta
      541 ttagaaacca aagtgtctca atgtttgttg agtgtggaaa gaaatatttt agcacagaga
      601 ctattccaga agttcagacc tttgattcta atagtgtgtt tactttagga agtatgaata
      661 ataattctat ccattttgaa ggaatagtat gtcagttaga tattattcct tctgcagaag
      721 catctgcaga ctactgcaga tatgtgaaac agcagtgtcg ccaagcagac aaataccaac
      781 ctgaaacaag cattccttgt acaactctca taccaacaaa gataccggaa cactctcccc
      841 cgcccaaact atttgctgaa aaagtactgt cagaggatac atttactgaa ggcaaaagca
      901 ttccaaatat cataaaaaat gattctgaaa ccgtgtataa aagacaagaa caccagatat
      961 caagatctca gttatcttct cttcagtcag gaaatgtctc tgctgtggat ctcacaaacc
     1021 atgggattca ggccaaagaa atgatcactg aggaagatac tcagacaaat ttcagcctgt
     1081 cagtgaccac tcatcgcatc agtgaggcaa aaatgaatac caaagagaaa tttagttctc
     1141 tcctaaacat gtctgacaat atcacacaac atgatgatag agtaactggt ctgtcactgt
     1201 ttaagaagat gccatctatt cttccacaaa ttaaacaaga tacaattact aatctcaaga
     1261 aggctatcac agcaaatcta cacactaacg aactcatgga aatgcaacca attttaaaca
     1321 caagcttgca tagagtgaca aatgagccat ctgtggataa tcaccttgat ctaaggaaag
     1381 aaggtgaatt ttatcctgat gctacttatc ccatcgaaaa tagctatgaa actgagcttt
     1441 atgattatta ttattatgag gatctaaata caatgcttga aatggagtat ctgagagggc
     1501 caaaaggaga cactggacct cccggtccac ctggtccagc aggtatccca ggtccgtcag
     1561 ggaagagagg tccacggggc ataccagggc cacatggaaa tcctggttta cctggattac
     1621 ctggtccaaa gggccccaaa ggagatccag gattttcccc aggtcaatct gttcctggag
     1681 aaaagggtga tcaaggcctt tctggattaa tgggcccccc tggtatgcaa ggtgataagg
     1741 gtctcaaagg acatcctgga ctcccaggac ttccaggtga acaaggaatt ccaggatttg
     1801 ctggtaatat tggttcaccc ggttaccctg gcaggcaggg tttagctgga ccagaaggta
     1861 atccaggtcc taaaggtgca caaggtttta ttggctctcc tggagaagcg ggacaactgg
     1921 gacctgaagg agaacggggc attcctggga tccgtggaaa gaagggtttt aaggggagac
     1981 agggttttcc aggtgacttt ggagacagag gccctgctgg tcttgatggc agtcctggac
     2041 ttgtaggtgg cactggtcct ccggggtttc ctgggcttag aggcagtgtt ggccctgtgg
     2101 gaccaattgg acctgctgga attcctggcc caatgggcct ttcagggaat aaaggactac
     2161 ctggaatcaa aggtgataag ggtgaacaag gcacagcagg agagctagga gaacccgggt
     2221 attctggaga caagggtgct gttggtttac caggaccacc agggatgaga ggaaagtcag
     2281 ggccttcagg ccaaacaggt gacccaggac tccaaggacc atctggccct ccaggaccag
     2341 agggttttcc aggagatatt gggattcctg gacaaaacgg ccctgaagga ccaaagggac
     2401 tccttggaaa tagaggacct cctggacctc ctggtctcaa aggaactcag ggagaagaag
     2461 gaccaattgg agcctttggg gaactggggc caagaggaaa accaggtcaa aaggggtatg
     2521 caggtgaacc aggaccagaa ggcttaaagg gagaagtagg agatcaagga aatattggaa
     2581 aaattggtga aacaggacct gttggcttac ctggagaagt tgggatgact ggaagcattg
     2641 gcgaaaaggg agaacgtgga agtccaggcc cactaggtcc ccagggagaa aaaggtgtta
     2701 tgggatatcc aggtcctcct ggggttccag gacctatcgg tccattggga ttacctggtc
     2761 atgtgggggc aagaggacca cctgggagtc aaggtcctaa aggacaaaga ggatcaagag
     2821 gaccagatgg tctcttaggg gaacaaggta tacaaggtgc caagggtgaa aaaggagatc
     2881 aaggaaaaag agggcctcat ggtcttattg gtaagactgg aaaccctgga gaaagaggat
     2941 ttcaagggaa accaggttta cagggattgc ctggaagtac aggtgacaga ggacttccag
     3001 gagagccagg actgcgagga ctgcaaggtg atgttggacc tcctggagaa atgggcatgg
     3061 agggacctcc aggcactgag ggagagtctg gtctgcaagg tgaaccaggt gcaaagggag
     3121 atgttggaac tgctggcagt gttggaggaa ctggggaacc aggtttacgg ggtgaaccag
     3181 gagctcctgg agaagaaggt ctccagggaa aagatgggtt aaagggagta ccaggaggaa
     3241 ggggacttcc tggagaggat ggagaaaaag gagagatggg cttaccagga attataggac
     3301 ccttgggtag atcaggccaa acaggccttc cgggacctga aggaattgtg ggaattccag
     3361 ggcaaagagg tcgtccagga aaaaagggtg ataaaggaca aataggaccc acaggagaag
     3421 ttggaagcag aggtcctcct ggaaaaattg ggaaaagtgg tcctaagggt gccagaggaa
     3481 ctagaggtgc tgtgggacat ttaggattga tgggacctga tggagaacca ggaattccag
     3541 ggtacagggg ccatcagggc caaccaggac cctctggatt gccaggacct aaaggagaaa
     3601 agggctaccc aggagaagat agcacagtcc taggaccacc tgggcctcga ggtgaaccag
     3661 gtccagtggg ggaccaagga gagagaggag agcctggagc agagggatat aagggccatg
     3721 tgggtgtacc aggactaaga ggtgccactg gacaacaagg acccccaggc gaaccaggtg
     3781 accagggtga acaaggacta aaaggagaga gaggatctga aggtaataag gggaaaaaag
     3841 gagctcctgg tccttctggg aaacctggga ttcctggact tcaaggccta cttgggccaa
     3901 aaggcataca aggataccat ggagcagatg gcatttcagg aaaccctgga aaaattgggc
     3961 caccaggaaa acagggactt cctggcatca gaggcggccc aggaagaaca ggtcttgctg
     4021 gggctccagg tcctccagga gtaaagggtt catcaggctt gccaggaagc ccaggaattc
     4081 aaggcccaaa gggtgaacaa gggctacctg gtcaacctgg aattcaaggt aaaagaggtc
     4141 accgaggagc acaaggtgat caaggaccat gtggagaccc tggcctgaaa gggcagcctg
     4201 gagaatatgg tgttcaaggt ttgacaggtt tccaaggatt cccaggccct aaaggtcctg
     4261 aaggggatgc tggcattgtt gggatatcag gtcctaaagg tcctattgga cacagaggaa
     4321 acactggtcc ccttggcaga gaaggtataa taggcccaac aggtagaact ggacccagag
     4381 gtgaaaaggg ctttagaggt gaaactggtc ctcaaggacc aagaggtcaa ccagggcctc
     4441 caggtccacc tggagcacca ggcccaagaa agcaaatgga tatcaatgct gctattcaag
     4501 ccttgattga atcaaatact gccctacaga tggagagcta ccagaatact gaagtgactt
     4561 taattgacca cagtgaagag atattcaaaa ccctgaacta ccttagcaat ttattgcaca
     4621 gcatcaagaa tcctcttggc acacgagata acccagcacg aatctgcaaa gatttactta
     4681 actgtgaaca aaaagtatca gatggaaaat actggattga cccaaatctt ggctgtcctt
     4741 cagatgccat tgaggttttc tgcaatttca gtgctggtgg ccagacatgc ttacctcctg
     4801 tttctgtaac aaagttggag tttggagttg ggaaagtcca gatgaacttc cttcatttac
     4861 tgagttcgga agccacccat atcatcacca ttcactgtct aaacacccca aggtggacaa
     4921 gcacacaaac aagtggccca ggattgccta ttggtttcaa gggatggaat ggccagattt
     4981 ttaaagtaaa cactctactt gaacctaaag tgctttcaga tgactgcaag attcaagatg
     5041 gcagctggca taaggcaaca tttctttttc acacccagga acctaatcaa cttccagtga
     5101 ttgaagtaca aaaacttcct catctcaaaa ctgaacgaaa gtattacatt gacagcagtt
     5161 ctgtatgctt tctgtaaagt ctctgaatta gttccgaatt caggctgttg gccaggtaat
     5221 tgctgcagag ggagaaataa gacagacaga tacagtcatt atgaaatgca tgtaataaag
     5281 cattggctaa atcttaaaga atctcaggaa gaacagactt cctcctaaga aggagaaaag
     5341 gcatttttaa aggactatga ttgataaagt atttaattct tttaaaaatt atattcatct
     5401 cagctttctt agagaattcc ctagaactaa aaatttataa atatggaatt cttcagggta
     5461 tcttatattt ttgactgagt gcgtagtacc cattagacag ctggagatgc agagcactat
     5521 ggagcaatac tggctaatgc ttccagatgt gcactgcttc tgtctaaaaa ttacaagcca
     5581 cagtctaata tgtcttattt tccaaaacac taagctgtat tcaggtcccc gatgggcata
     5641 tacatcttag ccggtgatac actacctctt acgtgttgcc tctttgtgtt gcttggtgct
     5701 ctttcgaaaa caaggtgctt atggctttca tagactattt cctttttcat ctttgtcatt
     5761 ctttaaaagt gtatgtactg gttacatcaa gatatgtttt ggttgttagt acttatttta
     5821 atttgtttgg tcacacactt aataacacgt gaaactattt atgtgaagtc cttgttttat
     5881 tttaaaattc tctttgtgta tttggaatca aagccagcac attgtaacct gtgcttgtac
     5941 gcaaaagaat tagatttctt tgtttttgtt ttatttttta aattgttgta aaaattatta
     6001 taggccagct acatctagta gtaggtttgg ggtacagatt gggggttgtg ccatactgtt
     6061 tttaaagttc atgatcatct ggaatgatac ttagtgtata tatattttgt aaagttttaa
     6121 ttcagcaaat tttttgaaat tgctgctgtt ttaaattata aaacctttat atttctgctt
     6181 tgtagaaatt atatgttttg tagtattcat tgattttctt tcactgtact taaatttagt
     6241 gttagtactt taaaattttt aatttaccag tctttaaagc aacatccaga aaaaaaaagt
     6301 cttttcccat ttaaaatagg ctcagccagt tcaatgtctc cttgttatca gagaaatgtt
     6361 agttcaatac tgaaagaaaa atattatacc tcttggtatc tagaaaagct tgttcatcca
     6421 ttataaatat atctttagcc acagcaaacc acacttaacc tatctataat aaaaatgtgc
     6481 tttaaataaa aaaaaa
//