LOCUS       AF360739                3331 bp    mRNA    linear   HUM 08-OCT-2001
DEFINITION  Homo sapiens SSA protein SS-56 (SS-56) mRNA, complete cds.
ACCESSION   AF360739
VERSION     AF360739.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3331)
  AUTHORS   Billaut-Mulot,O., Cocude,C., Kolesnitchenko,V., Truong,M.J.,
            Chan,E.K., Hachula,E., de la Tribonniere,X., Capron,A. and
            Bahr,G.M.
  TITLE     SS-56, a novel cellular target of autoantibody responses in Sjogren
            syndrome and systemic lupus erythematosus
  JOURNAL   J. Clin. Invest. 108 (6), 861-869 (2001)
   PUBMED   11560955
REFERENCE   2  (bases 1 to 3331)
  AUTHORS   Billaut-Mulot,O., Cocude,C., Kolesnitchenko,V., Truong,M.J.,
            Chan,E., Capron,A. and Bahr,G.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAR-2001) Laboratoire d'Immunologie moleculaire de
            l'Infection et de l'Inflammation, Institut Pasteur de Lille, rue du
            Professeur Calmette, Lille 59019, France
FEATURES             Location/Qualifiers
     source          1..3331
                     /db_xref="H-InvDB:HIT000078346"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     gene            1..3331
                     /gene="SS-56"
     CDS             244..1701
                     /gene="SS-56"
                     /note="SSA protein family member; 56 kDa"
                     /codon_start=1
                     /product="SSA protein SS-56"
                     /protein_id="AAL11501.1"
                     /db_xref="GI:15982946"
                     /translation="MDPTALVEAIVEEVACPICMTFLREPMSIDCGHSFCHSCLSGLW
                     EIPGESQNWGYTCPLCRAPVQPRNLRPNWQLANVVEKVRLLRLHPGMGLKGDLCERHG
                     EKLKMFCKEDVLIMCEACSQSPEHEAHSVVPMEDVAWEYKWELHEALEHLKKEQEEAW
                     KLEVGERKRTATWKIQVETRKQSIVWEFEKYQRLLEKKQPPHRQLGAEVAAALASLQR
                     EAAETMQKLELNHSELIQQSQVLWRMIAELKERSQRPVRWMLQDIQEVLNRSKSWSLQ
                     QPEPISLELKTDCRVLGLREILKTYAADVRLDPDTAYSRLIVSEDRKRVHYGDTNQKL
                     PDNPERFYRYNIVLGSQCISSGRHYWEVEVGDRSEWGLGVCKQNVDRKEVVYLSPHYG
                     FWVIRLRKGNEYRAGTDEYPILSLPVPPRRVGIFVDYEAHDISFYNVTDYGSHIFTFP
                     RYPFPGRLLPYFSPCYSIGTNNTAPLAICSLDGED"
     misc_feature    292..426
                     /gene="SS-56"
                     /note="Region: zinc finger domain"
     misc_feature    538..624
                     /gene="SS-56"
                     /note="Region: B box cys/his domain"
     misc_feature    922..1005
                     /gene="SS-56"
                     /note="Region: leucine zipper domain"
BASE COUNT          815 a          817 c          891 g          808 t
ORIGIN      
        1 acgcgggggc gggctactgg gcctgcgctg ccgggctttg ggttctgggc ctctgccgct
       61 ctctggccct aagtgctgag ctgccgggaa cggcagcttc tgacgctggg ccattggacg
      121 ctgcggaacc aggcttcttc actttgagtt tccgccgcga agcgccagtc cgggccgagg
      181 agggagcctt tactacttct ccctggtttc attcatgttc tgaggagggt gtgagaagga
      241 accatggatc ccacagcctt ggtggaagcc attgtggaag aagtggcctg tcccatctgt
      301 atgaccttcc tgagggagcc catgagcatt gactgtggcc acagcttctg ccacagctgt
      361 ctctctggac tctgggagat cccaggagaa tcccagaact ggggttacac ctgtcccctc
      421 tgtcgagctc ctgtccagcc aaggaacctg cggcctaatt ggcagctggc caatgttgta
      481 gaaaaagtcc gtctgctaag gctacatcca ggaatggggc tgaagggtga cctgtgtgag
      541 cgccatgggg aaaagctgaa gatgttctgc aaagaggatg tcttgataat gtgtgaggcc
      601 tgcagccagt ccccagagca tgaggcccac agtgttgtgc caatggagga tgttgcctgg
      661 gagtacaagt gggaacttca tgaggccctc gaacatctga agaaagagca agaagaggcc
      721 tggaagcttg aagttggtga aaggaaacga actgccacct ggaagataca ggtggaaacc
      781 cgaaaacaga gtattgtatg ggagtttgaa aaataccagc gattactaga gaaaaagcag
      841 ccaccacatc ggcagctggg ggcagaggta gcagcagctc tggccagcct acagcgggag
      901 gcagcggaga ccatgcagaa actggagttg aaccatagcg agctcatcca gcagagccag
      961 gtcctgtgga ggatgattgc agagttgaaa gagaggtcgc agaggcctgt ccgctggatg
     1021 ttgcaggata ttcaggaagt gttaaacagg agcaaatctt ggagcttgca gcagccagaa
     1081 ccaatctccc tggagttgaa gacagattgc cgtgtgctgg ggctaagaga gatcctgaag
     1141 acttatgcag ctgatgtgcg cttggatcca gatactgctt actcccgtct catcgtgtct
     1201 gaggacagaa aacgtgtgca ctatggagac accaaccaga aactgccaga caatcctgag
     1261 agattttacc gctataatat cgtcctggga agccagtgca tctcctcagg ccggcactac
     1321 tgggaggtgg aggtgggaga caggtctgaa tggggcctgg gagtatgtaa gcaaaatgta
     1381 gaccggaagg aggtggtcta cttatccccc cactatggat tctgggtgat aaggctgagg
     1441 aagggaaatg agtaccgagc aggcaccgat gagtacccaa tcctgtcctt gccggtccct
     1501 cctcgccggg tgggaatctt cgtggattat gaggcccatg acatttcttt ctacaatgtg
     1561 actgactatg gctcccacat cttcactttc ccccgctatc ccttccctgg gcgcctcctg
     1621 ccctatttta gtccttgcta cagcattgga accaacaaca ctgctcctct ggccatctgc
     1681 tccctggatg gggaggacta agaaagctac caccctaacc acagaggctt ggaattgggc
     1741 ctggccccca tggggcttgg aggaccgagc cactgacagg tatcccctga aactgagctg
     1801 agcccagtat ccaaggattc ctctgtctga tcctttggtc tttgctacca ggctgaagtc
     1861 tgtcatgaaa ccacttattt taaaaagcag aggcccagtc aaatgagcat tgcatcccat
     1921 gagggaagca cgacagggct gatggtgagg atcagagcag ttctaaggtg actcgttggg
     1981 gtaaggatca ggactttgtc cattgtagta gccaaccacc ctcttccctg attcccgtcc
     2041 ggtgtcacag ttcagtcagt gaggatgatg aagtagatac agtcttcagg acaccattag
     2101 atgggctttc ccaataggcc aaaaaaatgc tgcgcatacc cagagctggt tgttgtgctg
     2161 aggccagtca gaggatgctt cccctgaggt ttgctatatc taatcaacct ttatgtgact
     2221 ctcaccttct gacctcctgg caagagaaat tcagtgcagc agggggacac agacctgccc
     2281 aagccacccc actgccgttc cctctctgag cacaagctgg gcaaatcact gtcccttgga
     2341 ctccagtaga ccagtgtcct aagtcttgcc ttttttctct aagtggcagg atcagaaaac
     2401 ctgcgaagct ttagtttgta ttttcacact tttatgaatg aggaaactga aaatggcctt
     2461 aagggagcaa gttatttctt tttttttgac acggagtctc gctctgttgc ccaggctgga
     2521 gtgcagtggc acgatctcgg ctcactgcag gctctgcctc ctgggttcac gccattctcc
     2581 tgcctcagct tcccgagtag ctgggactac aggcgcccac cacgacgcct ggctcatttt
     2641 tttgtatttt tagtagagac ggggtttcac catgttagct aggatggtct cgatctcctg
     2701 acctcatgat ccgccctcct cagcctccca cagtgctggg attagaggca tgagccactg
     2761 cgcccggccc ctggagcaag ttatttctta caaagctgct gaaggtaaga ttatcaaaat
     2821 tataaagcat ttttcacact caagtgaaac aaggttgaca aactcacttc gcaggtcaca
     2881 tgcctataca tcacttatta tatttgggtc tgaaacttct cacatgtttg ggaggtttta
     2941 tgtgtcctca ttgggaaaat gggtgtaatt cagcataaaa cctcatatga ttgtcctgcc
     3001 tcatggagct gttgtataga tcccagatcc atcccatgat ttgttcctgt ctgaggcata
     3061 gaggcaggca agccgtggat tttgcacatg gtgactttcc cactgtgcca tgatacagtc
     3121 tgcatcttat agcagtgcct ttgtctcagg gcctctgctg gcagtctaga ccttttgggc
     3181 agaaaggagc ttcaaatggc tgtgataagg aatattaaaa attgtgtttc tactttaatg
     3241 tattggctgt tcatgtatgt aggagttaaa taggccaaac tggagaaata aacgcattct
     3301 gtccgaaaaa aaaaaaaaaa aaaaaaaaaa a
//