LOCUS       AH009405                7574 bp    DNA     linear   HUM 10-JUN-2016
DEFINITION  Homo sapiens chromosome 12 inner nuclear membrane protein (MAN1)
            gene, complete cds.
ACCESSION   AH009405 AF180135 AF180136 AF180137 AF180138 AF180139 AF180140
            AF180141 AF180142 AF263918
VERSION     AH009405.2
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 7574)
  AUTHORS   Lin,F., Blake,D.L., Callebaut,I., Skerjanc,I.S., Holmer,L.,
            McBurney,M.W., Paulin-Levasseur,M. and Worman,H.J.
  TITLE     MAN1, an inner nuclear membrane protein that shares the LEM domain
            with lamina-associated polypeptide 2 and emerin
  JOURNAL   J. Biol. Chem. 275 (7), 4840-4847 (2000)
   PUBMED   10671519
REFERENCE   2  (bases 1 to 7574)
  AUTHORS   Lin,F., Blake,D.L., Callebaut,I., Skerjanc,I.S., Holmer,L.,
            McBurney,M.W., Paulin-Levasseur,M. and Worman,H.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-AUG-1999) GI of Medicine, Columbia University, 630
            West 168 Street, P&S 10-509, New York, NY 10032, USA
COMMENT     On or before Jun 10, 2016 this sequence version replaced
            gi:8132525, gi:8132526, gi:8132527, gi:8132528, gi:8132529,
            gi:8132530, gi:8132531, gi:8132532, gi:8132533, gi:8132524.
FEATURES             Location/Qualifiers
     source          1..7574
                     /organism="Homo sapiens"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:9606"
                     /chromosome="12"
                     /map="12q14"
     gene            <1644..6936
                     /gene="MAN1"
     mRNA            join(<1644..3165,3274..3443,3548..3627,3737..3882,
                     3991..4092,4201..4303,4413..4591,4700..4781,5095..5279,
                     5502..6936)
                     /gene="MAN1"
                     /product="inner nuclear membrane protein"
     CDS             join(1644..3165,3274..3443,3548..3627,3737..3882,
                     3991..4092,4201..4303,4413..4591,4700..4781,5095..5279,
                     5502..5665)
                     /gene="MAN1"
                     /codon_start=1
                     /product="inner nuclear membrane protein"
                     /protein_id="AAF73293.1"
                     /db_xref="GI:8132534"
                     /translation="MAAAAASAPQQLSDEELFSQLRRYGLSPGPVTESTRPVYLKKLK
                     KLREEEQQQHRSGGRGNKTRNSNNNNTAAATVAAAGPAAAAAAGMGVRPVSGDLSYLR
                     TPGGLCRISASGPESLLGGPGGASAAPAAGSKVLLGFSSDESDVEASPRDQAGGGGRK
                     DRASLQYRGLKAPPAPLAASEVTNSNSAERRKPHSWWGARRPAGPELQTPPGKDGAVE
                     DEEGEGEDGEERDPETEEPLWASRTVNGSRLVPYSCRENYSDSEEEDDDDVASSRQVL
                     KDDSLSRHRPRRTHSKPLPPLTAKSAGGRLETSVQGGGGLAMNDRAAAAGSLDRSRNL
                     EEAAAAEQGGGCDQVDSSPVPRYRVNAKKLTPLLPPPLTDMDSTLDSSTGSLLKTNNH
                     IGGGAFSVDSPRIYSNSLPPSAAVAASSSLRINHANHTGSNHTYLKNTYNKPKLSEPE
                     EELLQQFKREEVSPTGSFSAHYLSMFLLTAACLFFLILGLTYLGMRGTGVSEDGELSK
                     NPFGETFGKIQESEKTLMMNTLYKLHDRLAQLAGDHECGSSSQRTLSVQEAAAYLKDL
                     GPEYEGIFNTSLQWILENGKDVGIRCVGFGPEEELTNITDVQFLQSTRPLMSFWCRFR
                     RAFVTVTHRLLLLCLGVVMVCVVLRYMKYRWTKEEEETRQMYDMVVKIIDVLRSHNEA
                     CQENKDLQPYMPIPHVRDSLIQPHDRKKMKKVWDRAVDFLAANESRVRTETRRIGGAD
                     FLVWRWIQPSASCDKILVIPSKVWQGQAFHLDRRNSPPNSLTPCLKIRNMFDPVMEIG
                     DQWHLAIQEAILEKCSDNDGIVHIAVDKNSREGCVYVKCLSPEYAGKAFKALHGSWFD
                     GKLVTVKYLRLDRYHHRFPQALTSNTPLKPSNKHMNSMSHLRLRTGLTNSQGSS"
     exon            <1644..3165
                     /gene="MAN1"
                     /number=1
     gap             3171..3270
                     /estimated_length=unknown
     exon            3274..3443
                     /gene="MAN1"
                     /number=2
     gap             3444..3543
                     /estimated_length=unknown
     exon            3548..3627
                     /gene="MAN1"
                     /number=3
     gap             3633..3732
                     /estimated_length=unknown
     exon            3737..3882
                     /gene="MAN1"
                     /number=4
     gap             3887..3986
                     /estimated_length=unknown
     exon            3991..4092
                     /gene="MAN1"
                     /number=5
     gap             4097..4196
                     /estimated_length=unknown
     exon            4201..4303
                     /gene="MAN1"
                     /number=6
     gap             4309..4408
                     /estimated_length=unknown
     exon            4413..4591
                     /gene="MAN1"
                     /number=7
     gap             4596..4695
                     /estimated_length=unknown
     exon            4700..4781
                     /gene="MAN1"
                     /number=8
     gap             4787..4886
                     /estimated_length=unknown
     exon            5095..5279
                     /gene="MAN1"
                     /number=9
     exon            5502..6936
                     /gene="MAN1"
                     /number=10
BASE COUNT         1903 a         1329 c         1599 g         1943 t
ORIGIN      
        1 gagacggagt ctcgctcttg ttgcccaggc tggagtgcag tggcgcgatc tcggctcatt
       61 gcaacctctg ccttccccgg gatcaagcga ttctcctgcc tcagcctccc gagtagctga
      121 gattacaggc gcctgccacc acgcccggct aatttttttg gatttttagt agagacgggg
      181 tttcaccatg ttggccaggc tggtctcaaa ctcctgacct cgtgatccgt cccctgaccc
      241 ccgccccccg ccccgctccc aaagtgctag gattacaggc gtgagccacc gcgcccggcc
      301 gtatttatgc ttttgactaa cgtttttctg tacaggtgta tagggtaatg taataggtaa
      361 aataactcat tcaacaacaa aaaattattg tagtattttg tagctactag gattgaagta
      421 ctaaagaatt gtctgtctgc caaggtttgg ggaaatggga aaatgggaca agatcttcac
      481 tacatggggc acatttcacc ttcttcttgg aatcaattcc ctatcctgta aatggcaaag
      541 ttgggggttc caggtcttgt ccttgttttt ttgctttgtg tgaaaggttc tcccctacct
      601 gcactaatct tatttcaaat attcatctca tactatcctc tctttgcaat ctttaattca
      661 ttcaacaaat atttattgag ctctactagt attggtgagt aacagaagcc agggtcctcc
      721 cacatggagc ttattattag tccaaaggat agggacataa ataatttttg aaagtaaaca
      781 aatatttatt aataactgat aaataactat tggttggaaa ggtgctaaga aggaaataaa
      841 taggatcatg tgttatgtct ctgagagtct tagaatgaag cagacaagct ctttcacttt
      901 caagtgctga cgtagtaaag tcattaggtt tcaaaaaagg aaaaaaagat aatatcttac
      961 aattaactaa tgaatgaaca gccattacgc tagaagaaaa ttgtattgtg attggtgtac
     1021 tccgtatctt ctcagaatga gagaggtgag gcttctcaaa aagagcagcg agagaaagtc
     1081 acttaaaaat tttttttttt tggaaggtcc aaagttaaag ccgaactttg aaaaatagcc
     1141 aacccttaaa gtcagcggga aaagttgcca atctaagtct ggcccagcaa aatttttttt
     1201 ccagtagttt taggctccct tggccattgg gaatcccaga tgtaaagaaa accttacgcc
     1261 ataacttcaa aggtagattt ccagttatta ctgccccggt ggcaagaacc cttaggaagg
     1321 taaggtcaaa ggtgtggttt agttaaaagc caggttcccg ggaacggcac ttgaaagggc
     1381 aggccggaga ccagctgaag atgagataga gagcagggga agaatgcgcc gacacctcaa
     1441 ggtgagagag tagaaccagt ctccgccgtg ggaccgcgcg ctgctcaggt ggctctttcc
     1501 cgctcaggtg agctcctccc gcgcctccca ttggccgaga tgcccgcggc gctgggaggg
     1561 cgacgcagcg cggtctagtt cagggtctag ggcggcgcgt cacttccggt agcgcggagc
     1621 ttgtaaaaca ccctggagag aaaatggcgg cggcagcagc ttcggcgcct cagcagctct
     1681 cggatgagga gcttttctct cagctccgcc gttacggcct gtctcccgga ccagtgacgg
     1741 agagcacccg cccggtctac ctcaagaagc tgaagaagct tcgagaggaa gagcagcaac
     1801 agcaccggtc agggggccgc ggcaacaaga cgcggaacag taataacaat aacacggcag
     1861 ccgccacggt cgcagccgcg ggaccagcgg cggcggcggc cgcggggatg ggggtccggc
     1921 cggtctcggg cgacctctcc tacttacgga ctcctggggg cctgtgccga atctcggcct
     1981 ctggcccaga gagcctcctg ggagggcccg ggggcgcctc cgccgccccc gcggctggca
     2041 gcaaagtgct gctgggcttc agctcggacg agtcggacgt ggaggccagt ccccgggacc
     2101 aggccggcgg cggcgggagg aaagaccggg cttcgctcca gtaccgcggg ctcaaagcgc
     2161 cgccggcgcc cctggccgcc agcgaggtga ctaacagcaa ctctgcagag cgaaggaagc
     2221 cccactcgtg gtggggggcc aggaggccgg cgggccccga gctgcagacc ccgccgggga
     2281 aagatggagc agtggaggac gaggaagggg agggagagga cggtgaggag agggacccgg
     2341 agaccgagga gccgctctgg gcgagccgga ccgtgaatgg cagccggctt gtcccctaca
     2401 gctgccggga aaactattcg gactcagagg aagaggacga cgacgacgtg gcctccagca
     2461 gacaggtatt aaaggacgac tccctttccc ggcatcggcc cagacgaacc catagtaagc
     2521 ctctcccccc gctgactgct aaatcggccg gcggcaggct ggagacttca gttcagggag
     2581 ggggaggact cgcgatgaat gacagggcgg cggctgccgg gagtctagac aggagccgaa
     2641 acctcgaaga ggcggcggcc gcggagcagg gaggagggtg tgatcaagtg gactccagcc
     2701 ccgttcctag ataccgtgtt aacgctaaga aactgacccc tctcctgccc ccgccactta
     2761 ctgacatgga ctcaaccttg gattcgtcaa caggctccct tctgaaaacc aataatcata
     2821 ttggcggtgg ggccttcagt gtggactccc ccaggattta ttctaacagt ctccctccca
     2881 gtgcggcggt ggccgcctct agttcactca ggatcaatca cgccaatcat acgggctcca
     2941 atcataccta cctgaaaaac acatacaaca aaccgaagct ttccgaaccc gaagaggaac
     3001 ttctccagca atttaaacgg gaggaggtgt ccccaacagg gagtttcagt gcccactact
     3061 tgtcgatgtt tctcttaact gctgcctgct tatttttcct aatactggga ctgacttacc
     3121 taggaatgag agggacagga gtatctgagg atggagaact cagcagtaag nnnnnnnnnn
     3181 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     3241 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn tagaaaaccc ctttggtgaa acatttggaa
     3301 aaatacaaga aagtgaaaaa actcttatga tgaacacatt atataagctt catgatcgat
     3361 tggcacagct tgcaggagat catgaatgtg gcagttctag tcaaagaacg ctttctgttc
     3421 aagaggcagc tgcgtattta aaannnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     3481 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     3541 nnnttaggat ttaggtcctg aatatgaagg tatatttaac acttcattgc agtggatctt
     3601 agaaaatgga aaagatgttg gaataaggta aannnnnnnn nnnnnnnnnn nnnnnnnnnn
     3661 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     3721 nnnnnnnnnn nnataggtgt gttggttttg gccctgagga agaattgaca aatataactg
     3781 atgtgcagtt tttacagtcc acaagaccac tgatgtcttt ttggtgtcgt tttcgacgtg
     3841 cttttgttac tgtaactcac agattattgt tgttatgctt aggtaannnn nnnnnnnnnn
     3901 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     3961 nnnnnnnnnn nnnnnnnnnn nnnnnnacag gtgtagtgat ggtttgtgtc gttctgcgtt
     4021 acatgaaata tcgatggaca aaagaagagg aggaaacaag gcagatgtat gatatggtgg
     4081 taaagattat aggtgannnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     4141 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnttag
     4201 atgttttacg aagtcataat gaagcctgcc aggaaaacaa agatttacaa ccttacatgc
     4261 ctattccaca tgtacgcgat tccttaatac agcctcatga caggtgtgnn nnnnnnnnnn
     4321 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     4381 nnnnnnnnnn nnnnnnnnnn nnnnnnnnat aggaaaaaaa tgaagaaagt ctgggataga
     4441 gctgttgact tccttgctgc taatgagtct agagttcgca cggaaacacg aagaataggt
     4501 ggtgcagatt ttctggtttg gcggtggatc cagccttctg catcctgtga caaaatatta
     4561 gttatacctt ctaaagtatg gcaaggtcaa ggtatnnnnn nnnnnnnnnn nnnnnnnnnn
     4621 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     4681 nnnnnnnnnn nnnnngtagc atttcattta gatagaagaa attcaccacc aaatagtttg
     4741 acaccgtgtc taaagattcg gaatatgttt gatcccgtta tgtaagnnnn nnnnnnnnnn
     4801 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     4861 nnnnnnnnnn nnnnnnnnnn nnnnnnctgg aaagggagga gggctgagac ttctgaattg
     4921 taatttttaa atctactcct gttagtcacc aagcatttac ttaataccaa ttaaaatcgt
     4981 atgtggtttt aaaactatac caattctagt aatatatata tgttgtaaga gacagtgaag
     5041 aatttttacc gagtaggaat atggttgttg atttttgttt tcattaactt ttagggaaat
     5101 aggggatcag tggcatttgg caattcaaga agcaatttta gaaaaatgca gtgataatga
     5161 tggcattgtt cacattgcag tagacaaaaa ttcacgtgag ggttgtgtat atgttaaatg
     5221 tctgtctcca gaatatgctg gaaaggcttt taaagcattg catggctctt ggtttgatgg
     5281 taagaaattt gagtactaca aacattttga aaagatagtt atagtttaat tttaaactat
     5341 accagatttc aaataaaaga atttaggtta gcattttttt gagtaataat tttagatgac
     5401 tttatttatg ttttgtgctc atatgtcttt taccacagtt aattttctgc aaatattaaa
     5461 cagttttact gatctaaaat attattttta tcttacaaca gggaaattgg ttacagtaaa
     5521 atatttacga ctagatagat accaccatcg ctttccccag gctctcactt ccaacactcc
     5581 attgaagcca tcaaataaac atatgaactc catgtctcat cttcgtcttc ggactggcct
     5641 aaccaattct caaggaagtt cctgaaaaga ttttcttcca tttctaagac tgttatttac
     5701 aataggaaaa ttcctgtttg gctttttgtc ttccttttta aatgcttttt gtatgtaata
     5761 tttttattga tgaatacatc tctgaacgtt ccagaagtct taaggttcca aagggattta
     5821 gcagtgaggc agcaatgctg agtaggtagg ataattattt cattcagttt ttggagctca
     5881 gttaagccaa tacatttaaa gttttgcatg aggaacactg actttattaa gcattttcag
     5941 atgtggtggt tgtatttttg ccccaagaag tgtttggata accacacaaa agcatgatga
     6001 aaaggcttct tgtagtccca taatttcttg tgaactaatg ttgtgaattt ttgtatacag
     6061 tcacctgcat agttcctaca ggctaatgtg gtaaaactgt tgatttccca atttaacctt
     6121 aggtttctgt tgcttataag cgattcattt gctacggctg gaatatggga aaattaattt
     6181 gggcttagtg gttacaaata tgtgtaagtg gatgtatatg tacttaaact ggctttgtat
     6241 atatgtataa atgctggtgg tggtgaaagt agtcttgttt tatgaggatg tctgcattaa
     6301 agcagtaaaa taagctttcc attttattca taatctaatg tgtgtgtata tatgtatgtg
     6361 tgtatgtgtg tgtatatata gatgtatata tatacacaca cagagatata tacatatggc
     6421 tgtacttttg catagatcaa acagccaaac acctggaagt attagataca agtttaaaat
     6481 atcttttata ggttttatat aaaaatgtct gagtatgatt ttgtgtgaaa gttctgatac
     6541 cagttgtaat agagtcaaat ttatgtgagc aataaagaag aaattggcag atattggaaa
     6601 aatattttgt gaaaagctgt atttattata aatactaggg ccatgacata gtaccattgg
     6661 ggttaagtca ttttcccaat ctatttataa tttaatgata tgttagtgcc tctgttatat
     6721 gtcaagttta aagcagggca cattgttgca gcaaaatgtg tatttgacaa attatacttg
     6781 caattttggg tcatgaaagt ttgcaatata gtaaatgcac gattgactgt tgctttgtgc
     6841 ctcagtattt aatttgtttc agtaaactta ctttattact gtttatgatt tcagataaaa
     6901 atagttgctg agtaaatttt acttgtaatc tacaatgtga aacagctgga attgtacaaa
     6961 ttttggttgt atttaaagct cagtttcctt tttgttttat tgtatgcgtt gggtttgcag
     7021 catgaacttg cacagataat gcacgttttc tggttaagta aacatgatgc acactattct
     7081 gtaacagaaa gccctattgt gccttacctg tgtgcttttg tgggcacctt gtttatgaag
     7141 aataaaaaat gatttgttat ctgaagagaa taaattttaa attctcagtt tatgtctcag
     7201 atgctaacgt gtgaaaatat aaatatatat aatatataaa gtaaccagtc ttcctgtatt
     7261 ttatgtgcat catagtgatt tatctgagct tagtgacccc catcttgtaa cctgttgcaa
     7321 gagtgaatgt aaaaaatagt tgtggcattt taaaaggtcg cctttgatgc agatgcatct
     7381 ttttcttgct tctaaaacat atttcatgta aacattgtac atttattatt gtaatatata
     7441 ctattatgca gcttatttta cctgaaactg ttaagccgac caagatccct ccctgcaaga
     7501 cagatgggaa tgtgtataat aactaggtat ttgagaagtt ctgaagtttg atgtaatctg
     7561 ttacttgtcc tgtt
//