LOCUS       AF180135S9              2688 bp    DNA     linear   HUM 01-JUN-2000
DEFINITION  Homo sapiens inner nuclear membrane protein (MAN1) gene, exons 9
            and 10; and complete cds.
ACCESSION   AF263918
VERSION     AF263918.1
KEYWORDS    .
SEGMENT     9 of 9
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2688)
  AUTHORS   Lin,F., Blake,D.L., Callebaut,I., Skerjanc,I.S., Holmer,L.,
            McBurney,M.W., Paulin-Levasseur,M. and Worman,H.J.
  TITLE     MAN1, an inner nuclear membrane protein that shares the LEM domain
            with lamina-associated polypeptide 2 and emerin
  JOURNAL   J. Biol. Chem. 275 (7), 4840-4847 (2000)
   PUBMED   10671519
REFERENCE   2  (bases 1 to 2688)
  AUTHORS   Lin,F., Blake,D.L., Callebaut,I., Skerjanc,I.S., Holmer,L.,
            McBurney,M.W., Paulin-Levasseur,M. and Worman,H.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-AUG-1999) GI of Medicine, Columbia University, 630
            West 168 Street, P&S 10-509, New York, NY 10032, USA
FEATURES             Location/Qualifiers
     source          1..2688
                     /organism="Homo sapiens"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:9606"
                     /chromosome="12"
                     /map="12q14"
     gene            order(AF180135.1:<1644..3170,AF180136.1:1..173,
                     AF180137.1:1..89,AF180138.1:1..154,AF180139.1:1..110,
                     AF180140.1:1..112,AF180141.1:1..187,AF180142.1:1..91,
                     1..2050)
                     /gene="MAN1"
     mRNA            join(AF180135.1:<1644..3165,AF180136.1:4..173,
                     AF180137.1:5..84,AF180138.1:5..150,AF180139.1:5..106,
                     AF180140.1:5..107,AF180141.1:5..183,AF180142.1:5..86,
                     209..393,616..2050)
                     /gene="MAN1"
                     /product="inner nuclear membrane protein"
     CDS             join(AF180135.1:1644..3165,AF180136.1:4..173,
                     AF180137.1:5..84,AF180138.1:5..150,AF180139.1:5..106,
                     AF180140.1:5..107,AF180141.1:5..183,AF180142.1:5..86,
                     209..393,616..779)
                     /gene="MAN1"
                     /codon_start=1
                     /product="inner nuclear membrane protein"
                     /protein_id="AAF73293.1"
                     /db_xref="GI:8132534"
                     /translation="MAAAAASAPQQLSDEELFSQLRRYGLSPGPVTESTRPVYLKKLK
                     KLREEEQQQHRSGGRGNKTRNSNNNNTAAATVAAAGPAAAAAAGMGVRPVSGDLSYLR
                     TPGGLCRISASGPESLLGGPGGASAAPAAGSKVLLGFSSDESDVEASPRDQAGGGGRK
                     DRASLQYRGLKAPPAPLAASEVTNSNSAERRKPHSWWGARRPAGPELQTPPGKDGAVE
                     DEEGEGEDGEERDPETEEPLWASRTVNGSRLVPYSCRENYSDSEEEDDDDVASSRQVL
                     KDDSLSRHRPRRTHSKPLPPLTAKSAGGRLETSVQGGGGLAMNDRAAAAGSLDRSRNL
                     EEAAAAEQGGGCDQVDSSPVPRYRVNAKKLTPLLPPPLTDMDSTLDSSTGSLLKTNNH
                     IGGGAFSVDSPRIYSNSLPPSAAVAASSSLRINHANHTGSNHTYLKNTYNKPKLSEPE
                     EELLQQFKREEVSPTGSFSAHYLSMFLLTAACLFFLILGLTYLGMRGTGVSEDGELSK
                     NPFGETFGKIQESEKTLMMNTLYKLHDRLAQLAGDHECGSSSQRTLSVQEAAAYLKDL
                     GPEYEGIFNTSLQWILENGKDVGIRCVGFGPEEELTNITDVQFLQSTRPLMSFWCRFR
                     RAFVTVTHRLLLLCLGVVMVCVVLRYMKYRWTKEEEETRQMYDMVVKIIDVLRSHNEA
                     CQENKDLQPYMPIPHVRDSLIQPHDRKKMKKVWDRAVDFLAANESRVRTETRRIGGAD
                     FLVWRWIQPSASCDKILVIPSKVWQGQAFHLDRRNSPPNSLTPCLKIRNMFDPVMEIG
                     DQWHLAIQEAILEKCSDNDGIVHIAVDKNSREGCVYVKCLSPEYAGKAFKALHGSWFD
                     GKLVTVKYLRLDRYHHRFPQALTSNTPLKPSNKHMNSMSHLRLRTGLTNSQGSS"
     exon            209..393
                     /gene="MAN1"
                     /number=9
     exon            616..2050
                     /gene="MAN1"
                     /number=10
BASE COUNT          829 a          370 c          498 g          991 t
ORIGIN      
        1 ctggaaaggg aggagggctg agacttctga attgtaattt ttaaatctac tcctgttagt
       61 caccaagcat ttacttaata ccaattaaaa tcgtatgtgg ttttaaaact ataccaattc
      121 tagtaatata tatatgttgt aagagacagt gaagaatttt taccgagtag gaatatggtt
      181 gttgattttt gttttcatta acttttaggg aaatagggga tcagtggcat ttggcaattc
      241 aagaagcaat tttagaaaaa tgcagtgata atgatggcat tgttcacatt gcagtagaca
      301 aaaattcacg tgagggttgt gtatatgtta aatgtctgtc tccagaatat gctggaaagg
      361 cttttaaagc attgcatggc tcttggtttg atggtaagaa atttgagtac tacaaacatt
      421 ttgaaaagat agttatagtt taattttaaa ctataccaga tttcaaataa aagaatttag
      481 gttagcattt ttttgagtaa taattttaga tgactttatt tatgttttgt gctcatatgt
      541 cttttaccac agttaatttt ctgcaaatat taaacagttt tactgatcta aaatattatt
      601 tttatcttac aacagggaaa ttggttacag taaaatattt acgactagat agataccacc
      661 atcgctttcc ccaggctctc acttccaaca ctccattgaa gccatcaaat aaacatatga
      721 actccatgtc tcatcttcgt cttcggactg gcctaaccaa ttctcaagga agttcctgaa
      781 aagattttct tccatttcta agactgttat ttacaatagg aaaattcctg tttggctttt
      841 tgtcttcctt tttaaatgct ttttgtatgt aatattttta ttgatgaata catctctgaa
      901 cgttccagaa gtcttaaggt tccaaaggga tttagcagtg aggcagcaat gctgagtagg
      961 taggataatt atttcattca gtttttggag ctcagttaag ccaatacatt taaagttttg
     1021 catgaggaac actgacttta ttaagcattt tcagatgtgg tggttgtatt tttgccccaa
     1081 gaagtgtttg gataaccaca caaaagcatg atgaaaaggc ttcttgtagt cccataattt
     1141 cttgtgaact aatgttgtga atttttgtat acagtcacct gcatagttcc tacaggctaa
     1201 tgtggtaaaa ctgttgattt cccaatttaa ccttaggttt ctgttgctta taagcgattc
     1261 atttgctacg gctggaatat gggaaaatta atttgggctt agtggttaca aatatgtgta
     1321 agtggatgta tatgtactta aactggcttt gtatatatgt ataaatgctg gtggtggtga
     1381 aagtagtctt gttttatgag gatgtctgca ttaaagcagt aaaataagct ttccatttta
     1441 ttcataatct aatgtgtgtg tatatatgta tgtgtgtatg tgtgtgtata tatagatgta
     1501 tatatataca cacacagaga tatatacata tggctgtact tttgcataga tcaaacagcc
     1561 aaacacctgg aagtattaga tacaagttta aaatatcttt tataggtttt atataaaaat
     1621 gtctgagtat gattttgtgt gaaagttctg ataccagttg taatagagtc aaatttatgt
     1681 gagcaataaa gaagaaattg gcagatattg gaaaaatatt ttgtgaaaag ctgtatttat
     1741 tataaatact agggccatga catagtacca ttggggttaa gtcattttcc caatctattt
     1801 ataatttaat gatatgttag tgcctctgtt atatgtcaag tttaaagcag ggcacattgt
     1861 tgcagcaaaa tgtgtatttg acaaattata cttgcaattt tgggtcatga aagtttgcaa
     1921 tatagtaaat gcacgattga ctgttgcttt gtgcctcagt atttaatttg tttcagtaaa
     1981 cttactttat tactgtttat gatttcagat aaaaatagtt gctgagtaaa ttttacttgt
     2041 aatctacaat gtgaaacagc tggaattgta caaattttgg ttgtatttaa agctcagttt
     2101 cctttttgtt ttattgtatg cgttgggttt gcagcatgaa cttgcacaga taatgcacgt
     2161 tttctggtta agtaaacatg atgcacacta ttctgtaaca gaaagcccta ttgtgcctta
     2221 cctgtgtgct tttgtgggca ccttgtttat gaagaataaa aaatgatttg ttatctgaag
     2281 agaataaatt ttaaattctc agtttatgtc tcagatgcta acgtgtgaaa atataaatat
     2341 atataatata taaagtaacc agtcttcctg tattttatgt gcatcatagt gatttatctg
     2401 agcttagtga cccccatctt gtaacctgtt gcaagagtga atgtaaaaaa tagttgtggc
     2461 attttaaaag gtcgcctttg atgcagatgc atctttttct tgcttctaaa acatatttca
     2521 tgtaaacatt gtacatttat tattgtaata tatactatta tgcagcttat tttacctgaa
     2581 actgttaagc cgaccaagat ccctccctgc aagacagatg ggaatgtgta taataactag
     2641 gtatttgaga agttctgaag tttgatgtaa tctgttactt gtcctgtt
//