LOCUS       AF263523                2843 bp    mRNA    linear   HUM 31-OCT-2000
DEFINITION  Homo sapiens vanilloid receptor-related osmotically activated
            channel (VROAC) mRNA, complete cds.
ACCESSION   AF263523
VERSION     AF263523.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2843)
  AUTHORS   Liedtke,W., Choe,Y., Marti-Renom,M.A., Bell,A.M., Denis,C.S.,
            Sali,A., Hudspeth,A.J., Friedman,J.M. and Heller,S.
  TITLE     Vanilloid receptor-related osmotically activated channel (VR-OAC),
            a candidate vertebrate osmoreceptor
  JOURNAL   Cell 103 (3), 525-535 (2000)
   PUBMED   11081638
REFERENCE   2  (bases 1 to 2843)
  AUTHORS   Liedtke,W.B. and Friedman,J.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAY-2000) Molecular Genetics, The Rockefeller
            University, 1230 York Avenue, New York, NY 10021, USA
FEATURES             Location/Qualifiers
     source          1..2843
                     /db_xref="H-InvDB:HIT000075494"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="12"
                     /map="12q24.1"
                     /cell_line="HEK 293"
                     /note="between STS markers D12S1339 and D12S2291"
     gene            1..2843
                     /gene="VROAC"
     CDS             1..2616
                     /gene="VROAC"
                     /note="VR-OAC; non-selective cation channel; responsive to
                     osmotic stimuli"
                     /codon_start=1
                     /product="vanilloid receptor-related osmotically activated
                     channel"
                     /protein_id="AAG28029.1"
                     /db_xref="GI:11055322"
                     /translation="MADSSEGPRAGPGEVAELPGDESGTPGGEAFPLSSLANLFEGED
                     GSLSPSPADASRPAGPGDGRPNLRMKFQGAFRKGVPNPIDLLESTLYESSVVPGPKKA
                     PMDSLFDYGTYRHHSSDNKRWRKKIIEKQPQSPKAPAPQPPPILKVFNRPILFDIVSR
                     GSTADLDGLLPFLLTHKKRLTDEEFREPSTGKTCLPKALLNLSNGRNDTIPVLLDIAE
                     RTGNMREFINSPFRDIYYRGQTALHIAIERRCKHYVELLVAQGADVHAQARGRFFQPK
                     DEGGYFYFGELPLSLAACTNQPHIVNYLTENPHKKADMRRQDSRGNTVLHALVAIADN
                     TRENTKFVTKMYDLLLLKCARLFPDSNLEAVLNNDGLSPLMMAAKTGKIGVFQHIIRR
                     EVTDEDTRHLSRKFKDWAYGPVYSSLYDLSSLDTCGEEASVLEILVYNSKIENRHEML
                     AVEPINELLRDKWRKFGAVSFYINVVSYLCAMVIFTLTAYYQPLEGTPPYPYRTTVDY
                     LRLAGEVITLFTGVLFFFTNIKDLFMKKCPGVNSLFIDGSFQLLYFIYSVLVIVSAAL
                     YLAGIEAYLAVMVFALVLGWMNALYFTRGLKLTGTYSIMIQKILFKDLFRFLLVYLLF
                     MIGYASALVSLLNPCANMKVCNEDQTNCTVPTYPSCRDSETFSTFLLDLFKLTIGMGD
                     LEMLSSTKYPVVFIILLVTYIILTFVLLLNMLIALMGETVGQVSKESKHIWKLQWATT
                     ILDIERSFPVFLRKAFRSGEMVTVGKSSDGTPDRRWCFRVNEVNWSHWNQNLGIINED
                     PGKNETYQYYGFSHTVGRLRRDRWSSVVPRVVELNKNSNPDEVVVPLDSMGNPRCDGH
                     QQGYPRKWRTDDAPL"
BASE COUNT          553 a          921 c          788 g          581 t
ORIGIN      
        1 atggcggatt ccagcgaagg cccccgcgcg gggcccgggg aggtggctga gctccccggg
       61 gatgagagtg gcaccccagg tggggaggct tttcctctct cctccctggc caatctgttt
      121 gagggggagg atggctccct ttcgccctca ccggctgatg ccagtcgccc tgctggccca
      181 ggcgatgggc gaccaaatct gcgcatgaag ttccagggcg ccttccgcaa gggggtgccc
      241 aaccccatcg atctgctgga gtccacccta tatgagtcct cggtggtgcc tgggcccaag
      301 aaagcaccca tggactcact gtttgactac ggcacctatc gtcaccactc cagtgacaac
      361 aagaggtgga ggaagaagat catagagaag cagccgcaga gccccaaagc tcccgcccct
      421 cagccgcccc ccatcctcaa agtcttcaac cggcccatcc tctttgacat cgtgtcccgg
      481 ggctccactg ctgacctgga cgggctgctc ccattcttgc tgacccacaa gaaacgccta
      541 actgatgagg agtttcggga accatctacg gggaagacct gcctgcccaa ggccttgctg
      601 aacctgagca atggccgcaa cgacaccatc cctgtgctgc tggacatcgc ggagcgcacc
      661 ggcaacatga gggagttcat taactcgccc ttccgtgaca tctactatcg agggcagaca
      721 gccctgcaca tcgccattga gcgtcgctgc aaacactacg tggaacttct cgtggcccag
      781 ggagctgatg tccacgccca ggcccgtggg cgcttcttcc agcccaagga tgaggggggc
      841 tacttctact ttggggagct gcccctgtcg ctggctgcct gcaccaacca gccccacatt
      901 gtcaactacc tgacggagaa cccccacaag aaggcggaca tgcggcgcca ggactcgcga
      961 ggcaacacag tgctgcatgc gctggtggcc attgctgaca acacccgtga gaacaccaag
     1021 tttgttacca agatgtacga cctgctgctg ctcaagtgtg cccgcctctt ccccgacagc
     1081 aacctggagg ccgtgctcaa caacgacggc ctctcgcccc tcatgatggc tgccaagacg
     1141 ggcaagattg gggtctttca gcacatcatc cggcgggagg tgacggatga ggacacacgg
     1201 cacctgtccc gcaagttcaa ggactgggcc tatgggccag tgtattcctc gctttatgac
     1261 ctctcctccc tggacacgtg tggggaagag gcctccgtgc tggagatcct ggtgtacaac
     1321 agcaagattg agaaccgcca cgagatgctg gctgtggagc ccatcaatga actgctgcgg
     1381 gacaagtggc gcaagttcgg ggccgtctcc ttctacatca acgtggtctc ctacctgtgt
     1441 gccatggtca tcttcactct caccgcctac taccagccgc tggagggcac accgccgtac
     1501 ccttaccgca ccacggtgga ctacctgcgg ctggctggcg aggtcattac gctcttcact
     1561 ggggtcctgt tcttcttcac caacatcaaa gacttgttca tgaagaaatg ccctggagtg
     1621 aattctctct tcattgatgg ctccttccag ctgctctact tcatctactc tgtcctggtg
     1681 atcgtctcag cagccctcta cctggcaggg atcgaggcct acctggccgt gatggtcttt
     1741 gccctggtcc tgggctggat gaatgccctt tacttcaccc gtgggctgaa gctgacgggg
     1801 acctatagca tcatgatcca gaagattctc ttcaaggacc ttttccgatt cctgctcgtc
     1861 tacttgctct tcatgatcgg ctacgcctca gccctggtct ccctcctgaa cccgtgtgcc
     1921 aacatgaagg tgtgcaatga ggaccagacc aactgcacag tgcccactta cccctcgtgc
     1981 cgtgacagcg agaccttcag caccttcctc ctggacctgt ttaagctgac catcggcatg
     2041 ggcgacctgg agatgctgag cagcaccaag taccccgtgg tcttcatcat cctgctggtg
     2101 acctacatca tcctcacctt tgtgctgctc ctcaacatgc tcattgccct catgggcgag
     2161 acagtgggcc aggtctccaa ggagagcaag cacatctgga agctgcagtg ggccaccacc
     2221 atcctggaca ttgagcgctc cttccccgta ttcctgagga aggccttccg ctctggggag
     2281 atggtcaccg tgggcaagag ctcggacggc actcctgacc gcaggtggtg cttcagggtg
     2341 aatgaggtga actggtctca ctggaaccag aacttgggca tcatcaacga ggacccgggc
     2401 aagaatgaga cctaccagta ttatggcttc tcgcataccg tgggccgcct ccgcagggat
     2461 cgctggtcct cggtggtacc ccgcgtggtg gaactgaaca agaactcgaa cccggacgag
     2521 gtggtggtgc ctctggacag catggggaac ccccgctgcg atggccacca gcagggttac
     2581 ccccgcaagt ggaggactga tgacgccccg ctctagggac tgcagcccag ccccagcttc
     2641 tctgcccact catttctagt ccagccgcat ttcagcagtg ccttctgggg tgtcccccca
     2701 caccctgctt tggccccaga ggcgagggac cagtggaggt gccagggagg ccccaggacc
     2761 ctgtggtccc ctggctctgc ctccccaccc tggggtgggg gctcccggcc acctgtcttg
     2821 ctcctatgga gtcacataag cca
//