LOCUS       AF250306                1652 bp    mRNA    linear   HUM 17-APR-2001
DEFINITION  Homo sapiens putative SB115 protein mRNA, complete cds.
ACCESSION   AF250306
VERSION     AF250306.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1652)
  AUTHORS   Wan,T., Li,N., Zhang,W. and Cao,X.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-MAR-2000) Department of Immunology, Second Military
            Medical University & Shanghai Brilliance Biotechnology Institute,
            800 Xiangyin Rd., Shanghai 200433, P.R. China
FEATURES             Location/Qualifiers
     source          1..1652
                     /db_xref="H-InvDB:HIT000075015"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             222..1412
                     /codon_start=1
                     /product="putative SB115 protein"
                     /protein_id="AAK37425.1"
                     /db_xref="GI:13649459"
                     /translation="MGERKGVNKYYPPDFNPEKHGSLNRYHNSHPLRERARKLSQGIL
                     IIRFEMPYNIWCDGCKNHIGMGVRYNAEKKKVGNYYTTPIYRFRMKCHLCVNYIEMQT
                     DPANCDYVIVSGAQRKEERWDMADNEQVLTTEHEKKQKLETDAMFRLEHGEADRSTLK
                     KALPTLSHIQEAQSAWKDDFALNSMLRRRFREKKKAIQEEEERDQALQAKASLTIPLV
                     PETEDDRKLAALLKFHTLDSYEDKQKLKRTEIISRSWFPSAPGSASSSKVSGVLKKLA
                     QSRRTALATSPITVGDLGIVRRRSRDVPESPQHAADTPKSGEPRVPEEAAQDRPMSPG
                     DCPPETTETPKCSSPRGQEGSRQDKPLSPAGSSQEAADTPDTRHPCSLGSSLVADYSD
                     SESE"
BASE COUNT          394 a          525 c          484 g          249 t
ORIGIN      
        1 tgacgtcggg aggagggcag acacgccgct ttttggatgc ctcctatgcc tggcgggagt
       61 cttgtctgag ctggcaccac cacacggccc acgacatctt cgcagggaag cctgtggacc
      121 ctctgccagg ctccacaaga ggtcaggaca gtgcagtgtg ttcacaaggc cagtttctga
      181 tcgtccgccc cgaggctgag gaccagtagg cagctcccaa gatgggtgaa aggaaagggg
      241 tcaacaagta ctatcctcca gacttcaacc ctgagaagca tggctctctc aaccgatacc
      301 acaacagcca cccgcttcgg gagcgggctc ggaagctgtc acagggcatc ctcatcatcc
      361 gattcgaaat gccatataac atctggtgcg atggctgcaa gaaccacatc ggcatgggtg
      421 ttcgttacaa tgcagaaaag aagaaggtgg gcaattacta cacaaccccg atctacaggt
      481 tccggatgaa atgccacctc tgtgtcaact acatcgagat gcagacggac cccgccaact
      541 gcgactacgt gatcgtgagt ggcgcccagc gcaaggagga gcgctgggac atggcggaca
      601 atgagcaggt gctgaccaca gagcatgaga agaagcagaa gctggagacg gacgccatgt
      661 tccggctgga gcatggcgag gccgaccgca gcacactcaa gaaggcgctg cccacactga
      721 gccacatcca ggaggcccag agcgcctgga aggacgactt cgccctcaac agcatgctgc
      781 ggagaaggtt ccgggaaaag aaaaaagcca tccaggagga ggaggagaga gaccaggcct
      841 tgcaggccaa ggcgagcctg accatcccgc tggtgcccga gacggaagat gaccgcaagc
      901 tggcggctct gctgaagttc cacaccctgg actcctacga ggacaagcag aaactcaagc
      961 ggaccgagat catcagccgc tcctggttcc cctctgcccc cggatccgcc tccagcagca
     1021 aggtcagcgg cgtcctgaag aagctggcac agagccgcag aaccgcgctt gccacctccc
     1081 ccatcaccgt cggggacctg ggcatcgtgc ggcggaggtc tcgggacgtc ccggagagcc
     1141 cccagcatgc ggccgacacc cccaagtctg gggaaccgcg ggtaccagag gaggctgccc
     1201 aggaccggcc catgtccccc ggagactgtc ctccggaaac aactgagacc cccaagtgca
     1261 gcagcccgag ggggcaggaa gggagccgtc aggacaagcc cctgtcgcca gcaggctcct
     1321 cccaggaggc agctgacacc cccgacacgc ggcacccctg cagtctcggc tcctccctcg
     1381 tggcggacta ctccgactcg gagagtgagt gagcgatccc catcctggag actggacccg
     1441 ctctagaggc ccggacacac ccaggaggcc cctcacagac tgcagacccc cggctcgccc
     1501 accagccctg ggagagctca gatgccgcat cctccccaga ccgcgccttc ctgcaaccgt
     1561 ggagttattt atttggtcct ggtgagggtg tttgtgcctt gtgagactcc gtacattaaa
     1621 gacctgtctc ttcaaaaaaa aaaaaaaaaa aa
//