LOCUS       AF249873                1362 bp    mRNA    linear   HUM 23-JAN-2001
DEFINITION  Homo sapiens muscle-specific protein (C4orf5) mRNA, complete cds.
ACCESSION   AF249873
VERSION     AF249873.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1362)
  AUTHORS   Ahmad,F., Gonzalez,O., Ramagli,L., Xu,J., Siciliano,M.J.,
            Bachinski,L.L. and Roberts,R.
  TITLE     Identification and characterization of a novel gene (C4orf5)
            located on human chromosome 4q with specific expression in cardiac
            and skeletal muscle
  JOURNAL   Genomics 70 (3), 347-353 (2000)
   PUBMED   11161785
REFERENCE   2  (bases 1 to 1362)
  AUTHORS   Ahmad,F.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-MAR-2000) Cardiology, Baylor College of Medicine,
            6550 Fannin Street, MS SM677, Houston, TX 77030, USA
FEATURES             Location/Qualifiers
     source          1..1362
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="4"
                     /map="4q26-q27"
     gene            1..1362
                     /gene="C4orf5"
     CDS             361..1155
                     /gene="C4orf5"
                     /note="transcript found in cardiac and skeletal muscle"
                     /codon_start=1
                     /product="muscle-specific protein"
                     /protein_id="AAF63623.1"
                     /db_xref="GI:7542831"
                     /translation="MLSHNTMMKQRKQQATAIMKEVHGNDVDGMDLGKKVSIPRDIML
                     EELSHLSNRGARLFKMRQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQ
                     QAPLTPPNTPDPRSPPNPDNIAPGYSGPLKEIPPEKFNTTAVPKYYQSPWEQAISNDP
                     ELLEALYPKLFKPEGKAELPDYRSFNRVATPFGGFEKASRMVKFKVPDFELLLLTDPR
                     FMSFVNPLSGRRSFNRTPKGWISENIPIVITTEPTDDTTVPESEDL"
BASE COUNT          455 a          289 c          253 g          365 t
ORIGIN      
        1 agtggttccc aatccccaca tttaaaatgg aatgtttggt ttatttaaag taaataggct
       61 attttttctt actgggtctg gcttctctgg cccttcgcat acgtgtgtct gctgagtgtt
      121 cctgcatgta agaattaaga ccaagggagg ggagagagaa acccacacat aaacaatgca
      181 ctaaagatca ctgaactgtt taaacatttc cacttgccag tttaatttct tgaagactgt
      241 tgcttgtttg gaatgtttct tgtcactgat tttaaggttg catctggaaa agactaaagg
      301 cttcagtccc ctcccaccac cagaaaaacc acaatctaac agcaagggaa caaaaaaacc
      361 atgctatcac ataatactat gatgaagcag agaaaacagc aagcaacagc catcatgaag
      421 gaagtccatg gaaatgatgt tgatggcatg gacctgggca aaaaggtcag catccccaga
      481 gacatcatgt tggaagaatt atcccatctc agtaaccgtg gtgccaggct atttaagatg
      541 cgtcaaagaa gatctgacaa atacacattt gaaaatttcc agtatcaatc tagagcacaa
      601 ataaatcaca gtattgctat gcagaatggg aaagtggatg gaagtaactt ggaaggtggt
      661 tcgcagcaag cccccttgac tcctcccaac accccagatc cacgaagccc tccaaatcca
      721 gacaacattg ctccaggata ttctggacca ctgaaggaaa ttcctcctga aaaattcaac
      781 accacagctg tccctaagta ctatcaatct ccctgggaac aagccattag caatgatccg
      841 gagcttttag aggctttata tcctaaactt ttcaagcctg aaggaaaggc agaactgcct
      901 gattacagga gctttaacag ggttgccaca ccatttggag gttttgaaaa agcatcaaga
      961 atggttaaat ttaaagttcc agattttgag ctactattgc taacagatcc caggtttatg
     1021 tcctttgtca atcccctttc tggcagacgg tcctttaata ggactcctaa gggatggata
     1081 tctgagaata ttcctatagt gataacaacc gaacctacag atgataccac tgtaccagaa
     1141 tcagaagacc tatgaaaaga aagttgtatg tgccacataa aactctgaat ataaaagttg
     1201 ctgttctact attttaacta ctggcaaagc cacttgcatt tttcattagt agcaacaata
     1261 gcaatttagt gattttcctt ttctgacatt caatttcaat ctcagatcaa atactaataa
     1321 acaattagaa atcttacttt aaaaaactta aaaaaaaaaa gc
//