LOCUS       AF174603                 368 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens F-box protein Fbx23 (FBX23) mRNA, partial cds.
ACCESSION   AF174603
VERSION     AF174603.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 368)
  AUTHORS   Cenciarelli,C., Chiaur,D.S., Guardavaccaro,D., Parks,W., Vidal,M.
            and Pagano,M.
  TITLE     Identification of a family of human F-box proteins
  JOURNAL   Curr. Biol. 9 (20), 1177-1179 (1999)
   PUBMED   10531035
REFERENCE   2  (bases 1 to 368)
  AUTHORS   Chiaur,D.S. and Pagano,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-AUG-1999) Pathology, NYU Medical Center, 550 First
            Ave. MSB 548, New York, NY 10016
FEATURES             Location/Qualifiers
     source          1..368
                     /db_xref="H-InvDB:HIT000072612"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     gene            <1..>368
                     /gene="FBX23"
     CDS             <1..>368
                     /gene="FBX23"
                     /note="contains one F-box"
                     /codon_start=1
                     /product="F-box protein Fbx23"
                     /protein_id="AAF04524.1"
                     /translation="GSGFRAGGWPLTMPGKHQHFQEPEVGCCGKYFLFGFNIVFWVLG
                     ALFLAIGLWAWGEKGVLSNISALTDLGGLDPVWLVCGSWRRHVGAGLCWAAIGALREN
                     TFLLKFFXXFLGLIFFLELAT"
BASE COUNT           47 a          102 c          118 g           98 t
ORIGIN      
        1 ggctccggtt tccgggccgg cgggtggccg ctcaccatgc ccggnaagca ccagcatttc
       61 caggaacctg aggtcggctg ctgcgggaaa tacttcctgt ttggcttcaa cattgtcttc
      121 tgggtgctgg gagccctgtt cctggctatc ggcctctggg cctggggtga gaagggcgtt
      181 ctctcgaaca tctcagcgct gacagatctg ggaggccttg accccgtgtg gcttgtttgt
      241 ggtagttgga ggcgtcatgt cggtgctggg ctttgctggg ctgcaattgg ggccctccgg
      301 gagaacacct tcctgctcaa gtttttctnc gngttcctcg gtctcatctt cttcctggag
      361 ctggcaac
//