LOCUS       AF161586                 855 bp    mRNA    linear   HUM 09-AUG-1999
DEFINITION  Homo sapiens GABA-A receptor-associated protein (GABARAP) mRNA,
            complete cds.
ACCESSION   AF161586
VERSION     AF161586.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 855)
  AUTHORS   Wang,H., Bedford,F.K., Brandon,N.J., Moss,S.J. and Olsen,R.W.
  TITLE     GABA(A)-receptor-associated protein links GABA(A) receptors and the
            cytoskeleton
  JOURNAL   Nature 397 (6714), 69-72 (1999)
   PUBMED   9892355
REFERENCE   2  (bases 1 to 855)
  AUTHORS   Wang,H. and Olsen,R.W.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-JUN-1999) Department of Molecular and Medical
            Pharmacology, UCLA, 10833 Laconte, Los Angeles, CA 90095, USA
FEATURES             Location/Qualifiers
     source          1..855
                     /db_xref="H-InvDB:HIT000072192"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     gene            1..855
                     /gene="GABARAP"
     CDS             69..422
                     /gene="GABARAP"
                     /codon_start=1
                     /product="GABA-A receptor-associated protein"
                     /protein_id="AAD47641.1"
                     /db_xref="GI:5712774"
                     /translation="MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDL
                     DKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEED
                     FFLYIAYSDESVYGL"
BASE COUNT          183 a          240 c          207 g          225 t
ORIGIN      
        1 cgaccggccc cgtcccggcc cccctgggtt ccctcagccc agccctgtcc agcccggttc
       61 ccgggaggat gaagttcgtg tacaaagaag agcatccgtt cgagaagcgc cgctctgagg
      121 gcgagaagat ccgaaagaaa tacccggacc gggtgccggt gatagtagaa aaggctccca
      181 aagctcggat aggagacctg gacaaaaaga aatacctggt gccttctgat ctcacagttg
      241 gtcagttcta cttcttgatc cggaagcgaa ttcatctccg agctgaggat gccttgtttt
      301 tctttgtcaa caatgtcatt ccacccacca gtgccacaat gggtcagctg taccaggaac
      361 accatgaaga agacttcttt ctctacattg cctacagtga cgaaagtgtc tacggtctgt
      421 gaagctgctg cccctgagct ggaggggggt ctcattctac aaagagagag gtggcccccc
      481 tttcttgacc tcctcctcct tcaagctcaa acaccacctc ccttattcag gaccggcact
      541 tcttaatgtt tgtggctttc tctccagcct ctcttaggag gggtaatggt ggagttggca
      601 acttgtaact ctcctttctc ctttcttccc ctttctctgc ccgcctttcc catcctgctg
      661 tagacttctt gattgtcagt ctgtgtcaca tccagtgatt gttttggttt ctgttccctt
      721 tctgactccg tcaaggggct cagaacccag caatcccttc ctttcactac cttctttttt
      781 gggggtagtt ggaagggact gaaattgtgg ggggaaggta ggaggcacat caataaagag
      841 gaaaccacca agctg
//