LOCUS       AF157706              162114 bp    DNA     linear   VRL 15-OCT-2003
DEFINITION  Human herpesvirus 6B strain Z29, complete genome.
ACCESSION   AF157706 L13162 L14772 L16947
VERSION     AF157706.1
KEYWORDS    .
SOURCE      Human betaherpesvirus 6B
  ORGANISM  Human betaherpesvirus 6B
            Viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae;
            Roseolovirus.
REFERENCE   1  (bases 19696 to 22886)
  AUTHORS   Pellett,P.E., Sanchez-Martinez,D., Dominguez,G., Black,J.B.,
            Anton,E., Greenamoyer,C. and Dambaugh,T.R.
  TITLE     A strongly immunoreactive virion protein of human herpesvirus 6
            variant B strain Z29: identification and characterization of the
            gene and mapping of a variant-specific monoclonal antibody reactive
            epitope
  JOURNAL   Virology 195 (2), 521-531 (1993)
   PUBMED   7687803
REFERENCE   2  (bases 64106 to 84963)
  AUTHORS   Stamey,F.R., Dominguez,G., Black,J.B., Dambaugh,T.R. and
            Pellett,P.E.
  TITLE     Intragenomic linear amplification of human herpesvirus 6B oriLyt
            suggests acquisition of oriLyt by transposition
  JOURNAL   J. Virol. 69 (1), 589-596 (1995)
   PUBMED   7983761
REFERENCE   3  (bases 64106 to 84963; 106012 to 126166)
  AUTHORS   Lindquester,G.J., Inoue,N., Allen,R.D., Castelli,J.W., Stamey,F.R.,
            Dambaugh,T.R., O'Brian,J.J., Danovich,R.M., Frenkel,N. and
            Pellett,P.E.
  TITLE     Restriction endonuclease mapping and molecular cloning of the human
            herpesvirus 6 variant B strain Z29 genome
  JOURNAL   Arch. Virol. 141 (2), 367-379 (1996)
   PUBMED   8634027
REFERENCE   4  (bases 64106 to 84963)
  AUTHORS   Lindquester,G.J., O'Brian,J.J., Anton,E.D., Greenamoyer,C.A.,
            Pellett,P.E. and Dambaugh,T.R.
  TITLE     Genetic content of a 20.9 kb segment of human herpesvirus 6B strain
            Z29 spanning the homologs of human herpesvirus 6A genes U40-57 and
            containing the origin of DNA replication
  JOURNAL   Arch. Virol. 142 (1), 103-123 (1997)
   PUBMED   9155876
REFERENCE   5  (bases 106012 to 126166)
  AUTHORS   Lindquester,G.J., Greenamoyer,C.A., Anton,E.D., O'Brian,J.J.,
            Pellett,P.E. and Dambaugh,T.R.
  TITLE     Comparison of a 20 kb region of human herpesvirus 6B with other
            human beta herpesviruses reveals conserved replication genes and
            adjacent divergent open reading frames
  JOURNAL   Arch. Virol. 142 (1), 193-204 (1997)
   PUBMED   9155884
REFERENCE   6  (bases 1 to 162114)
  AUTHORS   Dominguez,G., Dambaugh,T.R., Stamey,F.R., Dewhurst,S., Inoue,N. and
            Pellett,P.E.
  TITLE     Human herpesvirus 6B genome sequence: coding content and comparison
            with human herpesvirus 6A
  JOURNAL   J. Virol. 73 (10), 8040-8052 (1999)
   PUBMED   10482553
REFERENCE   7  (bases 19696 to 22886)
  AUTHORS   Pellett,P.E.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-JUL-1993) Herpesvirus Section, Centers for Disease
            Control and Prevention, 1600 Clifton Road, Mailstop G18, Atlanta,
            GA 30333, USA
REFERENCE   8  (bases 64106 to 84963; 106012 to 126166)
  AUTHORS   Pellett,P.E.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-OCT-1993) Herpesvirus Section, Centers for Disease
            Control and Prevention, 1600 Clifton Road, Mailstop G18, Atlanta,
            GA 30333, USA
REFERENCE   9  (bases 1 to 162114)
  AUTHORS   Pellett,P.E., Dominguez,G., Dambaugh,T.R., Stamey,F.R., Dewhurst,S.
            and Inoue,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-JUN-1999) Herpesvirus Section, Centers for Disease
            Control and Prevention, 1600 Clifton Road, Mailstop G18, Atlanta,
            GA 30333, USA
  REMARK    Sequence updated by submitter
COMMENT     On or before Aug 16, 1999 this sequence version replaced L14772.1,
            L16947.1, L13162.1.
FEATURES             Location/Qualifiers
     source          1..162114
                     /organism="Human betaherpesvirus 6B"
                     /mol_type="genomic DNA"
                     /strain="Z29"
                     /db_xref="taxon:32604"
                     /note="variant B"
     repeat_region   1..8793
                     /rpt_type=direct
     repeat_region   59..353
                     /note="heterogeneous telomeric unit"
                     /rpt_type=tandem
                     /rpt_unit_seq="tarsyc"
     gene            583..3988
                     /gene="DR1"
                     /note="US22 gene family"
     CDS             join(583..841,955..2975)
                     /gene="DR1"
                     /codon_start=1
                     /product="DR1"
                     /protein_id="AAD49614.1"
                     /translation="MPLTARAGHTLHRLPLSHYWWLLLGRHSLRHVHSYLRLRKGLRL
                     PLPWPEQECLHLHPKPYKFLLRYPCLTRQPHLLQGWPADSSLWFDPKPYHPSADSKLL
                     PLGLITLSAFSMRVSEPTHCSGFHAADPSLSWLTGSSPWLVLLQAPGGSLFCHDVFQG
                     RLYLLSHSVSLFLKTGLRQCEAIYRAPLWRVRPLPSLWTCRDPDTAFLPKLLARTARR
                     GLAAFYALWRLHLGSRSELSHPVLEWERTELVLTDRRRGWPCTHLLSGSESQRVSSSD
                     AGDTWNAATEKAAGGKEEAERGGRQQATDRLASPHLTRGRRDCGRSLQGEEPSAAEDF
                     ARCRPLLDELCGEGGWLPFAFLTASPHVCLILTEGGPVLALDLNDTSLWRIADDLELL
                     LRLGSLLLLSGLRLPLRPPSGSGEAARKPGYEKEEGRGRATTASATAATSPRRPTRPR
                     GVTEKGRVTTGDVPFSAHPESEEQTDGHHGRQESGHGDQRGGDGRGHRDDGARRHAND
                     ETEPQQRGEHEDGEQTDSGREEDAQESEVARRDEKGTEQGGSGRSCGRATQTYGGRGE
                     HGAWSSIPLSVPRPDPRVWVPPPHLLFPSPLPSITPVEDEPSARPRCPPGPAEEPSKC
                     SPCPPCPSPDAPQSAVPRLSALSVPSPSTARVRFSLSSLSSSSSSSSSSSPSYSPSPL
                     SPPSPVSPSSPRSPFISPIRSPGLRAKPWVSSGHPVAFPPAPSSAPPFSKRVPSVPSS
                     ASPSAPCIGRSRPPSAQTA"
     gene            complement(2723..3325)
                     /gene="DR3"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             complement(2723..3325)
                     /gene="DR3"
                     /codon_start=1
                     /product="DR3"
                     /protein_id="AAD49618.1"
                     /translation="MSRVFSCVLRACVCAGLCCWVCMGVICGDCQRWWRRRCARWGRV
                     GPRVLDGGAWRVRSGDGARSVSRTCETERAPSAARSPVYSPPFVLVSSSSSSSCSSAC
                     SSRVPSPPPSPHAASHAVCAEGGRDLPMHGADGDADEGTDGTLLEKGGADEGAGGNAT
                     GCPEDTHGFARSPGDLMGEMNGDLGDEGETGEGGDNGEGE"
     gene            3022..3988
                     /gene="B1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             3022..3501
                     /gene="B1"
                     /codon_start=1
                     /product="B1"
                     /protein_id="AAD49617.1"
                     /translation="MQKNMKTKKTKKRGRKEGNTPETERRMEPARSRTSAIPSGLRRR
                     SGPSTPLRPGPEVRHAPTWRTASATTADSHRISPPYTPSSRGRHIHTRGARTRTRETS
                     AAEINGVYARAVTRKTKRSETIDRLLLSVLPGHGPHASLRSHLRARSALRPPPDPPR"
     gene            3536..3988
                     /gene="B2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             3536..3775
                     /gene="B2"
                     /codon_start=1
                     /product="B2"
                     /protein_id="AAD49616.1"
                     /translation="MQPMTKKKHTTASKRSPARPPSLSPPLESRRRVGGKSPERLHGN
                     APPTPPRSPLPPSPSPEHTRRLSPQRRRPQRQRKL"
     regulatory      3912..3917
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="DR1; B1; B2"
     regulatory      3938..3942
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="DR1; B1; B2"
     regulatory      3968..3974
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="DR1; B1; B2"
     regulatory      3983..3988
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="DR1; B1; B2"
     gene            5027..7435
                     /gene="DR6"
                     /note="US22 gene family; transactivator"
     CDS             join(5027..5330,6329..7203)
                     /gene="DR6"
                     /codon_start=1
                     /product="DR6"
                     /protein_id="AAD49615.1"
                     /translation="MTTRHTQTRDGRIAIRRDGARLAHARARARFEWLLLARGRPSKL
                     YGYTSRHRGERIHLPWPRYWCLELHPDPYRDARSATVWGHRWGWPPTHVRPRSVQDCA
                     LDSSLYVCCGYGEKLQPVGFVSSYLTHSPLDTLRVLLVGRDGAVYVHHMRAARLCRLA
                     SNVTEFARRGLQRDPVAYEEDLELPDRRMCGTNVRHLFDVIAAAADEHDLLTVGGLCQ
                     THAGVSCELLETVRDPWTAVPGVRMTLTVARAQYRLWPDARRQLRLHLYAGHPLGPWI
                     VCAVLSRERETQTPSPPIGSGGVILGNVPTPGPREVETAWVIVTVAGPLLSFWPDNGK
                     ICRLANSFAALWRMGPRAMRGHWTYSAPGRHLPGDAWPLCEHVRPPVGKLPRQRAYLD
                     "
     gene            7349..7528
                     /gene="B3"
     CDS             7349..7528
                     /gene="B3"
                     /codon_start=1
                     /product="B3"
                     /protein_id="AAD49619.1"
                     /translation="MSIRLRVCVGCVYVRVTVSLPAFNPMRNKIGECTQSHTMCLRAV
                     LLTPHNKKKKHTSCP"
     regulatory      7430..7435
                     /regulatory_class="polyA_signal_sequence"
                     /gene="DR6"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     repeat_region   8250..8711
                     /rpt_type=tandem
                     /rpt_unit_seq="taaccc"
     gene            complement(8911..9492)
                     /gene="B4"
     CDS             complement(8911..9492)
                     /gene="B4"
                     /codon_start=1
                     /product="B4"
                     /protein_id="AAD49620.1"
                     /translation="MCVFFCVCIFLCVYFFVCIFLCVFFCVCIFLCVFFCVYFFVCVF
                     FCVCFFVCVFFVCVYAFAHVAVCSVRPRRHVCACSRAYLHHRNGSGVYKKVIRPAGRS
                     AHPPVGRFYTRPLFSLSRATCGPSSGTSAPRPRWRSLTLGGAHGPRGRSLFPPASPRL
                     SLCGSAFCLSFSLARAIVFSLSPGSGARLHLRL"
     gene            9315..9761
                     /gene="B5"
     repeat_region   9315..9510
                     /note="R0"
                     /rpt_type=tandem
                     /rpt_unit_seq="yacacaaaaaaa"
     gene            complement(9515..14040)
                     /gene="U4"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     gene            complement(9515..12205)
                     /gene="U3"
                     /note="US22 gene family; transactivator"
     gene            complement(9515..10715)
                     /gene="U2"
                     /note="US22 gene family; transactivator"
     regulatory      complement(9515..9520)
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U2; U3; U4"
     CDS             9522..9761
                     /gene="B5"
                     /note="membrane protein"
                     /codon_start=1
                     /product="B5"
                     /protein_id="AAD49621.1"
                     /translation="MRCSHNVNIGQRQPRKRPLQQQQQHQLQQQTRAGSRSVNSRISV
                     AQRVLAVPTDYGRSPARDCGHFPLYHVRRKLIDGR"
     CDS             complement(9624..10715)
                     /gene="U2"
                     /codon_start=1
                     /product="U2"
                     /protein_id="AAD49691.1"
                     /translation="MFCRSPFLGISSWSLASAALCPSSCSFPAGRDLRCDAAVPEVKW
                     TAFVRTLVARPLSADDVRDFVSTFAHCRLALSWPVGAELRFATSDMLGITQAELAKLS
                     RGYGCCPGMDLTVIGVTIFAEVSALVLVGECGEIYAFNGVFDDALYRLAEDAFGLWKH
                     GLRRFEPVYGSKCLMETGASFFGGMSGVDDALAFAVSFDKALVPLPWPRGAFFEFAVP
                     RRAEKRWRLIPGGGVAVVIGRFFGRGVTLPLLRRQRVLMDQVGRVYAASLDGGAVVRL
                     SDSFRAFLAMGVRKLFKNHRFPPGHLWTMQLPVTCVHAPVINLPAVYQLSPHMVEREM
                     SAVSCGASTVVRRDCEDTLRDGDAGVDTS"
     CDS             complement(11045..12205)
                     /gene="U3"
                     /note="transactivator"
                     /codon_start=1
                     /product="U3"
                     /protein_id="AAD49622.1"
                     /translation="METTNSRRVSSAQRQILATATVRFIEGLHEPAQDSMMCGDDELQ
                     SQERMKKRQRLYNKSKRDLVDLLRVYTCLNSVRMFTFVNFGRRIPLAWPEGYELVINN
                     CRDENEYADEKLGELADLVCCRERLVVLGYVKKRGEIGSEPAYWFLKGDIVVLLGGAG
                     RVYAHTWLLPQQLCRVGDTIDDFLRKGLKRFYYAHQLVSSLQFVVEDTEVDGVCSCRD
                     VLCFRDRHIGRSFALRWPKNETLLFHRRRDSFVFVRCDEARRRLAEMCFFGSFGYKYF
                     ADAGRISLYVADDGRIFGFNDNDEDGRPRFVAENFQQFRRIGVIQYYKSYVFRREQPE
                     WALLPTCHLSRMFYQKTWRQADEDLLFVKARNDERQEFPDAGTRSAVHDVVR"
     CDS             complement(12433..14040)
                     /gene="U4"
                     /codon_start=1
                     /product="U4"
                     /protein_id="AAD49623.1"
                     /translation="MELLDHDIYKGPVRERVTYTIPNHPYLSLTVHHSRELDVDLKDI
                     TEEMIIDSGTLTAEDLFMTRGLRFCDDSVLWAALAEKVSVEFQRRGKTTMDLSAFMSL
                     LERLTFEDETSAFYRLLTKCTALAHFSILEYIVDGEKRDTISAHFNRLLELLDSLFLQ
                     FLMLRNRSESNTLLTLFDILPNPKEIYGDAASPTSVLLKHFLSDYIFVAYASSYRFVS
                     SVLCSCDQCRASLFRIYLGKKDSRAVNISDISEFDPADLILGQLHLDAREAVALRAEI
                     DRDLGSSLILNSMERRHLPILHDKQLGRGHFERNILKVYCNIVLCLFLLRRVKQRIVS
                     DLTAIARFFVKAISEMERCIDTVSGLHGVRIKLLVVSSQFEIKDPMRVPRLCFFFLEI
                     VTILVSGYDKERHRVRALLEHLCLKKICLGDLCASMRLAREIRHDVLEGFLNTLELSY
                     MSNPVRFFRFHDCNLYGTHMWSGVYPNVVPYAVRGGGSFDIRLQEHRRRQKRIVLRRR
                     LIRRVQQRGLDIREARRVPKLACVTFI"
     gene            complement(14071..18198)
                     /gene="U8"
                     /note="US22 gene family"
     gene            complement(14071..16959)
                     /gene="U7"
                     /note="US22 gene family"
     regulatory      complement(14071..14076)
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U7; U8"
     CDS             complement(join(14159..15800,15890..16959))
                     /gene="U7"
                     /codon_start=1
                     /product="U7"
                     /protein_id="AAD49634.1"
                     /translation="MSNFRLILETEGGKRVLCESIVLHFAFMFQTEIVPVCNDEFTLS
                     SCVPTLDFDVDVLSAAYGDGLEISSPGLRCCIAWPPMYALTLGEFYHFHTHRWVSAYD
                     WSSLLDTDEFLSAIGYAHPIYRDPNPDYDPYVMHSSTGKTIAVDTVTEKVYIIAESLV
                     QFFNIGLRQFPPFAEAELDPEQEKMWFGETKCGREEFILLQRNLPAMKDYVAKHCGKR
                     IRVDAFQDFDFSFCSLSDIYYLTGPGILEKITEKDYAIIGTCARSQAEPNCRAAIVMG
                     SNCHIYIYVENRISKVSKSLRTFIRRGFDELLYKEKYSLDWNDDTLFYISDTETENLN
                     RMLNGELPVLRSKPRHMCVRKDRLVKDRSKILFAVRLDEEDSLTVKFITKFLTPVFVG
                     RLPATSRFVVPVSCARLTNGLQGTAAARFGIKGLHPSSDCVVWNRLIDYEYETYKYPS
                     TYVRADQIADMVKNLKFMDNFDEKWQCITKLAFIGLYAGASLFNFASKPTLGYWCRYL
                     CEYASMLLFQFESKLKELTKESTRQLGGYNLCHWGQELKDCLENKSDVFFRYDFFERI
                     ESCLIEHFMLLCGCVECRRMFIMYNKRGRKCDFGHCVRIQCFPMIGSIRLPAFLHLGE
                     PYSVSLSSLIAKDLGLSMIEGQIEHSRLPISLQISVTPDKKALLTFLTNIVFIVFVVN
                     TLYRVINAELDIYYDLFTEEVGKLCVTMEEEMKLGRNGCLGDLCYFSSMKQMKEIVRC
                     PGEKSQFILKCWEALRIGFSVPAYKDYDETRFMEMFFLHHLHIKRFHEHNDRDLVSSD
                     NLIPGFFIVNTHEENFLQRLQRVVLPVAEDYLTNTRCINGTMAFFFSGLKYFGSGNHR
                     GVQISPEKDVRAIGYKLGSLDVLRDDYKYYEYAPDCAGELNGHDGDE"
     gene            15603..15809
                     /gene="U6"
     CDS             15603..15809
                     /gene="U6"
                     /codon_start=1
                     /product="U6"
                     /protein_id="AAD49624.1"
                     /translation="MPNLAAAVPCRPFVNLAQETGTTNLLVAGSRPTNTGVRNFVINL
                     TVSESSSSRRTANRILLRSFTSLL"
     CDS             complement(16963..18198)
                     /gene="U8"
                     /codon_start=1
                     /product="U8"
                     /protein_id="AAD49625.1"
                     /translation="MRRKACESKRGLKFNKVCHTTLFFPISCHVTASRIEVLYFRYFI
                     VSLLVLFGVFKMDLEAKEVSGEIPNENALAELCRFCESADLSRIENFVGTYKNWCLSI
                     IWPRNCWLRFTLRKDVAGYTEKMFEDMNDHYQGFVEKLCLLGTIQIPYRDVPILIGRS
                     KRIFLHDLETDTLHFVCDNFEQFVRYGVLGTNIITCAEPVYRHGLYDGPRFESLENLR
                     NNDVLRSPCTLNIHLKLNRKGVLGIKAMRKHYIAMLREFDELARCASLDDVERFVSLN
                     VGRDLRLDMPVFKSLTLGTRDSVWIGTCRLANLEEQEDLVEKVVVLGYLNDHDYESKC
                     TRPILCIGKSGKIYYYDWIDNVLVKLGDCLLTFLRVGFARLFADCGYEKIGKISMRFG
                     RMSTLGMSETYQSCMSLSK"
     gene            complement(18151..18493)
                     /gene="U9"
     regulatory      complement(18151..18156)
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U9"
     CDS             complement(18179..18493)
                     /gene="U9"
                     /codon_start=1
                     /product="U9"
                     /protein_id="AAD49626.1"
                     /translation="MAVRKLWKTVVQLFSKSKSEECNTEAGTMEVSCLKYGVQGLNAD
                     CSYVKSQCIKLSECECLYTFASDVCKEDFHNSEEMKVFVVQHSQEIVGGTDFSVHAEE
                     SV"
     gene            18543..20054
                     /gene="U10"
     CDS             18543..20054
                     /gene="U10"
                     /codon_start=1
                     /product="U10"
                     /protein_id="AAD49627.1"
                     /translation="MEIVTYKTASARSPTVTWSSGFGRAIASIQKRHQENIRKPLRFY
                     SGLLHCLIKQYEHCLVPPNKSIRFDKGKIEVAALILDLGHQVLGRQIHVRQRIYSWTS
                     ITLPKLFTPRELYFLVASPEDEDIVFNPTITKGGWISGSFSYPVEYRSNFSLTGMSAN
                     VLMVPFVPYRYPLNYARFISSIDLMILNEQFPEHECGDIQILKQRNYLYLGVIKNLTW
                     KKSVTGTGQTAPHRILKASFIGSWPDTSLPDRVALRFFNNTRFTIHCHEFAINIENLG
                     LVKNKEKVFGTLATVCCEQIPSLLTTENLPRYLIVQFEVVTQIEDPEPLLFSSNPKLY
                     FTGDVLNATMQLQHNPNYYDLLVHAPYDIHFYPSRCHIVILPIRYFTRGDKQILISGY
                     QNEGFFETQVMLWAPGTPLHITLRSFSPNLILPQSTPIATLFYVERMTSQNTEQKDVI
                     AKLSENGHFIGNLKLPRENFLHHDAITDLSLAAIPKDSATPGPGTVSSSVSPS"
     gene            complement(19917..22534)
                     /gene="U11"
     regulatory      complement(19917..19922)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="U11"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="highest abundance transcript"
     CDS             complement(19958..22534)
                     /gene="U11"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="101K; antigenic virion protein"
                     /codon_start=1
                     /product="U11"
                     /protein_id="AAA02870.1"
                     /translation="MDLKAQSIPFAWLDRDKVQRLTNFLSNLENLENVDLREHPYVTN
                     SCVVREGEDVDELKTLYNTFILWLMYHYVLSKRKPDYNAIWQDITKLQNVVNEYLKSK
                     GLNKGNFENMFTNKEKFESQFSDIHRALLRLGNSIRWGSNVPIDTPYVNLTAEDSSEI
                     ENNLQDAEKNMLWYTVYNINDPWDENGYLVTSINKLVYLGKLFVTLNQSWSKLEKVAM
                     SQIVTTQNHLSGHLRKNENFNAVYSQRVLQTPLTGQRVESFLKIITSDYEIIKSSLES
                     YSASKAFSVPENGPHSLMDFASLDGRMPSDLSLPSISIDTKRPSADLARLKISQPKSL
                     DAPLKTQRRHKFPESDSVDNAGGKILIKKETLGGRDVRATTPVSSVSLMSGVEPLSSL
                     TSTNLDLRDKSHGNYRIGPSGILDFGVKLPAEAQSNTGDVDLLQDKTSIRSPSSGITD
                     VVNGLANLNLRQNKSDVSRPWSKNTAANADVFDPVHRLVSEQTGTPFVLNNSDVAGSE
                     AKLTTHSTETGVSPHNVSLIKDLRDKDGFRKQKKLDLLGSWTKEKNDKAIVHSREVTG
                     DSGDATETVTARDSPVLRKTKHANDIFAGLNKKYARDVSRGGKGNSRDLYSGGNAEKK
                     ETSGKFNVDKEMTQNEQEPLPNLMEAARNAGEEQYVQAGLGQRVNKILAEFTNLISLG
                     EKGIQDILHNQSGTELKLPTENKLGRESEEANVERILEVSDPQNLFKNFKLQNDLDSV
                     QSPFRLPNADLSRDLDSVSFKDALDVKLPGNGEREIDLALQKVKAGERETSDFKVGQD
                     ETLIPTQLMKVETPEEKDDVIEKMVLRIRQDGETDEETVPGPGVAESLGIAAKDKSVI
                     AS"
     regulatory      complement(20019..20024)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="U11"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="less abundant transcript"
     gene            22636..23796
                     /gene="U12"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="truncated"
     CDS             join(22636..22668,22746..23330)
                     /gene="U12"
                     /note="G-protein coupled receptor"
                     /codon_start=1
                     /product="U12"
                     /protein_id="AAD49690.1"
                     /translation="MDTVIELSKLLHDEEFKDNASCTSTPTLKTARIIESAVTGITLT
                     ASVPMIIIVITTMILYHRVAKHNATSFYVITLFASDFVLMWCVFFMTVNREQLFSFNR
                     FFCQLVYFIYHAVCSYSISMLAIIATIRYKTLHRRKQTESKTYSTGRNIGILLLASSM
                     CAIPTALFVQINGAKKTTGKCVVYLSSPKAYELFLAVKIVFSFIW"
     regulatory      23791..23796
                     /regulatory_class="polyA_signal_sequence"
                     /gene="U12"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     gene            23856..26173
                     /gene="U13"
     CDS             23856..24179
                     /gene="U13"
                     /codon_start=1
                     /product="U13"
                     /protein_id="AAD49628.1"
                     /translation="MAHAKKQARRKLLTSTDDPILSSTFTMRPTSKIADAEIISREHD
                     YIASKTQADSKKKLSSLSVIFDKTVLFEFYGIGDNNEKAIVYPIDPDFLLCDSENNCT
                     LSPFL"
     gene            24277..26173
                     /gene="U14"
     CDS             24277..26109
                     /gene="U14"
                     /codon_start=1
                     /product="U14"
                     /protein_id="AAD49629.1"
                     /translation="MITHAMEGSKTFNIPTFVLDENCNFIPDVLSRANAKFIKEVLIR
                     DSYNAVCLANSFIPMATQTVEQILIIITKFKFSRSRDLLMSVFRLGVHINRFYAGKNQ
                     VKHMITMMKSLFDTEEAMRQLDRALMGLFVDARDNSYMPLIALSLHENGLPDSKFIKA
                     VRLIQTTVNSFHNRPDADIEQYAEKLRAYNYLYKIPKYSLKEAVDIYSDNLKDLTIGV
                     NKKPTLLFTSSDDAYLSHIYNDLLFLTSTWNMIYNCKKEIRRLNTWIKYEINSIMETA
                     VLVGFQLPDLKETILDLAALISNMNLVSPDKELFPHYKLILAKLFEICIFATKANICI
                     LPSFIKGHLIEFEDVLKRSNDDEDLNYLLLKSRDSDDEYDEDKPPIQVDPGRVDNVLT
                     DSDFFNVTPENAFSSIAIMPISYDKTIDVEDNEIQVLEVEMQSLSAVVYGAVASKYGL
                     SLEQVIRKLNRNEGRTSSRASPSHSTSTVPYSPPQSDRSTPTSILRQRVPMRSNSRSS
                     SVSFSQEDSNRSHYSDETNISDYSYPMADLELEDEEPMEDHPHSPQSTSSNNSMSRQS
                     RALQNGQRRRAPTMVPSSQTRRQNNARPRRVARRLTEMMNDARL"
     gene            complement(26121..27048)
                     /gene="U15"
                     /note="HCMV UL25/UL35 gene family"
     regulatory      complement(26121..26126)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="U15"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             complement(join(26143..26328,26500..26572,26732..27048))
                     /gene="U15"
                     /codon_start=1
                     /product="U15"
                     /protein_id="AAD49689.1"
                     /translation="MDVWKRQRLQECRELCPLPALMSLSNILSNTEIIYVKYLFKMDF
                     STMYRFILPALTLSMTVTKSVVIEMLFILKRWEEINQFFRLNIRKVNDCFVVAQFTNI
                     PVKRKIIVLLYMLTSRQEKQLFLNMIYAFLEKSHLRLGDDEEQNAIRFFSYVDELHLT
                     RDVLLEIIYKLKNTEINQTMELLLSYNELAG"
     regulatory      26168..26173
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U13; U14"
     gene            complement(27258..28421)
                     /gene="U17"
                     /note="US22 gene family; IE-B"
     regulatory      complement(27258..27263)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="U17"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             complement(join(27330..28105,28193..28421))
                     /gene="U17"
                     /codon_start=1
                     /product="U17"
                     /protein_id="AAD49635.1"
                     /translation="MADERIGDYVKTRYDIALMNLNDIKIAVFRDSLSTYVEQKTGLT
                     IQFNWPKSRCLVISTLCKIPFPTKSAAELQEMCSLLLCCPERLQLLGYVSAWGKETRD
                     VCLTKTLVFVGEDERFYGLDFVNETLYLLAETTERFAVLGLRRYDPVYREKDIRFLTK
                     IDDVLQSLIDVQDNLWKFATIVYKNSGRHYIMKSCLENNDGVFVLFLTRKEDFPSRME
                     WNFFSDVYESMPYHGHVIGSIGKTLLYPKTMFVMMDLSGAIYGIDTIGTGIGSCVKIA
                     DEFESFLRQGIVRGYRRYKFFHQNISTVQEILPLCPHTFLGPTFSNDYIYDLSSEDEE
                     "
     gene            complement(29440..31920)
                     /gene="U19"
                     /note="IE-B"
     gene            complement(29440..30485)
                     /gene="U18"
                     /note="IE-B"
     regulatory      complement(29440..29445)
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U18; U19"
     CDS             complement(29601..30485)
                     /gene="U18"
                     /codon_start=1
                     /product="U18"
                     /protein_id="AAD49630.1"
                     /translation="MKKLTMESLLVYTFVMGVCFTSNLTCEQKIVLIQEQKLGAICIS
                     TCYVNGVLAGNSSCVSVRTSYLINLAMLTDGFKAMKVGNITSISEKTAFLRVIINYYF
                     RGVMLRALIAKRLPNAAQLSSTVNCWLEGHSAGGVMTLFYGTERIVLKSSTEMNASQW
                     TSDGPDANGTLNILNERVSLDSYFLSMICPQLSDEIYKKKVVHSKYFSLIKNDTMPKK
                     FLRNTWKSAWTNWYKYKEIEALLDFSRDYENVSEITHSMSAAGLFFLAGGAFTMLLLL
                     CCLSMITRKHVVKDLGYK"
     CDS             complement(30751..31920)
                     /gene="U19"
                     /codon_start=1
                     /product="U19"
                     /protein_id="AAD49631.1"
                     /translation="MAFTGDELARMLQFKDKMISSAGSALRFEKVVQEAMASGIVLQH
                     ITCIKVRICDNSDILSDRQLRCLLINGLYPFEGRMSMFGVTEEWEGASAAPERQVVFL
                     LSSTGQVLGYEDGVIFYLSPTFSDFWTTAMEFSCQNAILSNFIAQKSRDEYSDQFQKY
                     FTRMRHTPISLTGVLPRRFQKVESGACVEEDARASMRPIQSDSFGAKGPFCWPTEELL
                     QPSAKKDVGGTVCMALSCQEDNSARHCTIYGLTKTPGIKIMLSRHTQTDRSEAMCDAA
                     TQTEDVVDNSSETLFLGGNLVHQSILETEVQATAKNTFDVSDPRIDSVYDTTVVGAMA
                     TDDVGCKHVQGGASLAQEKPLKGYCIIATPSECKPNIHWLKSPENAVHESAAVLR"
     gene            complement(32096..37936)
                     /gene="U25"
                     /note="US22 gene family"
     gene            complement(32096..36969)
                     /gene="U24A"
     gene            complement(32096..36777)
                     /gene="U24"
     gene            complement(32096..36386)
                     /gene="U23"
     gene            complement(32096..35459)
                     /gene="U22"
     gene            complement(32096..34954)
                     /gene="U21"
     gene            complement(32096..33449)
                     /gene="U20"
     regulatory      complement(32096..32101)
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U20; U21; U22; U23; U24; U24A; U25"
     CDS             complement(32145..33449)
                     /gene="U20"
                     /codon_start=1
                     /product="U20"
                     /protein_id="AAD49632.1"
                     /translation="MITVFVACLFQCVSSLPAKLYIKTTLAEGIGKLQTVIGIDNDIV
                     FAYERLYGDLTLRNHTAVGETLFDLAGSLEEGKNSTVDRFLGHVVIREFHRLHAGLQY
                     VSVQNFSVSELVCFVNNNTQLSGSYVFLARNTTYVQIDLFNENRSFVHDLINVSSFLQ
                     NRSLHVLSFYARRFCVEDILNFYGKVVFGDSKYRPPQVFSKRDTGLLVCTARRYRPIG
                     TNIQWSLHNQTVSDDHTTDDFIRTEISGQLLYSYERALSRALSMTHREFSCEITHKLL
                     VTPALLTREDAFSFKGFVNPVKESEDTFPRHNFPAPHRKKFNKLQLLWIFIVIPIAAG
                     CMFLYILTRYIQFFVSGGSSSNPNRVLKRRRGNDEVPMVIMEVEYCNYEAENHDMELH
                     SVQNVRDDSIAVVCGNNSFDIERQSIKSHESFSNVKLEMLPL"
     CDS             complement(33452..34954)
                     /gene="U21"
                     /codon_start=1
                     /product="U21"
                     /protein_id="AAD49633.1"
                     /translation="MSASFTTASRFTFLLLPFFVLAGLLWILCLICGRNPSTLWYDGD
                     LILKIASLELVGASDRKREGKRSMMICFVFLCVLTFVRGEIYPSTCPALGAGNGEAVR
                     SGEMLLEISAYRNWRSGKMELWGSAAVNNQVFYGGMEDSQIEYDFGKFLVFRCFQVFH
                     NVHKLLFNTVSSATMHLARKRVQKCGHGKMTFISIQVQCSVNKKSIRLSRMNETNLKK
                     QVLRVAFFLDGSNNSWIADKNFQGEDRTMLRLWTELSTYRQYLISSCNNDVKVLSELY
                     GEFRRMALSYDEELKLNFMPVIRSSSERLFRADDLKCSFSRWLGAEGEFAVCEYSGWG
                     VSKLGKIEIFAEEPLTFDMVWKTVKMRSSGAYTSLFRDDVTWGLISLDKWVGDKYFCM
                     CTNKESGDNVIVTLPEKNVEKSIQIYNEGSTMLAFAEITSIMVNLMFMGAVAVCVGIL
                     GISCFVGLKEIIYFIFVSVNSMWPFCNKLLTTAVNCFFKGRTFLRRELKI"
     CDS             complement(34851..35459)
                     /gene="U22"
                     /codon_start=1
                     /product="U22"
                     /protein_id="AAD49636.1"
                     /translation="MVPQGWSLAWVSVLYVSVIPSLHIINNENSVFIGTHSETELRHW
                     LIFVKMAQRSGTAWWRMASVPINAYFERDIAFLFNPRCVIETALGSKILCRYNKNIGV
                     VFVDNDTTCNVSFPSGVQLQLLNQSVMESIRTKTYVVDYARKTTERGDCFISVAFCRK
                     ERRRFLPRYERFVYYCISVYLFAVAVFCSCWFALDPLFNMWA"
     CDS             complement(35487..36386)
                     /gene="U23"
                     /codon_start=1
                     /product="U23"
                     /protein_id="AAD49688.1"
                     /translation="MRKSEFNAKSCFLMIGICVFNLNSSSCIIKTNAEHCSKRLFSFC
                     YLGVGVIKKPLHLGNRKNMLFLSFLLVCLCEEVQMLNLTTTEVSATEFASIASKNMET
                     NVSTSSDYLTGKSETTFSANPETWGKNVTEISIASVAYLNQSSMVTSTLAVGTTNRSS
                     GNNVNVTTSSFPTVKGDEAQDIETFFTVILASTLSDVSEKTPQGLPTKSTPKKTVQAL
                     WETDTVQVPELTDTNEGDEEYFKDFLSSLVIWICGISFVGAFIIVIVILYNWYKKDKQ
                     RSLLWDEENKPDVQIRRDAKTCR"
     CDS             complement(36511..36777)
                     /gene="U24"
                     /codon_start=1
                     /product="U24"
                     /protein_id="AAD49637.1"
                     /translation="MDRPRTPPPSYSEVLMMDVMYGQVSPHASNDTSFVECLPPPQSS
                     RSAWNLWNKRRKTFAFLVLTGLAIAMILFIAFVIYVFNVNRRKK"
     CDS             complement(36796..36969)
                     /gene="U24A"
                     /codon_start=1
                     /product="U24A"
                     /protein_id="AAD49638.1"
                     /translation="MLLISKTLFPIPRSAEELWEGTYTLVVAFVLAFLVYSDYLSNLS
                     PFGEILSSPCIST"
     CDS             complement(36986..37936)
                     /gene="U25"
                     /codon_start=1
                     /product="U25"
                     /protein_id="AAD49639.1"
                     /translation="MGLSSSKDIDLLVNFIENRQGATLALPWPEDYRLTLHSVENIPD
                     ISREDVQNWAKTYMCCEGELVVVGVIHKAKTRTCRGPIVLQGARGHIYVYNGFFDRSL
                     YHVASSFHDLFSNGLRFFYPIYETCDYALDSTVALDMIAHSKSFSELLHYRNERKNAF
                     FTLKTYPYKTFVRFCNLSMTGFSSKHLIQWRRKLQTSLLDVVFIVQHNFFGDWRELVV
                     VFDGHGMLFCVDREESLLFIARNMSDFLKIGCLRYNENRRLHTQWFTQDTDYIKQVDE
                     MFSRDVLCPLREHCQRSRRDRGLLKICTSLVRGINCIERG"
     gene            complement(38003..40019)
                     /gene="U27"
     gene            complement(38003..38931)
                     /gene="U26"
     regulatory      complement(38003..38008)
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U26; U27"
     CDS             complement(38044..38931)
                     /gene="U26"
                     /codon_start=1
                     /product="U26"
                     /protein_id="AAD49640.1"
                     /translation="MRRLTDSFILGLAKGAVIPGLYPFRMTEGRSSLEQIGVVITVAI
                     SFLLTFKKFDPRFYKPIGDFKIVFLSLMAAKLPSFLSAVVMICLIFSEMRLRMILSRC
                     VLIMPSYSPAVFTGMMVSLFFKSQMFDDYSVLTTTAFLLPFTLRYGWMIRSSGFLISL
                     QKYRPILKSTSFREVDLKYLVKFTVEFLLLFTILWIGKIFLSMPKSNHLFFLTVVNNV
                     FFKLNVFKAAACAMVAILSGLMMNVCLYRIIFEAFLGLGFSSIMLTLSSDLKDRSFYA
                     GDLLNGFFCLVVCCMYFGV"
     CDS             complement(38919..40019)
                     /gene="U27"
                     /note="Polymerase processivity factor; polymerase
                     processivity factor"
                     /codon_start=1
                     /product="U27"
                     /protein_id="AAD49641.1"
                     /translation="MERGSRDHHRDHRDHREHRELREPPTLAFHMKSWKTINKPLKAF
                     TKLLKENTTVTFTPQPSIIIQSAKNHLVQKLTIQAECLFLSDTEHFLTKTINNHIPLF
                     ESFMNIISNPEVTKLYIQHDSDLYTRVLVTASDTCTQASVPCVHGQEVVRDSGKSPLR
                     IDLDHSTVSEVLKWLSPVTKTKRSGKSDAFMAHIIVQVNPPTIKFVTEMNELEFSNSN
                     KVIFYDVNNMRFNLSAKNLQQALSMCAVIKTSCSLRTVAAKDCKLILTSKSTLLTVEA
                     FLTQEQLKEESRFERMGKQDDGKGDRNHKNEDGSALASKQETQYKITNYMVPTKNGTA
                     GSSLFNEKEDSESDDSMHFEYSSNPKRQRCVV"
     gene            complement(40123..43471)
                     /gene="U29"
     gene            complement(40123..42549)
                     /gene="U28"
     regulatory      complement(40123..40128)
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U28; U29"
     CDS             complement(40135..42549)
                     /gene="U28"
                     /note="large ribonuclease reductase"
                     /codon_start=1
                     /product="U28"
                     /protein_id="AAD49642.1"
                     /translation="MKRKERRINKDFGYNRKCVCHYEASQKRFCYSQYSCASVLYERV
                     RDIAKIMDRLDSGLDAWCLRDAIISVLRATHCVPRVDRMLGRWYLKTSIFYDFCPDDL
                     ILSCPNVIMPNVLNFVKKYRDFIRSVLYKVSVSWKNQYMPGVLGASRFLEEISNSLNG
                     VEESIPCIYLRMCATLTEIVLRNGYLREIYQENPYVIFEELAFSLFTQKWVLPFSCMT
                     NLGLVEKANSTVFDVAIYNTCLYSLADFITVNGEHLFPALLNGSNISMNVTRYQQEAK
                     NIFEILLSQIQVVERDTDKTVQLTVYVEVWHVSALTWLDLYQVLPETSRVTFCLIIPG
                     IFMDRYELKRAQWSLFHKNIAFELGKCDEVTFSTKYLEFERTTDHAKITMASFVEKIC
                     RCLKRGRMGLIFRKNVYQYSMIPHVPLYCGGDFLDVLPVRDGINTCLRMLLNVVHFLG
                     DEVSDELTEEIDFVRLQCKFFMFNELRRVVRKMVLVANAVIDYAVDNKDFLREGIVDG
                     RSLGICITGLHSVFMTVGLSYAHPDACRLYRMMCEHIYYTCVRTSVDCCMKGAEPCNL
                     FDRSKYALGMLYFDQFDNVECTLPEELWTTLRKDVLMHGVRNIHFTAGTAMQKEFDII
                     NSSESFWPMEDNKILRRSNIKVVIGKDGLNDVTSVYSSELKSLYIPVYNNLLLNRFNK
                     HQQYLKTVGYRVLNVDTNLFTDKELDDLAVFKDGFSYPLNDLIEMYKSGLPFLDQGQA
                     NVFYFNDTVSLKHLLPLLYKTGFKVAMYKVLCSSEMYKHLDLSNPLPLIGKCSDGVVM
                     HVKNIL"
     CDS             complement(42572..43471)
                     /gene="U29"
                     /note="capsid assembly and DNA maturation"
                     /codon_start=1
                     /product="U29"
                     /protein_id="AAD49643.1"
                     /translation="MNSKSSARAAIVDTVEAVKKRKYISIEAGTLNNVVEKERKFLKQ
                     FLSGRENLRIAARVFTPCELLAPELENLGMLMYRFETDVDNPKILFVGLFFLCSNAFN
                     VSACVRTALTTMYTNSMVDNVLSMINTCKYLEDKVSLFGVTSLVSCGSSCLLSCVMQG
                     NVYDANKENIHGLTVLKEIFLEPDWEPRQHSTQYVYVVHVYKEVLSKLQYGIYVVLTS
                     FQNEDLVVDILRQYFEKERFLFLNYLINSNTTLSYFGSVQRIGRCATEDIKSGFLQYR
                     GITLPVIKLENIFVDLSEKKVFV"
     gene            42999..52559
                     /gene="U30"
     CDS             42999..46247
                     /gene="U30"
                     /codon_start=1
                     /product="U30"
                     /protein_id="AAD49644.1"
                     /translation="MTHDNRQLLPQETKLVTPNKDTLSSRYLHVLIIDNTLSTIEFVY
                     MVVKAVLTQADTLKAFEQRKNRPTNRILGLSTSVSKRYINIPKFSSSGANNSQGVKTL
                     AAIRKFSLPDKNCFRNFLSFSTTLFKVPASIDIYFLFFTASTVSTMAARALDLEFILS
                     SLKNSTSPESLLAATAKIEILSLAADSVTHNRVIAFINRLPPKKYHFDLIREYTVFYF
                     LNSTTLTSENKLLSAELLHEELSQIRSSSSPGTELENLNNAEVLYVFDRILNSIKMLK
                     NELSSPIGKLRVQPAANDPGTDKTIKYSKIQSIIQKVHSFTRENSLLANCRAVVELID
                     DLYRKLYSWFLHILTFEDIQFPGDTFLDRLLKMDYCFTYYPSSNRHLIDLFEKTLDNQ
                     TSTDIDKFFDTSGNSPELLYQKTFSLKIFSKNLTAQDNGLYIYPLLKTDLSILDFLGT
                     ENILFHRGLIYHILHQKTIPQERENDLNKINQFFATVIQQVIETRSSCLPASLSRLLD
                     TIFHFNRIGLNIETCRIYVEILSNHMATPDTQPIINTFTINLIHIVFTAHVFFICMEN
                     FSPTFLFYNRKKLILEQQRAILIIERNEYSTLWKQISDHIDCLFNISLSESFFKEYTK
                     GGNEEHKQFLYKNLFEKWGDVFFPFTYSVTTSKNSTAHHITTLELRAICKEVYQSDSP
                     EAYESLLPYSTHPAFKTLFIKIYVIPMVTYITNLTFDKLQSDYRLITLIHACKLLLPS
                     QHLLLHYMVWLYAFSINVDHIDLGTFTVIKSVIFKIADHINVMTHTIYSPETNLLVSI
                     LLNAYTDYLQKYVNPWIKQTITANFSLLQTYITFTKQCASILATKCNINLDNLFISMT
                     IGTDKIVTTSFCSFIATCRNLVRQHEEFKKSLKTIETSKTTLTNMLLNIITSVSSSKE
                     LLTNEALQKFIDTVQRISQHVNETYQLISVNLEKCKISNDILIESLKKTISIVDVLSS
                     DAILNTSLTSRCLEAATLAVSNNSFTILEIKKDAVAVFKPFITQLFESMKPTTSLYKK
                     LMATQKLTTDRIPFLDIFDDRYNLVRHVERQLNWYAAYAEAAQQDLIAPLTF"
     gene            46265..52560
                     /gene="U31"
     CDS             46265..52498
                     /gene="U31"
                     /note="large tegument protein"
                     /codon_start=1
                     /product="U31"
                     /protein_id="AAD49645.1"
                     /translation="MKIITSSTNQNDSKYGPRAGKQCMSNSFSFLHTVYLNGINNSLN
                     AGTIDAIMEEGYHLDTASTLALMLDNSDSQDYRLLTEIPRRIHSRYGVTQHELSRPFN
                     GTLDTQKIDNEVYFGLIDFILYGKTKNCPAFAVITIGVLSRAIFFLNNTLYLFDSHPT
                     EREATAAIYICQDIEEAYELLTAHGTEGFYYDASFIFFIETSNLSLSSHDAELLILKT
                     YKDPDIAITLDKFSSTEIHDIKKTDDIGSQQDLVAAKTTYLERAPQKRKKNSHSLELE
                     LNDKKKKDTASLTYYATEVDLIPSFYELRSQFQSLFHDLKSFPIMKSQFNWTIYLQDS
                     PMNPNQPFATPFLWNRVFHLLCQIVDVFVGVGSTNDDSSKQKQQTIFINYLLPFKDFS
                     EVFNEALTACQENNLDILLIYNNYLCKTTTFRTLERILLSKFLAIADNEHEKHYEWVK
                     SWTTQMLQEMPKKLDDIENYLKAYVSQNPVKHFHEFVCLNKAEKHNIAVLLNEKRKEI
                     QEDIERDKNIFAQLSNFIDKLGETPALPIESENVHKVHTSDITEAIVPRFMTESIELP
                     NISTLNNTQQLSLEKQISEKLTNTIHTLRNKFTKIVQDNYNNLAAGFMPVTELNCLFA
                     YLVNLYFNIEVLKHSGLNINTELLQEVEKLYDNTQFLRFGTSHFNINNLSNFTLSIRK
                     MFVDFYNSQKPSDRASEILAAIESILADPSKNKTIVNIEMIKSQLEELGKMEISTTEN
                     KQTAEITKQILGDQELTPIYDFLHHLSAYNLPNTTTVKNLHLHFILEKRPDIAAILHD
                     KIQSILDICIDDMLNDITVPEQTFSTVLFLVDLFPNSTEKTALFESVLTLRQLAKKCA
                     NLKTLEEFDDLAQFITTNSEQLQNMMKQHFGKKIPTLMDHIKFLYSQKIITAEEKNWI
                     QRAKTAVITSPEELTAFLATAPTKHALQTCKPELDKALQRHMEEQMKQTAENDKKHIL
                     TIRNTLEKRLNDILLILKDGQFSSLETVHLNLLETFLKQLQDNDLIIHFTHALLPVLK
                     DIETTISKTISDILEKILIKTPLNPEQMSKEEQKYTPLLSFLSKFKKTTFCTEDVKTE
                     IDQMQKSITFLTKIATSTNKYTRISHSVYGQELNLYEERITELKKETNKIKEQLSKEY
                     AVAEKKILLSSQDAKTNKIYLVLNTHTLKEIKNTQFRETAFAKALTVEVNNKENQLQE
                     LLNHFNAHLKAKMDQNHITKLSFDTKWTAFVSDSRLYFPDFVDIKLQDFISDPFKVIS
                     QLMNKAANEMPYIQAEITLKWLTQLVHDINKFCLSAISEFGKEAIPFNYAALRDLEYQ
                     INTKYVEIENKVICNETVENTKNIPKLTKLLKELDPKRVAGGQKQYQTLMNKILTSET
                     SMQQTYEKEQLKKEYFETVNNVASFKLAFNFPKQRQNVERLMEKFKSLPKGQPFEKFP
                     EENDLFSDSLITENYINGLRALLNFITAAQNYIQNTLLKQWAVFQQQNFIPIDYSVAN
                     VKPISDLYARLRIERDRQVFYQVNSVFGTQLIVDETGVPLQFHNIFYNAVVKFFSLNY
                     KQIHVPEDTPRLVSSQYKLLSVCKSFIIILQQFWENIITLDLGPYLRDGTQNFKRELI
                     PIVNLKLFIYIITQAWTASEDSTVSTAFELPIKQFTLLILCSHPEYLYGCLSHPTDLV
                     INSLAKSIDKDSLYDTFVVSHNPPEKPMHLMRSICIDTQLWQSAKLMKDTFQQTFFTQ
                     LCPQNEKFFIYLTAFLILPYKFLNYIWIQYKPITFTQRSYQNLIKDLCSEYVHQNKIT
                     MSSVTPHEPDTIKSGEKITSKITVHKAQNTPTLTRLQAQEYVFDYILYSFLTGYEMTF
                     AMYIDTIEKTYLLCMRHLENVLHDKDFQSVLRARTFDINYILKQSWTKNIVEHSIFSV
                     QLNKIVSYLNHTNRATPNIPLILFNYDNEVVNVYLPPMSTDPKKVAFYIKNPFHFPVQ
                     EYEATDLISFHLYPKTTDILNQLPPNKTVSTRPYNLSSETLTTKNLSEPKFKQPTVTG
                     LMPKSQSIILSTDTNVLETSPDIKANTASAAIKDVTLAREQISEFSESINTTLSKLKS
                     LYL"
     gene            complement(52535..55373)
                     /gene="U35"
     gene            complement(52535..55036)
                     /gene="U34"
     gene            complement(52535..54255)
                     /gene="U33"
     gene            complement(52535..52841)
                     /gene="U32"
     regulatory      complement(52535..52540)
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U32; U33; U34; U35"
     regulatory      52555..52560
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U30; U31"
     CDS             complement(52572..52841)
                     /gene="U32"
                     /codon_start=1
                     /product="U32"
                     /protein_id="AAD49646.1"
                     /translation="MTTIRGDDLSNQITQISGSSSKKEEEKKKQQMLTGVLGLQPTMA
                     NHPVLGVFLPKYAKQNGGNVDKTAFRLDLIRMLALHRLNTKTGSD"
     CDS             complement(52843..54255)
                     /gene="U33"
                     /codon_start=1
                     /product="U33"
                     /protein_id="AAD49647.1"
                     /translation="MFYLKKLLRQLLAPLCKHGPYTHLQLFVMGDACVPGKCVLTMFL
                     TNKKFLNKEVTEKFYNEFFAIWLRCRPETRFITKRLFNKMVMTKGLFVLLAYLYFVYR
                     QCKVLELLSLYKLKRIKWMDVETRFRVYPSYKLNKLLEMPSFSEINELHMFLFEQQLL
                     LPIPTHVNLPCMRLFCLRDYEQTETVMLRYRQREHVLSFPSMLQKYALKSPAGNFMFT
                     MAKALVENFCFSADRYLIPVEHNNLVPMVPSKPERGDFPKILTFALATSLKDGLATSV
                     ISLPVMCYCKTKCSRFILEESYICVICAKCGHCLNSGKEKLCSPQGFSLSSMFYFRDK
                     QEKNLIYSMHTDVMYCSLCGSQQLVFERIYEMSEHCVLGMKVETVSWKAVIGTNSACT
                     ILNDNVKFDVIVPCSCRSCYSTVHLYNVTVKKLLRLVSHGSDFQCQHCQHSFRETCLD
                     LEDCVNICQGCQISQNVRCI"
     CDS             complement(54206..55036)
                     /gene="U34"
                     /codon_start=1
                     /product="U34"
                     /protein_id="AAD49648.1"
                     /translation="MANVLKEKMYDELLSATCRILKLGSHDYRMTERNLLSKNPKFPL
                     CDIILKLDYAYNLEYLLSLWEHVTKQEPRFVFKNTGGAVSMSCYLHAPVKAEGHHAVR
                     ECNILRVNECLTVRMSDIVAMKPSTFAVFTKCIIRRNRDETYVVEFVAFGPENESEYI
                     SLLKAIFLKKCSMGKQHLESNRFCQGLRRRSSHVLEKGQLGSSGEIANKASAVVTSQE
                     SINQFYEKEKSFLSGVKFSRLSERHCRVAIVSICFLLALYFCYVLLKKTPTPASGPVV
                     "
     CDS             complement(55053..55373)
                     /gene="U35"
                     /codon_start=1
                     /product="U35"
                     /protein_id="AAD49649.1"
                     /translation="MMDSSPEKTNLELLYEQVCEQGREFEVVFYPMLPRLYEMMLPSL
                     EARLNFLSVGYRHVAFSRYVHGDVDCVHREVMAQKMVLLTSILSKLLNVNGILEHQEY
                     LNTE"
     gene            55372..57625
                     /gene="U36"
     CDS             55372..56826
                     /gene="U36"
                     /codon_start=1
                     /product="U36"
                     /protein_id="AAD49650.1"
                     /translation="MYKGWDSEALSIQSEIVNEILLYCYLTPQPPIPSETTTATSPTN
                     IENEISNLESSENLEELKRLSVALNIDRRCNICSIVNLCLKQNKSWIYDYSLLCYKCN
                     YAPKTPLSLLIVSAEFIMLIRERFPNINFDGLFQNNIVSIFDFHVHFFIHRCFANTVN
                     DHIQSENITLNHMAIIRSTLLKEDSIPHIKIKKFLTKKMNPKKTQSPELNKKLTVPMK
                     TRFTTLLFYMWSGTNVFDRVPFTDLTIRKHRFIKNLYSNKTDIELTAGPILLAQIPFS
                     ITKNKTTSVCLLCELMAASKQDYLFLKYLHQSIMDYCQNNLKMIDRVQFVIADIFEKT
                     KIHMHVKNLSDYSKAIFDNEFSFSDDNFTLDTHVYLILRQTGTVGVYKHFFCDPLCLA
                     NCKTINPEVLFNTTDAGEIQDLKVTICYRNEYLSIVEKHVWLAIHLFKAFQIIKPNHK
                     NKTQIAEFLKDFTNLLALHHFDIVDPIFTVNYYV"
     gene            56830..57625
                     /gene="U37"
     CDS             56830..57624
                     /gene="U37"
                     /codon_start=1
                     /product="U37"
                     /protein_id="AAD49651.1"
                     /translation="MTVHKNRFRRSRSLSVTHRIQKRPDHREKTKLYLQLKLHDLHAV
                     FNLFPEYEQKFLAIIKLPITGKEPIDVPFSLSNHHQHTCLEFSPYANEQISKSACLHC
                     ESVSVPTSSDAMVAHLNQVTNVMQNRFYFYGFRKDMELIRMSAKQPTIFQIFYIVHNT
                     INNIFPIMFEKKQKLGMHIVFQSRTLHIPCECIKQIIAVSSGYNVYLDILQDSVILTV
                     LCETLDTNTNIHIDIGMLQKKLEEMDIPNEISDRLEKYKGHLIGFH"
     regulatory      57620..57625
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U36; U37"
     gene            complement(57630..68740)
                     /gene="U41"
     gene            complement(57630..65334)
                     /gene="U40"
     gene            complement(57630..63200)
                     /gene="U39"
     gene            complement(57630..60708)
                     /gene="U38"
     regulatory      complement(57630..57635)
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U38; U39; U40; U41"
     CDS             complement(57670..60708)
                     /gene="U38"
                     /note="DNA polymerase"
                     /codon_start=1
                     /product="U38"
                     /protein_id="AAD49652.1"
                     /translation="MDSVSFFNPYLEANRLKKKSRSSYIRILPRGIMHDGAAGLIKDV
                     CDSEPRMFYRDRQYLLSKEMTWPSLDRVRSKDYDHTRMKFHIYDAVETLMFTDSIENL
                     PFQYRHFVIPSGTVIRMFGRSEDGEKICVNVFGQEQYFYCECVDGKSLKATINNLMLT
                     GEVKMSCSFVIEPADKLSLYGYNANTVVNLFKVSFGNFYVSQRIGKILQNEGFVVYEI
                     DVDVLTRFFVDNGFLSFGWYNVKKYIPQDMGKGSNLEVEINCHVSDLVSLENVNWPLY
                     GCWSFDIECLGQNGNFPDAENLGDIVIQISVVSFDTEGDRDERHLFTLGTCEQIDGVH
                     IYEFASEFELLLGFFIFLRIESPEFITGYNINNFDLKYLCIRMDKIYHYEIGCFSKLK
                     NGKIGISVPHEQYKKGFLQAQTKVFTSGVLYLDMYPVYSSKITAQNYKLDTIAKICLQ
                     QEKEQLSYKEIPKKFISGPSGRAVVGKYCLQDSVLVVRLFKQINYHYEVAEVARLAHV
                     TARCVVFEGQQKKIFPCILTEAKRRNMILPSMVSSHNRQGIGYKGATVLEPKTGYYAV
                     PTVVFDFQSLYPSIMMAHNLCYSTLVLDERQIAGLSESDILTVKLGDETHRFVKPCVR
                     ESVLGSLLKDWLAKRREVKAEMQNCSDPMMKLLLDKKQLALKTTCNSVYGVTGAAHGL
                     LPCVAIAASVTCLGREMLCSTVDYVNSKMQSEQFFCEELGLTASDFTGDLKVEVIYGD
                     TDSIFMSVRNMANESLRRIAPMIAKHITDRLFKSPIKLEFEKILCPLILICKKRYIGR
                     QDDSLLIFKGVDLVRKTSCDFVKGVVKDIVDLLFFDEEVQTAAVEFSHMTQTQLREQG
                     VPVGIHKILRRLCKAREELFQNRADVRHLMLSSVLSKEVAAYKQPNLAHLSVIRRLAQ
                     RKEEIPNVGDRIMYVLIAPSTGNKQTHNYELAEDPNYVLEHKIPIHAEKYFDQIIKAV
                     TNAISPIFPKTDIKKEKLLLYLLPMKVYLDETFSAIAEVM"
     CDS             complement(60708..63200)
                     /gene="U39"
                     /note="Glycoprotein B"
                     /codon_start=1
                     /product="U39"
                     /protein_id="AAD49653.1"
                     /translation="MSKMRVLFLAVFLMNSVLMIYCDSDDYIRAGYNHKYPFRICSIA
                     KGTDLMRFDRDISCSPYKSNAKMSEGFFIIYKTNIETYTFPVRTYKNELTFPTSYRDV
                     GVVYFLDRTVMGLAMPVYEANLVNSRAQCYSAVAIKRPDGTVFSAYHEDNNKNETLEL
                     FPLNFKSVTNKRFITTKEPYFARGPLWLYSTSTSLNCIVTEATAKAKYPFSYFALTTG
                     EIVEGSPFFDGSNGKHFAEPLEKLTILENYTMIEDLMNGMNGATTLVRKIAFLEKGDT
                     LFSWEIKEENESVCMLKHWTTVTHGLRAETDETYHFISKELTAAFVASKESLNLTDPK
                     QTCIKNEFEKIITDVYMSDYNDAYSMNGSYQIFKTTGDLILIWQPLVQKSLMVLEQGS
                     VNLRRRRDLVDVKSRHDILYVQLQYLYDTLKDYINDALGNLAESWCLDQKRTITMLHE
                     LSKISPSSIVSEVYGRPISAQLHGDVLAISKCIEVNQSSVQLYKSMRVVDAKGVRSET
                     MCYNRPLVTFSFVNSTPEVVLGQLGLDNEILLGDHRTEECEIPSTKIFLSGNHAHVYT
                     DYTHTNSTPIEDIEVLDAFIRLKIDPLENADFKLLDLYSPDELSRANVFDLENILREY
                     NSYKSALYTIEAKIATNTPSYVNGINSFLQGLGAIGTGLGSVISVTAGALGDIVGGVV
                     SFLKNPFGGGLMLILAIVVVVIIIVVFVRQKHVLSKPIDMMFPYATNPVTTVSSVTGT
                     TVVKTPSVKDADGGTSVAVSEKEEGMADVSGQISGDEYSQEDALKMLKAIKSLDESYR
                     RKPSSSESHASKPSLIDRIRYRGYKSVNVEEA"
     CDS             complement(63154..65334)
                     /gene="U40"
                     /note="transport/capsid assembly"
                     /codon_start=1
                     /product="U40"
                     /protein_id="AAD49654.1"
                     /translation="MNSLQSLCVLCARLNECALDLECLKFCDPVIVLSDMANFKKNGI
                     VILHLYQTFFEGIKEQNLLCASALTVYMQVLLKAMYEQVLLLDAALESFMVDQDRKKY
                     FEKVLCLKRCAEHLSINISLNNGVEFIVQLSTLNDIEQLISKINSVYALLLPQEGLQI
                     CGKIIDLLTIMCGACMVAKPESYLETKTCMKCYEELTLTPNQGKSLRKRLHGKFCNHL
                     TEQKAFFNIEKNIETIEKDLGEAILNYGTIQSVVTEIKKIFKQQRSAESLHVSDAEKT
                     LKKYNIFSKVPDVIYSLSEFTYWSKISETIVRNVAITLQQLNSCHTLYKQLQNDVSLY
                     LYGEVSEDFLALSENLLTHDERLYVGSIYVSPSRLIDLVTGLSIKNLEESPIFKRLAE
                     EDEVQHKIKSLLHDIRDPQTTETPGRLNTINCMLQTHNLQQEVLARKKAYFQKVSESG
                     YNRVMACIREQESLINKVVSVNVYGNFIFEALSKIMNGFVLRKMYLDGSIRVDSCTYD
                     EHLYIKNNLMPKKLPLELLPDLSEIMYTLLTGPLSDFHKSAYPLPANISMAYGCDHAE
                     MLPHMKEDLARCIEGTIHPSVWMVCEYNEFFNFSGVTDVNDMQKKMWNFIRELTLSVA
                     LYNDVFGKRLKIVRIDEEEDLNGNVVLTFNHESPLLFHTGGGMTKFKDVYSLLYCDLQ
                     AQLSRETVDVPEGVSYSVRTPNLLDLVRENEQDESIIPGCLFDE"
     CDS             complement(65342..68740)
                     /gene="U41"
                     /note="major DNA binding protein"
                     /codon_start=1
                     /product="U41"
                     /protein_id="AAB06339.1"
                     /translation="MADENETVVSAPVSTAAWIYVFPKEKELLDVLSVLSLMERNSPV
                     VISPLLMNLTVENDFSTTVKTPITNFGGTILTKITSFMPVCFFFHGTEQLVGMAEDHG
                     DLIRLCEQTRQKFHLQSFEVPTARKVIDIKALCSAVGKDADSVICHVACGNGFKELLF
                     AGLLIPCVEEQIQVQVGEYSCVKIPLYSATLFETEETISLSSCTEFIQERGFFLPALS
                     ETLFYYVFTSWGTTLRFSNTKELIDAGLKQFTQDGEQTVKLAPHKTYLGISGQKISAV
                     EKDFLMLVDSVVTELSFSHVAEYLDSVYDPSQIMNFNDWPIIRNSETHAERMAQLTNL
                     KLHLSSHLAVLIFAPNSILYCSKLAFIPNVKQAFNSVMTQELLLRSLSFCNALSSLTE
                     DVYNDNRKIIKCDSTSGKDDKFSANHLAYACATCPQLLSYVVWNLNRMSVYNAGNAYT
                     EIYNHLVNCSANLCEFCDGKCCQSCIGTAMVRVGTRLPAIPKNVKKEPLVMSMFSRYY
                     AEVDILGSFGRKPVSELKEIGKDQQNTLSLDRGKFVSQIFDYCKKNSLIDPVTGEDTF
                     NVRSKKDFVSIIHGLTQCIEECVSRCIVEMRRTQTPREQIENCLQSFNVDTTPYATAF
                     SPFLTFAYYKVILTVLQNLALIVASGHVVDRPCTGNSISKWLVQQYQSLYGTFHSSYL
                     KKGFLNTRTVKVASNVDMEQILDCDLYKSGKYVKTTIQAKLCRLSMQCLRDFRIKNRP
                     FNKSSKTAHNNPYFKKNVKHKKNPLSGCISFLLFKYHDKLFPNVKISCLELWQRFLLN
                     NVPKTLDIGNPEEVKTFIKFAFSITNTYDEIDIIDIQPECLSTFIDCYFHNKFLSALG
                     FHDYLTSLHGLTSKLVTQNPVLFPVVLDKQPKFSSIQEYLVYVKKLVLDGVPNPVIAS
                     LSKEPNFGTIFTSRSLVTFGLTLEKFVSLANREYFQFGQLGWIGGSGVDRNLNPTSSA
                     LQDFRFMRQKTIIATKFSEVIVKKVRRETIMFDTEVVKGKVLSIVENLTNDIDPELLI
                     IAEVMRDREDKPTMDDMLFFVDGREALAASIMLKLNHLVDMNVRDFSIANLQSVFEAV
                     SSNDAPVYDFSEILAEEDDQASGVLKCDETETETDEPMTKKNRL"
     gene            complement(69965..74460)
                     /gene="U43"
     gene            complement(69965..71653)
                     /gene="U42"
     regulatory      complement(69965..69970)
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U42; U43"
     CDS             complement(70103..71653)
                     /gene="U42"
                     /note="transactivator"
                     /codon_start=1
                     /product="U42"
                     /protein_id="AAB06340.1"
                     /translation="MYPRGVKRSQHDRHKQTAFRTIKRSITHRPTSKFISHFAKNFRG
                     KLAPLKQLDESRLDALSLTELEQLKTIIEEKQQEKRAQNNAITFLPNLPTVPFADTNF
                     SIKSLGLRPYNGDARDPKQRIRDRFPQTHERICLLTNDILETDLLLRYRQCLDSLTRE
                     ENQQLMGDRIFSLTNSPCLAFTVATVEEACSYFKFHDLHNLPVNPQDLFMYTITVMKF
                     EFFNKLNMAKLTCVFNDNGHGDIEYRKLRQLCGKPVLDREMPNSEFEVQQQTPDSFRH
                     PIQQAMSIVVTFARILRQIKEHIIRTKKPQFIRDFDTERVAERYECGLISRLIGKQFS
                     NHKCDDVSCQNRIERIMAPWKPSLFFCTYFAKDAPKFKLFPNLPHEYRNLSFTCPKVD
                     MEPSCSYSTSRDLPQTSHRSHKNQGTPKVKSKVCVEKPDTSNLTTTKTTTEILIEESM
                     ETDNKIPDPRELNFNQAKQDEIVIININENVNSKHESESSVEMDLDLDYEADTCETNL
                     NTYSSDSE"
     CDS             complement(71878..74460)
                     /gene="U43"
                     /note="helicase/primase complex"
                     /codon_start=1
                     /product="U43"
                     /protein_id="AAB06341.1"
                     /translation="MTIVVFATEYDAANVIFSILCRSPSEHLIFPIIVKYKPSNNVSF
                     CLQTQKCKNSKRIDTVFVCHAEKLNLSHYIQTASPIKAEDVANSLNDKETELLYVDMI
                     LSQTGKEKEDVEFKYMAYFHKSLIIKYLTGKFLLPTSPFWFLSTYGQTEGLLLLTMYY
                     YLFEEQKSTITTTKNYVQCFTENTGSMVFTYSSMSEFINITLKSKFRKLFADFATYAR
                     QKNLRDKEEFKYLDTQINLFRKSSHLTNTFRVHYIYIAYNTALETTKFVNYCNITSYD
                     SNLPIGQQCQRNVHILGNSLHENLLCIMKQYFNADCYFKTYIDIKRLKNPDLNVTEYE
                     YALASKKKTIQALTSEQITRAIAKCNKNGEGLFSPVKPGLQGLLEISASDKYVQIQDK
                     RIYRRQHLHKDYHRPFPVFRVQLLHKNIFCFGNSEDWYENMGFNRILQYLPDEYISDE
                     ALTRAIWLQDTHFLCDDFEKQFYTTRHEIFNERIPVTNYIGDLDLPLQDTATITEETF
                     FSMCRLIRLTLINAWKKIFPSIDTHTHPIFFFKTQCDTTNDALDYTEDPTEIKQFCIC
                     RKKIGLRISIPLPNGTAIAGGEPLKQLSKILNHVMCLDQELSQILNSLTFPGECFDIG
                     IYHTGHCIRIGYMYKTDMDKGKMLHGRLTPIFIVPEGYRNSCKTFIQMQMDLNNLLHH
                     GTKKAPIEELIYSITDKGCPKENLSFMDLKSRQLWNKVNIATDTLITKYLNTHGFNNN
                     ATSADDSLLSFIRLIGWPIIKTQLITHYETRIAQQFSQVTFLKIDSKNLQIKKTQFGR
                     VSDFSCLNRQHRGNRDNVLVYIQLKADGNRLILILWSTCFATKCQSNSKQVHCSIALE
                     QLKN"
     gene            74501..76650
                     /gene="U44"
     CDS             74501..75196
                     /gene="U44"
                     /codon_start=1
                     /product="U44"
                     /protein_id="AAB06342.1"
                     /translation="MPLGYWGVMGNCFRRLSLFGQPTQANYEMLCSSDDLESEELTYF
                     LDMTYKDFGVYQNDIISHQKDTETMKTLLGLLPMYKKTKLRHTIMERCLSNCPNHVKD
                     ALCVELMKAEKILQTMDVVFMKTLIGEFSMCTDNLNQLLNKFATDQSTLSDVEKINSL
                     IEIDGENSKRLLVELDPILHEETGLYQALPNVVTEAPSEKVKSIHVESEGESVWSSVT
                     EGGIMKQEKGTGV"
     gene            complement(75143..76273)
                     /gene="U45"
     CDS             complement(75143..76273)
                     /gene="U45"
                     /codon_start=1
                     /product="U45"
                     /protein_id="AAB06343.1"
                     /translation="MYSVISEKISETITLQRQTSSRYIEFFVFRNVDINELWTTDISE
                     DKTHDVWPAINEKSFKKFLENELTSYQRPISLLGIPQNGTVSKTCKREKQRETDCVNY
                     VRKHGNPVTFYPRHRAKRNANTDTCISEEPSILVSHHRNSKMDVFMDANKITLVNREL
                     IWVPHDQVRIVKLDISLCIPDGFFGVIIGHSNDVFCECITEIITDETDISVFLMNLSE
                     HSLMLLPGDVEFSINFLPCYIPEPWEMINLSPPESAVFHLKTCREFIIKPNSYTIQCF
                     DAMYVCADELKALMIPSKEIIKLGLLIETYIWNKDTIPSIKIFNSTRKTIYIPTGICI
                     ARIIFTCGHFCLSLMPERAINRLQVLDASSFFLFHYAAFSNA"
     regulatory      complement(75210..75215)
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U45"
     gene            76346..76650
                     /gene="U46"
     CDS             76346..76600
                     /gene="U46"
                     /codon_start=1
                     /product="U46"
                     /protein_id="AAB06344.1"
                     /translation="MSCKKGARQRLYVSLWLFYILVFAAATEMDFYSSECHSHTYEIV
                     LNSFSSIWLLINLFLLLCSFAIFLKYWCYKTFASETVKGY"
     regulatory      76645..76650
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U44; U46"
     gene            complement(76739..78999)
                     /gene="U47"
     regulatory      complement(76739..76744)
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U47"
     CDS             complement(76783..78999)
                     /gene="U47"
                     /note="glycoprotein O"
                     /codon_start=1
                     /product="U47"
                     /protein_id="AAB06345.1"
                     /translation="MLHISRLGLFLALFAIVMHSVNLIKYTSDPLEAFKTVNRHNWSD
                     EQREHFYDLRNLYTTFCQRNLSLDCFTQILTNVFSWNIRDLQCKSAVNLSPLQNLPRA
                     ETKIVLSSTAANKSIVASSFSLFYLLFATLSTYTADPPCVELLPFKILGTQLFDIKLT
                     DESLQMAISKFSNSNLTRSLTPFTPEIFFNYTSFVYFLLYNTTSCIRSNDQYFEHSPK
                     PINVTTSFGRAIVNFHSILTTTPSSTPSSTSASITSPHIPSTNTPTPEPSPVTKNFTE
                     LQTDTIKVTPNTPTITAQTTESIKKVVKRSDFPRPMYTPTDIPTLTIRRNATIKTEQN
                     TENPTENPKSPPKPTNFENTTIRIPETFESTTVATNTTQKLESTTFATTIGIEEISDN
                     IYSSPKNSIYLKSKSQQSTTKFTDTEHTTPILKFTTWQDAARTYMSHNTEVQNMTENF
                     IKISLGETMGITPKEPTNPTQLLNVKNQTEYANETHSTEVQTVKTFKEDRFQRTTLKS
                     SSEPPTVQTLSVTPKKKLPSNVTAKTEVQVTNNALPSSNSSHSITKVTEEPKQNRMSA
                     STHGEINHTEIPRMTPILNAHTWEKSTTPQWPFTAETSLTTSSKSAILTWSNLLTTPK
                     EPLTNTSLRSTNHITTQLTTSNRTQSAKLTKAHVSSQTTNIYPQTITERSTDVKKKSS
                     TESREANKTLPGNDYRVTDKNSHNHPDNLTTKAYSTQNATHYTYNERHDLNNTDST"
     gene            complement(79260..81349)
                     /gene="U48"
     regulatory      complement(79260..79265)
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U48"
     CDS             complement(79265..81349)
                     /gene="U48"
                     /note="glycoprotein H"
                     /codon_start=1
                     /product="U48"
                     /protein_id="AAB06346.1"
                     /translation="MLFRLWVFVLLTPCYSWRPWTISDESHCKNGNSENPIVRPGFIT
                     FNFYTKNDTRIYQVPKCLLGSDITYHLFDAINTTESLTNYEKRVTRFYEPPMNDILRL
                     STVPAVKQFNLDHSIQPQIVYSLNLYPSHGIYYIRVVEVRQMQYDNVSCKLPNSLNEL
                     IFPVQVRCAKITRYAGENIYTHFFTPDFMILYIQNPAGDLTMMYGNTTDINFKAPYRK
                     SSFIFKQTLTDDLLLIVEKDVVDEEYRFISDATFVDETLDDVDEVEALLLKFNNLGIQ
                     TLLRGDCKKPDYAGIPQMMFLYGIVHFSYSTKNTGPMPVLRVLKTHENLLSIDSFVNR
                     CVNVSEGTIQYPKMKEFLKYEPSDYSYITKNKSIPVSTLLTYLATAYETNVTISRYKW
                     SDIANTLQKIYEKHMFFTNLTFSDRETLFMLAEIANFIPADERMQRHMQLLIGNLCNP
                     VEIVSWAHMLTADKAPNLENIYSPCASPVRRDVTNSFVKTVLTYASLDRYRSDMMEML
                     SVYRPPDMARVAAIQCLSPSEPAASLPLPNVTFVISPSYVIKGVSLTITTTIVATSII
                     ITAIPLNSTCVSTNYKYAGQDLLVLRNISSQTCEFCQSVVMEYDDIDGPLQYIYIKNI
                     DELKTLTDPNNNLLVPNTRTHYLLLAKNGSVFEMSEVGIDIDQVSIILVIIYVLIAII
                     ALFGLYRLIRLC"
     gene            81508..84700
                     /gene="U49"
     CDS             81508..82266
                     /gene="U49"
                     /codon_start=1
                     /product="U49"
                     /protein_id="AAB06347.1"
                     /translation="MSLTGLPDIRKKIGQFHHLRIYKQILSLQGNFARLNYFLGDVFP
                     ANLRSASVSVFFEVRLGPRIPDCIVLLKSVDAKDEFAFHCYFFEFKTTLGKSTMQSVH
                     HNCIHQAQYLQGLRQLHQSISFLDQYLIADEVLWNVVPVICFFRQWGLKLDFFKKFSG
                     KTKRLSFSFICDLFARSQDGAVQSLLSIPNYTNFRRACQKHTDLYRRRYQKASKSVLT
                     KTSGENRSRASRQVAKNAPKNRIRRTAKKDAKRQ"
     gene            82043..84700
                     /gene="U50"
     CDS             82043..83710
                     /gene="U50"
                     /codon_start=1
                     /product="U50"
                     /protein_id="AAB06348.1"
                     /translation="MAQCNLFYQYPITPILEGHVRNILICTEEDIRRLQSQSSLRLRE
                     KIDQGHRDKLLRMRLKTELDALQRKMQKDSDVLNSHLKAIEDALLFTNDGEVNVETKA
                     DTQLLPKSPERLEKFNQVAITPLDPFIRFTDDFRGEMINTFFNNAQMWNFTFGSWFYK
                     LKRVFYNEPGLRRALKITNVDSLTISKELLTVTVNALEQATVYPIFGSEMSDLEAALC
                     ILAAFYSTYENSQIDERTTLVDIITLLPVIFRLLGSEITALKNVSPSGTYFGFNDPSC
                     MKFFVPMRKGKHYAENTFGNHVLVKMLLGRGVMQKIPGEKDSQNFDVEARLHGAIKND
                     VLVYWTYQLMRPKLGNNVPIFIHDQHYLRSGLVAIESLFLLWRILNSESLFNKRVGKF
                     LLTSIFPQLENVDFAENNFEAGNIQNFEYLMHHYVVPMYNLQNDISISTLFPGLVAVC
                     VNESVRLGWEHKCAGAPSDAVQVQSKENPFVEYIRAQMEQQADVAILEKHDCILFHFE
                     NGLNITLSFTLPRQRLFAMASSLFNVNDTYDFIYFLVLGFLPIPAII"
     gene            83808..84713
                     /gene="U51"
     CDS             83808..84713
                     /gene="U51"
                     /note="G-protein coupled receptor"
                     /codon_start=1
                     /product="U51"
                     /protein_id="AAB06349.1"
                     /translation="MEKETKSLAWPATAEFYGWVFIFSSIQLCTVVFLTVRFNGFKVG
                     REYAVFTFAGMSFNCFLLPIKMGLLSGHWTLPRDFCAILLYIDDFSAYFSSWSLVFMA
                     IERINYFCYSTPLLNENSKALAKVCFPIVWVVSGVQALQMLNNYKATALQNETGQCFL
                     AFLRSGHDMWLMLVYSVVIPVMLVFFYLYSKNFMLLKDELSSVTTYLCIYLLLGTIAH
                     LPKAALSEIESDKIFYGLRDIFMALPVLKVYYISAMAYCMACDDHTVPVRLCSIWLVN
                     LCKKCFSCTRREKGSDLEVGIKMLK"
     regulatory      84695..84700
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U49; U50; U51"
     gene            complement(84731..85508)
                     /gene="U52"
     regulatory      complement(84731..84736)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="U52"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             complement(84732..85508)
                     /gene="U52"
                     /codon_start=1
                     /product="U52"
                     /protein_id="AAD49655.1"
                     /translation="MTQIGQYIKLNDAVPNLILHITTKLLRNENLTSFKQEELLLIQH
                     VCTSMLSHGIKILLLRESLYNSGIGDIVILNRKISNNYWFRLFSILKQHSDAELLRHM
                     FNESHSAYISKKLHYSGNVSHIINFLFMDEFGLSLKIPEEIICEGNIVFSVGAIYNHR
                     LLKICRFFNRFWGDQEREPAVRLICKHLWFAYLIMFGKFEISTLAYNQQRAEHKAGLF
                     SFLQNDFKVFCGMSENPQLLDSSAIFDLTGISAEDLFSYE"
     gene            85515..87101
                     /gene="U53"
     CDS             85515..87101
                     /gene="U53"
                     /note="proteinase"
                     /codon_start=1
                     /product="U53"
                     /protein_id="AAD49656.1"
                     /translation="MSKVWVGGFLCVYGEEPSEECLALPRDTVQKELRSGNIPLPLNI
                     NHNEKATIGMVRGLFDLEHGLFCVAQIQSQTFMDIIRNIASKSKLIAAGSVIEPLPPD
                     PEIECLSSSFPGLSLSSKVLQDENLDGKPFFHHVSVCGVGRRPGTIAIFGREISWILD
                     RFSCISESEKRQVLEGVNVYSQGFDENLFSADLYDLLADSLDTSYIRKRFPKLQLDKQ
                     LCGLSKCTYIKASEPPVEIIVATGKVAGDQVQLTTEPGSELAVETCDVSVVHGNYDAV
                     ESATATTAMSNQNLPNTTPLLSSPPFSDCVFLPKDAFFSLLNVTTGQQPKVVPPVSVH
                     PPVTEQYQMLPYSESAAKIAEQESNRYHSPCQTMYPYWQYSPVPQYPAVLHGYRQPKT
                     FKKRHFQSDSEDELSFPGDPEYTKKRRRHKVDNDDDKEMAREKNDLRELVDMIGMLRQ
                     EINALKHVRAQSPQRHVVPMETLPTIEEKGAASPKPSILNASLTPETVNRSLAGQNES
                     MDLLKLNKKLFVDALNKMDS"
     regulatory      87084..87090
                     /regulatory_class="polyA_signal_sequence"
                     /gene="U53"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     gene            complement(87302..95201)
                     /gene="U57"
     gene            complement(87302..91162)
                     /gene="U56"
     gene            complement(87302..90271)
                     /gene="U55"
     gene            complement(87302..88715)
                     /gene="U54"
     regulatory      complement(87302..87307)
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U54; U55; U56; U57"
     CDS             complement(87336..88715)
                     /gene="U54"
                     /note="virion transactivator"
                     /codon_start=1
                     /product="U54"
                     /protein_id="AAD49657.1"
                     /translation="MQPATLQWSSYVLQLRLTTAAILKPGELRYFKCGLGICPPSSSV
                     VCTCRDESSFAASPFTYIDPKDYGNIPFAVHNISDLDLDLGRLPIVLNIFALPYANVT
                     VSNLPVQRIEAYDRHAIPHGQCEAQFILYGPLTRIKIYAADIRWTEKTPEEPTRYLFN
                     ADIWINLQNTPLDQIFNSAKIEFISHRHVSISRILLCGNLLILKTVYENDYLLDDTFF
                     PEKLNIQLSLTPHTADITMSQNQETLLKCNVGSITVGATKNIVSNLITPFHCSFHTIF
                     ESNSNFTGFFIPKLLHGISITTCIWDETRPLYITMKAQKKNCRINYSQELGKVFFFPK
                     QILPPGNNIEFSWTEMSNIYVNIESPNGPVKDIVALASQPVSRAPSLTTVAHVTPEIS
                     MGIFLKSLRIAFDKEHLVPLHFFLKPGESTRMEFMPPETPQSLTILEGDVGIRFIPCH
                     NNYSHRSSP"
     CDS             complement(88793..90271)
                     /gene="U55"
                     /codon_start=1
                     /product="U55"
                     /protein_id="AAD49658.1"
                     /translation="MLFKNTLAYYNFSITYTQDYKNTPRLNTRVLHPSCKITSSLKKT
                     QYLKSKVKHKMFFCTNMYSPQLNHVLQLVFDCNHIVPNSYQEITLKCRISSTKPGILF
                     ITDGTESETEDVLFDVQFLENTMTIKIKILPISRTVPVRIHLFSIPIYLPSPALEIDD
                     INALCQKENIDPIVYEQYGLTNMPISTTNVINQFKVVSNDSVETSLILLNLSWTESPY
                     QSQKLDRYGRKLLIVFSVFSIDTRKCSYWKNLFKSMIPLCRVNMISEPGISIYKIEFN
                     DPFLTIFLRNVVLPENERRFPITKECYLRLTFSPPNRSTVTLNMNMPYFKICADGKSL
                     EVFFPSDMSLVINTNKEITLRGKFTNKKIVGIFIPVQTHVFKLYPFLWFAQEPLKLRI
                     SCEKTVSVTEHDMLGRIFFVTKKLFRKPFRSLSNSDMKSLLTHTENTDKPFEVHFMGN
                     CFPAYLLPELTLHPLEYEDKPARGNPQILPSVEKHSIIKMRI"
     CDS             complement(90272..91162)
                     /gene="U56"
                     /codon_start=1
                     /product="U56"
                     /protein_id="AAD49659.1"
                     /translation="METVYCTFDHKLSLSDISTLCKLMNIVIPIPAHHHLIGSGNLGL
                     YPIVSSNKDYVHIRNVLRTMVVTILQKVEGNQLVLRKPMTGQQYAIKNTGPFPWEKGD
                     TLTLIPPLSTHSEEKLLKLGDWELTVPLVVPTAIAAEINIRLLCIGLIAVHREYNEMQ
                     TIIDELCSIQYRDVLIKLPDIVNDKQSMYSMKTACISLSMITAMAPDIVRTYIDRLTL
                     EDHSMLLIKCQELLSKRTTLSTQRCGQLHATDIKDELKKIKSVLTMIDQINSLTNEKT
                     YFVVCDVSADNRMATCIYKN"
     CDS             complement(91164..95201)
                     /gene="U57"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="U57"
                     /protein_id="AAD49660.1"
                     /translation="MENWQATEILPKIEAPLNIFNDIKTYTAEQLFDNLRIYFGDDPS
                     RYNISFEALLGIYCNKIEWINFFTTPIAVAANVIRFNDVSRMTLGKVLFFIQLPRVAT
                     GNDVTAPKETTIMVAKHSEKHPINISFDLSAACLEHLENTFKNTVIDQILNINALHTV
                     LRSLKNSADSLERGLIHAFMQTLLRKSPPQFIVLTMNENKVHNKQALSRVQRSNMFQS
                     LKNRLLTSLFFLNRNNNSSYIYRILNDMMESVTESILNDTNNYTSKENIPLDGVLLGP
                     IGSIQKLTNILSQYISTQVVSAPISYGHFIMGKENAVTAIAYRAIMADFTQFTVNAGT
                     EQQDTNNKSEIFDKSRAYADLKLNTLKLGDKLVAFDHLHKVYKNTDVNDPLEQSLQLT
                     FFFPLGIYIPTETGFSTMETRVKLNDTMENNLPTSVFFHNKDQVVQRIDFADILPSVC
                     HPIVHDSTIVERLMKNEPLPTGHRFSQLCQLKITRENPTRILQTLYNLYESRQEVPKN
                     TNVLKNELNVEDFYKPDNPTLPTERHPFFDLTYIQKNRATEVLCTPRIMIGNMPLPLA
                     PISFHEARTNQMLEHAKTNSHNYDFTLKIVTESLTSGSYPELAYVIEILVHGNKHAFM
                     ILKQVISQCISYWFNMKHILLFCNSFEMIMLISNHMGDELIPGAAFAHYRNLVSLIRL
                     VKRTISISNINEQLCGEPLVNFANALFDGRLFCPFVHTMPRNDTNAKITADDTPLTQN
                     TVRVRNYEISDVQRMNLIDSSVVFTDNDRPSNENTILSKIFYFCVLPALSNNKACGAG
                     VNVKELVLDLFYTEPFICPDDCFQENPISSDVLMSLIREAMGPGYTVANTSSIAKQLF
                     KSLIYINENTKILEVEVSLDPAQRHGNSVHFQSLQHILYNGLCLISPITTLRRYYQPI
                     PFHRFFSDPGICGTMNADIQVFLNTFPHYQRNDGGFPLPPPLALEFYNWQRTPFSVYS
                     AFCPNSLLSIMTLAAMHSKLSPVAIAIQSKSKIHPGFAATLVRTDNFDVECLLYSSRA
                     ATSIILDDPTVTAEAKDIVTTYNFTQHLSFVDMGLGFSSTTATANLKRIKSDMGSKIQ
                     NLFSAFPIHAFTNTDINTWIRHHVGIEKPNPSEGEALNIITFGGINKNPPSILLHGQQ
                     AICEVILTPVTTNINFFKLPHNPRGRESCMMGTDPHNEEAARKALYDHTQTDSDTFAA
                     TTNPWASLPGSLGDILYNTAHREQLCYNPKTYSPNAQFFTESDILKTNKMMYKVINEY
                     CMKSNSCLNSDSEIQYSCSEGTDSFVSRPCQFLQNALPLHCSSNQALLESRSKTGNTQ
                     ISETHYCNYAIGETIPLQLIIESSI"
     gene            95213..98813
                     /gene="U58"
     CDS             95213..97531
                     /gene="U58"
                     /codon_start=1
                     /product="U58"
                     /protein_id="AAD49661.1"
                     /translation="MQHTGNCETLIVNSCFGSTCARSIPVFIDSCDLTAEVSRDEETR
                     LARSVPVVLEKIESIIEKIFQTSGPNIVHDKDRAKIALCRLLLGPVAVPCFCEEWDTN
                     DYLSKSGCKCLGPILYIHTSRCRCSDIPVFKFSIMKDYYASHVFRGLLSLKEWNTHLP
                     NVLCTCELSMSDRYVATVFPKQNSIYLEYYPYFLCYLCRYLTVIEIEQCTNDLISLLG
                     PKVAQRVIIHFKLLFGFRHKPHMGTVDSWFWENFFMLELHKLWLTVVKHNRVTTDFFN
                     VVYEKIQNYKQYAIKTLRMSSKAVPAIQRFCLAKFKQQLLYLNIKVTVKKNKRELCLN
                     GFVYGKTLYVVESSQLIFRNLLLLYYDYSLPDECKTKEENVLTTHYIRVISRLSFKQS
                     RSAVPPGVKPDFTFVAQLPKRKELPNVPGGIDFAEITSVRHGAVILNAFNTNKVMNLK
                     ATISKRANFVYHRIPKTMTHSFVMYKHTFKEPAFTVSTFVSNDDLDMSSLNINIRGPY
                     CDFLYALGVYKMHVSIQDLFLPAFVCNSNNSVDLQGLEDQDVVRNRKKKVYWITNFPC
                     MISNANKVNVGWFKAGTGIIPRVSGKDLQNVLLQELNNVREIPGLVFDMDLHQLLVLL
                     EQRNLHQIPFLVKQFLIFLRLGLLMGYGNSRRNKVHDIMLHLISNGLFDFNKNSVANT
                     KIKHGCALVGTRLANNVPKIIARQKKMKLDHMGRNANSLAVLRFIVKSGEHKNKTVFI
                     KLLEYLAETSTAINTRNEVARLLLTLTTNMKT"
     gene            97528..98813
                     /gene="U59"
     CDS             97528..98580
                     /gene="U59"
                     /codon_start=1
                     /product="U59"
                     /protein_id="AAD49662.1"
                     /translation="MNVPMADEWFDCAIRLDSETIAVHEIFNSDLSKLLNLHSKTVYM
                     SDLCAFISGCVNRNVGKLTIYWHVYGDIIYALTGILHCVKITIECGERIADGRYRLYE
                     IPKLFLMRGQSTPLELKWKHAVGIATTNKPLLTHVLTDVLETSPFTLPDTLLSVQELS
                     IFRERLSYIYYVLGLDVDIVARTEREIFQKCAELARLQQVFLIQGNIMENFVLVQACL
                     FQLGADGLWEEMSGSVRPRPELMSSAFIQHRVMVNNCYCLAVIFNAIYKHKVSLPTVE
                     RSHEIVHRVVQEYYKSYVNAPLSVLVCATKVLTLFTEEYNFQSALVFVSQFFQVDVEA
                     SRADVIRLFLACLKGD"
     gene            complement(97675..103784)
                     /gene="U66"
     regulatory      complement(97675..97680)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="U66"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             complement(join(98577..99704,102912..103784))
                     /gene="U66"
                     /note="Putative terminase"
                     /codon_start=1
                     /product="U66"
                     /protein_id="AAD49667.1"
                     /translation="MLRTCDITHIKNNYEAIIWKGERNCSTISTKYPNSAIFYKKRFI
                     MLTPELGFAHSYNQQVKPLYTFCEKQRHLKNRKPLTILPSLTRKLQEMKFLPASDKSF
                     ESQYTEFLESFKILYREPLFLQIDGFIKDFRKWIKGEFNDFGDTRKIQLEPFQKNILI
                     HVIFFIAVTKLPALANRVINYLTHVFDIEFVNESTLNTLKQKTNVFLVPRRHGKTWFI
                     VPIISFLLKNIEGISIGYVAHQKHVSHFVMKEVEFKCRRMFPEKTITCLDNVITIDHQ
                     NIKSTALFASCYNTHSIRGQSFNLLIVDESHFIKKDAFSTILGFLPQASTKILFISST
                     NSGNHSTSFLMKLNNSPFEMLSVVSYVCEDHAHMLNERGNATACSCYRLHKPKFISIN
                     AEVKKTANLFLEGAFIHEIMGGATCNVINDVLITEQGQTEFEFFRYSTINKNLIPFLG
                     KDLYVYLDPAYTGNRRASGTGIAAIGTYLDQYIVYGMEHYFLESLMTSSDTAIAECAA
                     HMILSILDLHPFFTEVKIIIEGNSNQASAVKIACIIKENITANKSIQVTFFHTPDQNQ
                     IAQPFYLLGKEKKLAVEFFISNFNSGNIKASQELISFTIKITYDPVEYALEQIRNIHQ
                     ISVNNYITYSAKKQACSDDLIIAIIMAIYVCSGNSSASFREI"
     regulatory      98808..98813
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U58; U59"
     gene            99716..102891
                     /gene="U62"
     CDS             99716..99979
                     /gene="U62"
                     /codon_start=1
                     /product="U62"
                     /protein_id="AAD49663.1"
                     /translation="MNSALNEIKDDFENCETKNDLFKIIDKISKNCNFIVEQVESLPR
                     RVDSAAILFDNLAVEIFNDVIYRQNGDGVAAKIRQGNGQNIDT"
     gene            99921..102891
                     /gene="U63"
     CDS             99921..100577
                     /gene="U63"
                     /codon_start=1
                     /product="U63"
                     /protein_id="AAD49664.1"
                     /translation="MEMALPRKYDRVTGRILTHKNNQMCTTECSQMYNLHNPITFELG
                     LGNVFVCMRCLTVHHCDMQTDCTIVNTHEGYVCAKTGLFYSGWMPTYADCFLEPICEP
                     NIETVNVVVVLLSYVYSFLMENKERYAAIIDSIIKDGKFIKNVEDAVFYTFNAVFTNS
                     TFNKIPLTTISRLFVQLIIGGHAKGTIYDSNVIRVSRRKREDSLLKKMRLEYGNALIL
                     "
     gene            100555..102891
                     /gene="U64"
     CDS             100555..101883
                     /gene="U64"
                     /codon_start=1
                     /product="U64"
                     /protein_id="AAD49665.1"
                     /translation="METHLYYDTLYQYQGGVYPAHICLPTDAYLPMRVDCIESLYFRC
                     VFFKNGMHYTEWSKLKFTVISREIKFKDVLKNADFDELFTGLVVMTIPIPIVDFHFDI
                     DSVILKLVYPQLVHREIVLRLYDLICIRPSSDRPSEVSAKNIGIDFYQLTSQGNKQTP
                     DEEKRCLFFQQGPLEPPSTVRGLKAAGNAKPMQFPAHVNEKMTESFLSDSWFEQKVRC
                     KKILDFTQTYRVVVCWYELSFSREMQIENNLLSASQLKRVNAADFWDRTDRYLRDIGS
                     RVLTHIVKTLQIHNRQFKQKFNCNFPVNFSFEHLLSFMQLGKDFWILNLTLDSCIIKA
                     IICFLGFRNGRKSFLAQDEVWGDLIDCSKGSVIYGEKIQWILDSTNNLYSTRREKQNK
                     SWELYVDCCALYVSEKLELDFVLPGGFAITGKFALTDGDIDFFNWRFGLS"
     gene            101840..102891
                     /gene="U65"
     CDS             101840..102847
                     /gene="U65"
                     /codon_start=1
                     /product="U65"
                     /protein_id="AAD49666.1"
                     /translation="MAISTFSIGDLGYLRNFLQNECNWFRICKKTFYREYRSVATSSP
                     IFSLKNKPKKYCMHCEMVVLKRSHEFMFSLAVNGIHFGQFLTGIMKFKKKQVAEGLCY
                     YVLELGSISPVDLSFIPKYNSDCVTSMHCVTPELIYENCSIVCPEEASRLTVKGLGDN
                     KLIPLGGCGVWCLKNGGDLYIYAFVLAYDLYVACYDKTIFPSLAKIVFDMIACDSEDC
                     VFCKDHNKHVSQAGHIVGCVSNQETCFCYTPCQKKMTDINNPELISLLCDQEINKIDI
                     MYPEKKASLSLDINSYVHGYLGDEPCALKCVNWMPIRISSALSRLIILSCPVCKRVVM
                     D"
     regulatory      102886..102891
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U62, U63; U64; U65"
     gene            103756..108584
                     /gene="U67"
     CDS             103756..104817
                     /gene="U67"
                     /codon_start=1
                     /product="U67"
                     /protein_id="AAD49668.1"
                     /translation="MWVMSQVRSMEPDLTLAAVYQAAANLTEQDKEIFSEAVKTAFSV
                     CSSAAPSARLRMIETPTQNFMFVTSVIPSGVPSGEKKTKLNIDAALDNLALSFANKKS
                     KKMARTYLLQNVSRTQDQQVAISGTYILYTKKHIETSLMLDKTKLVKQILEYAETPNL
                     LGYTDVRDLECLLWLVFCGPKSFCQSDSCFGYSKTGYNAAFPNLLPPYLYECGQNNGL
                     FFGIVQAYVFSWYSDFDFSALEISERARRRIRSLLYDLKQKFSEQEISVLPVASQMCI
                     FCALYKQNKLSLEYVSGDLKTSVFSPIIIKDCLCVQTTISTTQMLPGTKSSAIFPVYD
                     LRKLLSALVISEGSVRFDI"
     gene            104817..108584
                     /gene="U68"
     CDS             104817..105161
                     /gene="U68"
                     /codon_start=1
                     /product="U68"
                     /protein_id="AAD49669.1"
                     /translation="MSLKDYLRQSISKDLEVRHRDSLKIRLGERHPLSVHQHMIAARQ
                     IIKSDNAEHQHVISSLSGFLDKQKSFLKVQQRALKQLEKLDVDEIIDTAAEVKAVSNN
                     IKETLMASTELE"
     gene            105164..106855
                     /gene="U69"
     CDS             105164..106855
                     /gene="U69"
                     /note="Phosphotransferase; ganciclovir kinase"
                     /codon_start=1
                     /product="U69"
                     /protein_id="AAD49670.1"
                     /translation="MDNGVETPQGQKTQPINLPPDRKRLRKHDGLGKGVKRKLFAEDS
                     SPLKKQIPACSDMETLSSPVKFGCKSRSASALDESFGKCKHETACDCSAIEELLCHES
                     LLDSPMKLSNAHTIFSSDKWKLELEKIIASKQIFLDMSENVELVAYGETLCNLRIFEK
                     ISSPFLFDVQSEERSYSVVYVPHNKELCGQFCQPEKTMARVLGVGAYGKVFDLDKVAI
                     KTANEDESVISAFIAGVIRAKSGADLLSHDCVINNLLISNSVCMDHKVSLSRTYDVDL
                     YKFEDWDVRNVMNYYSVFCKLADAVRFLNLKCRINHFDISPMNIFINHKKEIIFDAVL
                     ADYSLSEIHPEYNGTCAIAKEYDRNLQLVPISRNKFCDMFNPGFRPLVANAMILVNVC
                     EAFDGENNPLRHCNLDLCAFAQVVLLCVLRMTDKRGCREAQLYYEKRLFALANEACRL
                     NPLRYPFAYRDACCKVLAEHVVLLGLLFYRDVVDIYEKIYDFLDERGEFGLRDLFEAT
                     FLNNSKLTRRQPIRGGLASLQSSEYGEKLLHDLRALFLITSSADLDKDTSSLFQM"
     gene            106863..108584
                     /gene="U70"
     CDS             106863..108329
                     /gene="U70"
                     /note="Alkaline exonuclease"
                     /codon_start=1
                     /product="U70"
                     /protein_id="AAB06353.1"
                     /translation="MDLNQISETLSAVAEEEPLTMFLLDKLYAIREKIKQVPFSIVRL
                     CHVYCMLIKYNASNNNCILGRKLIEEMQQFLCGARVDGSEDVSMDMSELCKLYDYCPL
                     LCSALCRAPCVFVNKLFKIVERETRGQSENPLWHALRRYTVTATKLYDIYTTRNFLEH
                     KGQQFFGEAVIYGAKHERVIRHLVAIFYVKREVKETLGLLLDPSSGVFGASLDACFGI
                     SFNEDGFLMVKEKALIFEIKFRYKYLRDKEDHFVSELLKNPTEKSFSDFILSHPVPAI
                     EFRERGKIPSSREYLMTYDFQYRPQRKLRTCPTPAILTPHIKQLLCLNETQTSTVIVF
                     DCKSHLSEQKLSVFQKAVFTVNVFVNPKHRYFFQSLLQQYVMTQFYINDHSNPEYIES
                     TEVPSVHIVTALFRRRTEEERSLHLVIDETEYIEEEIPLALIVTPVAPNPEFTCRVIT
                     DICNLWENNICKQTSLQVWAQSAVNQYLAACVRKPKTP"
     gene            108266..108584
                     /gene="U71"
     CDS             108266..108511
                     /gene="U71"
                     /note="Myristylated virion protein"
                     /codon_start=1
                     /product="U71"
                     /protein_id="AAB06354.1"
                     /translation="MGTKCCKPVSCGMCKKTENTLMDYKGNPILLTTEFTVLTDTESE
                     EEGMADLEKPLLERVQATLAAKCDTEVEKKLPLKSKK"
     gene            complement(108543..109627)
                     /gene="U72"
     regulatory      complement(108543..108548)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="U72"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     regulatory      108564..108569
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U67; U68; U69; U70; U71"
     regulatory      108579..108584
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U67; U68; U69; U70; U71"
     CDS             complement(108593..109627)
                     /gene="U72"
                     /note="glycoprotein M"
                     /codon_start=1
                     /product="U72"
                     /protein_id="AAB06355.1"
                     /translation="MASSRVDTINLRIWLVSIICAALSFINVTVHLIAINFPNLGFPC
                     AYFEINDLKAVNLSANNEIYQMTHQLYINPVQIICYVLIMAILFLLIIIYYIVCCAKV
                     FSSNKTSNVNQTTRDITWMGDTSSCFQFILIMDTFQLFVTALSFRLVALGAFAYSIFF
                     VCFTTFNVTLITQFQSADKSFFAFQKIHPNLKGTVQFKTVVINLSELMLGYSTMFLGI
                     TTCLGVGNSIYIRSITVAFSSINTFLVMACIYSIVIEAVLVRYVKPLFGYYVGMFCGA
                     VGLSFPILQYETFFESEWSTGLIINLSVVAIISIGFIICRLVRYLVKKKRRYKQLLNA
                     ESSSLMDENE"
     gene            109640..114005
                     /gene="U73"
     CDS             109640..111982
                     /gene="U73"
                     /note="origin binding protein"
                     /codon_start=1
                     /product="U73"
                     /protein_id="AAB06356.1"
                     /translation="MENRFQNDTLFSEWFGQSLSDVRFPDNVTVYSQADSAVSFENVR
                     QPIKLVRAAMGSGKTTALIHFLKQVPKELSVLLISCRKTFAAEILHRFTLNGLEDFEL
                     YCDITERQINNRKVIVQIESLHRLTENYDVLILDEIMSIIKQFYSKTMTKTKEVDCKF
                     LSLIKNSSHVIAMDATLTRHVVEFFAAFKPDTQIALIRNTFVSAMFSNRVAYFCDTFF
                     GKEFSFFARLEDKLRWDKKLCLFCSTVLAAEYMHDLIRSRFSLKKVLLLTSKQGKCSS
                     IESWIRYDVVIYTSVVTVGLSFEPVYFSSLFVYIQLAKGGPDMVSIFQSIGRVRRVID
                     EDIYIYMNPVLIKSYDPLAPIAMPPCSDWSVAEQSIISESCIDFRGKCSGAHKYNFCS
                     VLKCLFRYRHYIEKTTITSLSDSLFLLCSLLCENSIKVDIVGNGFPMRKEVFLSFLQI
                     LVEECHFIEKKITLPGDNMTFQEIISSRETIMNGDFYENGNQLLHKDYITDMGKFRAT
                     FLSPGVDIFIASDIVSDLKNESKRYVFVNVWLQKCVSAGVESTRIERVFNERIKSYVL
                     PKSFLCDEYFVLGDISGVYEWGMLIDLAFLAEMIRKDLKLKSCTDTTTDISEDDLLLC
                     AARRSSDILQIMQLVFTVHVQFFQRYSLQTLQLFNKLRGMRIVTGVFSIEKFSISILR
                     LFFKCAFNMTLSASKPRYIPGKAYRNLTKNDLENMLDNWEISRTNLKTCKELRKALTE
                     ASRARRKQTIYKLQGSDISLSVSEVGVFGQHASPGVCVSS"
     gene            111951..114005
                     /gene="U74"
     CDS             111951..113939
                     /gene="U74"
                     /note="helicase/primase complex"
                     /codon_start=1
                     /product="U74"
                     /protein_id="AAB06357.1"
                     /translation="MHLRGCACHLSLYCVYNDWENKIYRVPIFQCLFLEAETRSLKTF
                     LIRGQSLDQESLNEIEVTRKETMLWDLQEQSNMMDKKIAAISSLIMNNGELLRKLSKF
                     FVPLTVVLGDDGLEILEAYVCGEEPMLPLDTVPVILRCVGDYAALDTKHLLSNECTQA
                     SKKLRFGYSVMDFHFSLTVSDVKICFSHTDTGEAVCEKMKQIFYFSVCAFGGEQVLLV
                     TPKNAYALLFDDDLCLLLLQSVFAFLHEKIFAVYKQVLVQLCEYIGPDLWPFGNERSV
                     SFIGYPNLWLLSVSDLERRVPDTTYICREILSFCGLAPILGPRGRHAIPVIRELSVEM
                     PGSETSLQRFRFNSQYVSSESLCFQTGPEDTHLFFSDSDMYVVTLPDCLRLLLKSTVP
                     RAFLPCFDENATEIELLLKFMSRLQHRSYALFDAVIFMLDAFVSAFQRACTLMEMRWL
                     LVRDLHVFYLTCDGKDSHVVMPLLQTAVENCWEKITEIKQRPAFQCMEISRCGFVFYA
                     RFFLSSGLSQSKEAHWTVTASKYLSACIRANKTGLCFASITVYFQDMMCVFIANRYNV
                     SYWIEEFDPNDYCLEYHEGLLDCSRYTAVMSEDGQLVRQARGIALTDKINFSYYILVT
                     LRVLRRWVESKFEDVEQAEFIRWENRMLYEHIHLLHLN"
     gene            complement(113880..116620)
                     /gene="U76"
     gene            complement(113880..114723)
                     /gene="U75"
     regulatory      complement(113880..113885)
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U75; U76"
     CDS             complement(113974..114723)
                     /gene="U75"
                     /codon_start=1
                     /product="U75"
                     /protein_id="AAB06358.1"
                     /translation="MKSLKKLKELETSDVFNTLHVRTILKVIKIDKCVSLARHSLVNI
                     TVGDDGIWFHLEDGTMINGLEYKTICEKELGFQGFIGIIILDSEDTLQELRLNPFQFK
                     RRLIHMKVDTPEEFMLCGLVFALENLPLKQSTLHKLIARLVLFPVLSPVTKILFNTCD
                     KLVCTLRHIFFNEHASEILHKVPPMIRLYNEMKNTHIEVLELYFNTKRSHNFINLSLE
                     SRQLQDSSLQVIQLATQFAQIFYSKNEDTSS"
     regulatory      114000..114005
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U73; U74"
     CDS             complement(114632..116620)
                     /gene="U76"
                     /codon_start=1
                     /product="U76"
                     /protein_id="AAB06359.1"
                     /translation="MHRASANSPLNSVSGSMMWRNQSSGRRPSKRLSDNEATLSTINS
                     ILGAEDMLSKNLLSYLPPNNEEIDMIYPSEQIMTFIEMLHGHKNFFKGQTIHNALRDS
                     AVLKKQIAYGVAQALLNSVSIQQIHDEWKRHVRSFPFHNKKLSFQDYFSVWAHAIKQV
                     ILGDISNIINFILQSIDNSHYNRYVDWICTVGIVPFMRTTPTAPNLYNLLQQVSSKLI
                     HDIVRHKQNIVTPILLGLSSVIIPDFHNIKIFRDRNSEQISCFKNKKAIAFFTYSTPY
                     VIRNRLMLTTPLAHLSPELKKHNSLRRHQKMCQLLNTFPIKVLTAAKTDVTNKKIMDM
                     IEKEEKNSDAKKSLIKFLLNLSDSKSKIGIRDSVEGFIQEITPSIIDQNKLMLNRGQF
                     RKRSAIDTGERDVRDLFKKQIIKCMEEQIQTQMDEIETLKTTNQMFERKIKDLHSLLE
                     TNNDCDRYNPDLDHDLENLSLSRALNIVQRLPFTSVSIDDTRSVANSFFSQYIPDTQY
                     ADKRIDQLWEMEYMRTFRLRKNVNNQGQEESITYSNYSIELLIVPFLRRLLNIYNLES
                     IPEEFLFLSLGEILLAIYESSKIKHYLRLVYVRELNQISEVYNLTQTHPENNEPIFDS
                     NIFSPNPENEILEKIKRIRNLRRIQHLTRPNYPKGDQD"
     gene            116415..121207
                     /gene="U77"
     CDS             116415..118889
                     /gene="U77"
                     /note="Helicase/primase complex"
                     /codon_start=1
                     /product="U77"
                     /protein_id="AAB06360.1"
                     /translation="MSISSLFGGRYDNKFLLNMSSAPKIELIVDKVASLSERRLEGRL
                     PEDWFRHIMDPETEFNGEFADALCIGIDEFAQPLPFLPFKALLVTGTAGAGKTNSIQT
                     LAANLDCIVTATTSIAAQNLSVVLNRSKSAQVKTIFKTFGFNSSHVSMSERQSYIAND
                     ERSIQIQQKQDLSIYWNVISDIAERALGAVACKTKELPDLCESSVIVIDEAGVILRHI
                     LHTVVFFYWFYNALYKTPLYENGIVPCIVCVGSPTQSNALVTSFNPLTQNKDVKRGID
                     VLSALICDDVLSKYCEVDNNWIIFVNNKRCADHAFGDFLKHIEFGLPLKPELIEYVDQ
                     FVKPASYIRNPMNEIETTRLFLSHNEVKNYFRSLHEQVEVTNRNNLFVFPVYFLIKNK
                     TFEDYKSEIGNFSLEIEPWFKSNIHRLNTYSQFADQDLSKTVQLEEIVLEDGSVEETL
                     ITCHLKHIRNSSIGVTSKIKASTVGFSGTYEKFVELLQSDLFIEKTSCEQTIHAYSFL
                     SGLMFGGMYSFCCSEFTTPEVLMEIKNIKMPSIEFLESEMSRMSRDVQTVETDERYDF
                     GLVDDGLSDMDLLEIDPCGDPFFTRYSKLPLTNSLSFEEISLLYTTFKDIFISRFAIL
                     QKHTKGKFGKTLLVTYNRNNVSRKQCGEIYSHLKSFYGMLTYAIPANNYTLEGYTNDN
                     VVHLGTDKQLPQILYKKGLPRLVIKDEMGFISVLDNNVSKFVDVVNGQSFHLCTTVDY
                     ATVSKVSMTITKSQGLSIQKVAIDFGSDPKNLKLSSIYVGMSRVTDPNNLIMNVNPLR
                     LNYENDNFIAPHIVKALKNENTMLIF"
     gene            119139..121207
                     /gene="B6"
     CDS             119139..119378
                     /gene="B6"
                     /codon_start=1
                     /product="B6"
                     /protein_id="AAB06361.1"
                     /translation="MWYELTSAKTNESLPRSTRMYSGGNLKNAQFSLLSSRELVNSYF
                     DVNSGGGLDGVLSINRSSFIFCTTEVILGIGVRIR"
     gene            120836..121207
                     /gene="B7"
     CDS             120836..121063
                     /gene="B7"
                     /codon_start=1
                     /product="B7"
                     /protein_id="AAB06362.1"
                     /translation="MLHNVSKCIHSICIRVCIKLHVICSSRFSIRCFAVYETYSLIPN
                     TSDGRQAFLYAFYGKVHALVADAIRKGFRFG"
     regulatory      121202..121207
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U77; B6; B7"
     gene            121486..123207
                     /gene="U79"
     CDS             join(121486..122116,122213..122412,122495..123106)
                     /gene="U79"
                     /note="DNA replication"
                     /codon_start=1
                     /product="U79"
                     /protein_id="AAD49671.1"
                     /translation="MYAEERGYGSFDNVIQAYEQIISQSLHLKRFEFDNGCFIEFLAD
                     SGTCETFSKGWISMIYWTSETDSMGSLTVDIGMDEGKCRTYRARGLLLCSKSITSISQ
                     NTEGRERILTVSHENGKLQITFVTIAKVSSEPELRNLGDLKFMEKFEKECRALDRKKH
                     DDEHRKRSGKQKEKRKVEDIDKKKEDEKRKQEEKKRNDEDKRPDKKDEFDEPPKEKRQ
                     KSHHETKRNLEEQSHEDGIAPTSTTFVNGAVEGALSPCVSIDNHEDQQHDELDKRVYA
                     QGTNREGLSNEDNYGNFQLNKSLEQLRARLVASSGEVVERSLSKLKERLDYVKDNLIK
                     NVLECADVTVPSKCLSKTKHIEQKKQIVFSDCVRSVPVCEIKPFIDMRVFETETTQNA
                     RRVRQRTRTTVGSTDGAIGQQRVISGQNRGRARGRGRGRVPRRRNSNLNNLRTQNSAI
                     VIDDSSETENFENAGSFNEDLLATTILETL"
     gene            complement(123109..123917)
                     /gene="U81"
     regulatory      complement(123109..123114)
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U81; U82"
     CDS             complement(123150..123917)
                     /gene="U81"
                     /note="Uracyl-DNA glycosylase"
                     /codon_start=1
                     /product="U81"
                     /protein_id="AAB06365.1"
                     /translation="MALLQWMLDHVQDEEKNYENLSIDDQHSLFGINRDWLSFLQLSK
                     LEITHLKHVYKLVDNDRVHLTVHPSSDNVHAWSFLCKPTDVKVVILGQDPYPDGRGCG
                     LAFGTVKECSIPESLKNIFKELERSIPNFSPPDNGCLNSWCREGVLLLNSIFTVVHGL
                     PMSHEAFGWQTLSYKIISRLSEQMNSLVFLLWGKHARKLSYLIDAQKHLVLESAHPSP
                     KVKSARMPFIGCNHFVRTNLFLTEHGKDPINWNILNE"
     regulatory      123202..123207
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U79"
     gene            complement(123207..124745)
                     /gene="U82"
     CDS             complement(123993..124745)
                     /gene="U82"
                     /note="Glycoprotein L"
                     /codon_start=1
                     /product="U82"
                     /protein_id="AAB06366.1"
                     /translation="MELLLFVMSLILLTFSKAMPLFDHNSFYFEKLDDCIAAVINCTR
                     SEVPLLLEPIYQPPVYNEDVMSILLKPPTKKKPFSRIMVTNEFLSDFLLLQDNPEQLR
                     TLFALIGDPESRDNWLNFFNGFQTCSPSVGITTCISDNCRKYLPERITYVNNFFVDNI
                     AGLEFNISENTDSFYSNIGFLLYLENPATGITKIIRFPFNSLTLFDTILNCLKYFHLK
                     TGVEFDLLKQMEAYNSKLPFRSSRPTILIRNT"
     gene            124821..125302
                     /gene="U83"
     CDS             124821..125162
                     /gene="U83"
                     /note="Intercrine cytokine"
                     /codon_start=1
                     /product="U83"
                     /protein_id="AAB06367.1"
                     /translation="MFIWLFIVFFYAAYIGMAIGFIGSSPDAELSSENSRISSSVLLG
                     CLLCCTDWSAVVPGKTETFRKPFVAIMIKKLKSCFAAYLSDLEQGSMCDMANASPTSL
                     ELGLSKLDKES"
     gene            complement(125259..127202)
                     /gene="U85"
     gene            complement(125259..126296)
                     /gene="U84"
     regulatory      complement(125259..125264)
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U84; U85"
     CDS             complement(125268..126296)
                     /gene="U84"
                     /codon_start=1
                     /product="U84"
                     /protein_id="AAD49672.1"
                     /translation="MKDRGNKNTSKTRPTVKSRRTRKTTKPSTERKKNVTTKTTIRNN
                     RLQNNLSSQTVQTDKPVDSATARAFPQHTSPDIKFNKEKYRNNAIYAHSKLRKISNAV
                     FHQDKEINRFSAFTDKPLADLSFNMPVKTSTTQKKEIVKSTECQRQDPNAVNAFKIFQ
                     SYETSPPYSPCSPKNFMSEIYRLFRCYNASIVQIQVYSRNKILINAMQEKLMSIGNMV
                     INVGEQIISESVHHEPVVAIAINQFFRGTVPHTDALRKNAVAPIPVNASKKKLVGICS
                     LMINAPTEKDLLCAAHVCINFAICHPNEITLNIAKLTQPMLLREHITIYNSFNKYIYW
                     DDYGKLLN"
     regulatory      125297..125302
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="U83"
     CDS             complement(126324..127202)
                     /gene="U85"
                     /note="glycoprotein; OX-2 homolog"
                     /codon_start=1
                     /product="U85"
                     /protein_id="AAD49673.1"
                     /translation="MSPLMLRLLPLLCIIISAHFVPRPETSPSLVYEIGSTVTFHCRL
                     NTTTNIQSVSWYNKSRLISNHEIQNMDNLSFTDDGYVFIHELNKINNLDVDSKLYFHI
                     KHDRTTSLLKIKARSAYDATCLTCTFTVDNEKTSATSCLKLIMKPIVVLYFRYLNNFL
                     DVTCTVTSYPKPNVVIKFLGEVYKRDIPMVRQNENGSSTVSVSFTFKRRTKLEFVGKT
                     ISCLASSWFTNQKASALVTSGEHTVQNHDEYSKEAVKGSNSDETVFTWIVPLILILII
                     SVMVLLISMCIVAFKS"
     gene            complement(127307..131901)
                     /gene="U86"
                     /note="IE-A"
     regulatory      complement(127307..127312)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="U86"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     regulatory      complement(127315..127320)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="U86"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             complement(127339..131901)
                     /gene="U86"
                     /note="IE-A"
                     /codon_start=1
                     /product="U86"
                     /protein_id="AAD49674.1"
                     /translation="MKLSGLYHDADVTHRQPLSENTHQDPISSQDSRKNSRTPQDPRR
                     AAQIHRQCTSSASNLPSNGNNSIHMRFASELPDQVLQPMYASQNQTTNSQCNFTSLPY
                     QPNYDAYRSIESSYRESRNTDRGYDSNFRHHSHRPRGGKGRYDSRNYFNPNSKYQQPY
                     GRFFPRSYNRRGRGHRLHDFSNRPADLSYQQYMHPNYEQYNPDLRMNNYKDVTQLTTN
                     FNFQAQDYSMAFSQTSITTDPTYVQSDNHNYPTKTQTTPETTKTKEHENAKDNKEHKK
                     QQVSTSPDAISLSYRPSSQKMDLIKKIYDTEVIPLPKEALIDNGSYCGVDTQKYKKTH
                     IRCRSIQKTKGHSSQTINKHKVQKHNENHVPSRSDLKQRKSNQHEDEAVTEARDFSKL
                     DPLLSPLPMTPEPTLNFAVHKTKIHSDSELHHTKKNIHRSKTSLQDRVLISKHAPRAP
                     TKDNSYKKHHDPKDTNDPKMKHSRGRTTSKKNTANSNGHQDVREVAVKNVSGKAAKNT
                     SKKSDPSHNLHGKTSDEQYKTSPDNEKISTPPKSKTHHCIHDSSSSEEGQYKSPNNSE
                     SNYGNCLSDKFYDNFTKTTPNSKTNHKTEESTENTDLNSFSNENTNKTEIEDSNIIQP
                     FSQLFCNETIIPSTSACPTQETPSTMNRNCASKKHSAGANKNLTDNSPIRSHSNPSSF
                     TAFNKSNSGNSTMNSTSNGDECTDKKPNCSSTENKSETSNQTNGENSDKPLSKTFTEV
                     SDRASSRASSRASSRASSRASSRASSRASSRASSRTSSRASSRAFSRASSRVSSRASS
                     RASSRASSRASSRASSRASGRASGRASSRASSRVSSRASSRASSRASSRASSRASSRA
                     SSRVSSKASSRASSRASSRASSRASSRASSRASSRASSRASSRASSRASSRASSRASS
                     RASSRASSRASSRASSRASSRASGRASSKASSRASSRASGKTPNNKLMSNIPSPQTYE
                     KTSNKRKPRQIYCDSNKRQIYPHDTSISTEAEVSEIKFRCGPELNFYKNAAARLQSFN
                     HNDQFYNPRFRPHIRTNRKKSESTNYTDSESSTSRSRSHSRYSPDSLNTPKRKKHKSG
                     SSSISSSIEENSRSNSRTETGTDKLITFNYQHSRTRSSSSSSVSSSCSSSRSKSWRKS
                     RYKNSEDPATYSPRSRLQQLEKQTRPKSASRDKTKIKSPNHESKHRHADMFRNSQKTG
                     EKFPLDNSSPSNTHEQSNHLENAIDQEQKKTPKTTNTTTNTIYRPRDNQSNISRNTTK
                     CKKKRTRDDDSDSSMQNFFKKRISGTQKTDSEISEIEEELSYREYVRRKEKKESAKYK
                     IHRGRVSTKDFRKLFRNTIRAFEYKQIPKKPFPENKLKEAVYNICSNGCSNTGAIIMY
                     FTRSKQVAEIIKTMQRELMIRPNITVSEPFKMNHAPPNYYDKDAINQFIELQKQGPQE
                     LWDKLENNTHDLFTRHSDVKTLMVYAATPIDFVMASKICNKYAKDKPKEIVLRVCSII
                     DGDNSISIYNSVSRDFKSKYLTLSKC"
     repeat_region   129046..129681
                     /note="R1"
                     /rpt_type=tandem
                     /rpt_unit_seq="rgcyctgctgga"
     repeat_region   133501..133863
                     /note="R2A"
                     /rpt_type=tandem
                     /rpt_unit_seq="attatatgata(n)6-
                     7gttt(n)3gtagactagtt(n)3ttatgttt"
     repeat_region   133982..134076
                     /note="R2B"
                     /rpt_type=tandem
                     /rpt_unit_seq="tttgtgtgtgtg"
     gene            complement(134769..138436)
                     /gene="U90"
                     /note="IE-A transactivator"
     regulatory      complement(134769..134774)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="U90"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             complement(join(135003..137932,138043..138254,
                     138342..138436))
                     /gene="U90"
                     /note="IE-1; IE-A, transactivator"
                     /codon_start=1
                     /product="U90"
                     /protein_id="AAD49675.1"
                     /translation="MESAKDTTSTSMFILGKPSGNNMESNEERMQNYHPDPVVEESIK
                     EILEESLKCDVSFESLLFPELEAFDLFIPESSNDIASKNVSYSSNVEEGASDEFKTLV
                     AQSVGNCIQSIGASVKAAMKQEQSNMEDNLINSAGLLTLHRSMLERLVLEQLGQLINI
                     NLLSSASSQFVSCYAKMLSGKNLDFFNWCEPRFIVFACDKFDGLVKKIASESRDLLMD
                     LKANMNNQFITALKNIFSKAYVALDSGKLNMVATSLLLMAHNKEMSNPEISNKEFCKQ
                     VNLLKQELLESRNEIIENHVKNMKMFQEFANKQMNQIFMDNCDKTFLKIHINCKNLIT
                     AAKNIGIAVLQSIVLCSNEFSWQYLKPRRHQFKITMMNMITHACECIETIYDDTGLIK
                     PLTSSDIMEGYIAINKNRESSICDLNIDPSESILLELADFDEHGKYSEESSIESIHED
                     DDNVDYLKYMEVQSPTDNNIPTPSKNNESPTRQKLTNIHEKDVGKMYPDTPSPDVPGK
                     SKEAKTFIEYSRQIGKEQTSPNCVCTASVTDLGGPDNFKSITGLESGKHFLIKKLLET
                     QPDSVVVETGSGQQDILAYSPDKRSQTKEWIQEKGSNSKCTETLPGMTFTNSATPVKS
                     HGAIQDTLNPESKLDKEMEAVESLVNLCDGFHDNPLISEMITFGYETDHSAPYESESD
                     NNDETDYIADCDSTVRTNNIHMNNTNENTPFSKSLYSPPEVTPSKEDHKTEKIVAVSQ
                     KCKSKKRTAKRKNVPIKPSKSKKIKLDRLPETTNVIVISSESEDEEDGNNIIDKSMLE
                     KTIKSEPNSESSSESDDCTSEDNYLHLSDYDKVINNGHCQSKGFPSPVFTIPIRSMPG
                     THDIRNKFVPKKHWLWFMRKTHKVDNCVIHSSAKMNVKNDSDVTEANHCFINHFVPIK
                     TDDEEYEKENVSYTYSKIQDSKTDLEDITPTKKLITEMVMENFMDLTDIIKHGIAKHC
                     QDLSSKYTVITHTACEKNLNVANSQNLVTAETQIFDPQGTGNNSPILNIINDTTCQND
                     ENRCTEGTSNDNEKCTIRSDCNSDKMEVFKLDGYPSDYDPFEENAQIY"
     gene            138591..140054
                     /gene="U91"
     CDS             join(138591..138816,138926..139170)
                     /gene="U91"
                     /note="IE-A"
                     /codon_start=1
                     /product="U91"
                     /protein_id="AAD49676.1"
                     /translation="MMGYEEKVSATGKTRLKILACLIVLILAAAITMLTLEIISNQKR
                     TTTDLEAVTVALKHVSTSLANCTESTTSVHTANPRKNKESRKKIEGKSPSWVQALTTA
                     SGIILLFCIMMIFITCSWTTEKDTEKSEVQSYASSVETLDSLNEAIIPKTEMNV"
     regulatory      139943..139948
                     /regulatory_class="polyA_signal_sequence"
                     /gene="U91"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     regulatory      140049..140054
                     /regulatory_class="polyA_signal_sequence"
                     /gene="U91"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     repeat_region   140082..142691
                     /note="R3"
                     /rpt_type=tandem
     gene            complement(141969..142766)
                     /gene="B8"
     CDS             complement(141969..142766)
                     /gene="B8"
                     /codon_start=1
                     /product="B8"
                     /protein_id="AAD49677.1"
                     /translation="MIYKKVHDEQKSLFFHKFKCQWVPRLGSFLPKRVRTLKIANGAT
                     AASVFHQKVKGQWVPRLGSFLPKRVRTLKIANGATAVSVFPHKVKGQWVPRLGSFLPK
                     RVRTLKIANWATAVSVSLHTVKGQWVPRLGSFLLKWVRTLKFANGATAVSVFSDKAKD
                     QWVPRLKFFLPIRMRTLKAVNKATAFPVFPHKLKGQWELRLKSFLIMRMRTLKSANKA
                     TTVPVFLHKVKDQWVPRLKYFLPIRMRTLKDANKATAVPVFPHKLKG"
     gene            complement(142886..144565)
                     /gene="U94"
     regulatory      complement(142886..142891)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="U94"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="does not follow consensus"
     regulatory      complement(143036..143041)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="U94"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             complement(143093..144565)
                     /gene="U94"
                     /note="Parvovirus rep homolog"
                     /codon_start=1
                     /product="U94"
                     /protein_id="AAD49678.1"
                     /translation="MFSIINPSDDFWTKDKYIMLTIKGPVEWEAEIPGISTDFFCKFS
                     NVPVPHFRDMHSPGAPDIKWITACTKMIDVILNYWNNKTAVPTPAKWYAQAENKAGRP
                     SLTLLIALDGIPTATIGKHTTEIRGVLIKDFFDGNAPKIDDWCTYAKTKKNGGGTQVF
                     SLSYIPFALLQIIRPQFQWAWTNINELGDVCDEIHRKHIISHFNKKPNVKLMLFPKDG
                     TNRISLKSKFLGTIEWLSDLGIVTEDAWIRRDVRSYMQLLTLTHGDVLIHRALSISKK
                     RIRATRKAIDFIAHIDTDFEIYENPVYQLFCLQSFDPILAGTILYQWLSHRRGKKNTV
                     SFIGPPGCGKSMLTGAILENIPLHGILHGSLNTKNLRAYGQVLVLWWKDISINFENFN
                     IIKSLLGGQKIIFPINENDHVQIGPCPIIATSCVDIRSMVHSNIHKINLSQRVYNFTF
                     DKVIPRNFPVIQKDDINQFLFWARNRSINCFIDYTVPKIL"
     gene            144640..148617
                     /gene="U95"
                     /note="US22 gene family"
     CDS             144640..148278
                     /gene="U95"
                     /codon_start=1
                     /product="U95"
                     /protein_id="AAD49679.1"
                     /translation="MSSNLEDLLWQQILSMDPAELLSDNAISSTCDENIAAGHHFTQS
                     PHVEMSVQSTTSAGHTGVMTTQSQFSNGVRDQNRESLSTLTGLSLESINNQINVQPTQ
                     MTFQPISPPMQGQNYVYSNNMINPIKPRSIIKSHGHSMGEMSFADHSLYVNAQPPVQQ
                     PQLKSLVGMHPCMTATSQGKYQTNKTVGPPSISASQITTGNAGIRPGEYQSVHNQSSV
                     NGSKSYEITTASGDEWILTTPGGQSWTLKRNPPNPPNNRTNSVVNKAQQVSHAQPYVS
                     GSSDGFYQGAALQSCAYVNTPGFTPVCETQNMNNSQATQLSASMNCINALQTTMDAIV
                     TSTSKPVGAVSNNRGANFGMGGMENYMDNNSPWNQYCKVQDIVSQNCSQGKVVSSTPG
                     IAPNLMKGNGLNVYGHVGCVDAAISDKQGGTANVASSLLNPEHQDWMRVTGTSTNLLN
                     NINAETKMENYGFPENGNVHGAVNTALPLTLSSGQPYTSVPQHGACEGNGTIPVVQIC
                     SPNTAFKAHYSLLGTVDENNPLSVRESIQDTSFSNGCAPQLSSPGGNPTIIAHSMIGN
                     NGTPNKDVCKPTPSLRAIKKLNFDYDDRGENIGFPSKLAALLSMGENMSKMDNPCYGT
                     SLAQFEESHQQNASEGKISIADLEFSEEDDVLSSAASVSCNDNCVMKIGASQQGTTVA
                     DLQQGFKQQMNGEFSMFAVDGNIKTQEMSNDCASNVTDNACAIRQNKRMHCEIGISED
                     GRVREEEKCSDVAIHVPRKSARIHNMKSEGVTCGMCVTAADSTRQDASGGSSSGTKKG
                     EKLQGLWKGYQDDDDSELTELSDTDSDNDVQNCHGVRKTGSKTYSSVFFNPDYRQAKR
                     LLADIPYRRWIPDTFNMEEHEGPFLPIVTRPPTVFMGGRRRRTYLRRSVTSIGPLSKL
                     TYFKELLQSYVLRNSNCYLSIGWPAKHRVYIMSEEKLGYNHIPTLREMFPLPPGWMIV
                     LGIVGSETPAALYKHMVVLLCENKWVLLHNYRDSKHELYFAASDLKQFMEEGLSRCDC
                     IYYEKSVPYGVAMEDSVREFLRNSKTFQSLMEYRKNMHGSTWTFNGMPGRLGDRVIHI
                     CNPELVNSIPADEAIRYEGKPLYFFAFVTTFKSHPGSKANVLIAADKNLGIYGYHKGR
                     PRIRYLCKNVQAFFRAGVRKMYLDYEIPSKTLLAVSEDDYLCILQKAPCLLLKPAVFR
                     KTFSQEGK"
     regulatory      148612..148617
                     /regulatory_class="polyA_signal_sequence"
                     /gene="U95"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     gene            complement(148659..152325)
                     /gene="U100"
     regulatory      complement(148659..148664)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="U100"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             complement(join(148665..148911,149041..149169,
                     149332..149341,149848..150008,150159..150272,
                     150369..150476,150587..150664,150786..151121,
                     151526..151807,151940..152325))
                     /gene="U100"
                     /note="gp82-105 complex; spliced envelope glycoprotein"
                     /codon_start=1
                     /product="U100"
                     /protein_id="AAD49680.1"
                     /translation="MRPPRRSAPILVCAISMATALSNATVHRDAGTVESTPPPDDEDN
                     YTAKYYDDSIYFNIYDGTNPTPRRRTLPEIISKFSTSEMSRLGGLKAFVPVDYTPTTT
                     LEDIEDLLNYAICDDNSCGCLIETEARIMFGDIIICVPLSAESRGVRNLKSRIMPMGL
                     SQILSSGLGLHFSLLYGAFGSNYNSLAYMERLKPLTAMTAIAFCPMTSKLELRQNYRL
                     EKARCELIVNIELLKIQNHGGQTIKTLTSFAIVRKDSDGQDWETCTRFASVSIEDILR
                     SKPAANGTCCPPRDVHHDRPTLQSSNSWTRTEYFEPWQDVVDAYVPINDNHCPNDSYV
                     VFQTLQGHEWCSRLNKNDTKNYLSSVLAFKNALYETEELMETIGMRLASQILSLVGQR
                     GTSIRNIDPAIVSALWHSLPEKLTTTNIKYDIASPTHMSPALCTIFIQTGTSKQRFRN
                     AGLLMVNNIFTVQARYSKQNMFEKKIYGYEHLGQALCEDGEILFQNAGQKFCRPFTDN
                     RTIVYTMQDQVQRPWSVTWMDFNLVISDYGRAVIENLTESAMSAHKNGPRYLQMETFI
                     SDLFRYECHRDNRYVLEKKLQMFYPTTHMNELLFYPSDPTLPSPYGNGHY"
     gene            complement(152925..153252)
                     /gene="B9"
     regulatory      complement(152925..152930)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="B9"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             complement(152932..153252)
                     /gene="B9"
                     /codon_start=1
                     /product="B9"
                     /protein_id="AAD49681.1"
                     /translation="MQRSSACMGISVPTRAQTDLPKQRSSACMGISVPARAQSDLPKQ
                     KSSACMGISVPARAQSDLPKQRKQRLYGNKCPGPSAAQLPGADRQRLYEKKWPGRSAV
                     QPAG"
     repeat_region   153322..162114
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /rpt_type=direct
     repeat_region   153380..153674
                     /note="heterogeneous telomeric unit"
                     /rpt_type=tandem
                     /rpt_unit_seq="tarsyc"
     gene            153904..157309
                     /gene="DR1"
                     /note="US22 gene family"
     CDS             join(153904..154162,154276..156296)
                     /gene="DR1"
                     /codon_start=1
                     /product="DR1"
                     /protein_id="AAD49682.1"
                     /translation="MPLTARAGHTLHRLPLSHYWWLLLGRHSLRHVHSYLRLRKGLRL
                     PLPWPEQECLHLHPKPYKFLLRYPCLTRQPHLLQGWPADSSLWFDPKPYHPSADSKLL
                     PLGLITLSAFSMRVSEPTHCSGFHAADPSLSWLTGSSPWLVLLQAPGGSLFCHDVFQG
                     RLYLLSHSVSLFLKTGLRQCEAIYRAPLWRVRPLPSLWTCRDPDTAFLPKLLARTARR
                     GLAAFYALWRLHLGSRSELSHPVLEWERTELVLTDRRRGWPCTHLLSGSESQRVSSSD
                     AGDTWNAATEKAAGGKEEAERGGRQQATDRLASPHLTRGRRDCGRSLQGEEPSAAEDF
                     ARCRPLLDELCGEGGWLPFAFLTASPHVCLILTEGGPVLALDLNDTSLWRIADDLELL
                     LRLGSLLLLSGLRLPLRPPSGSGEAARKPGYEKEEGRGRATTASATAATSPRRPTRPR
                     GVTEKGRVTTGDVPFSAHPESEEQTDGHHGRQESGHGDQRGGDGRGHRDDGARRHAND
                     ETEPQQRGEHEDGEQTDSGREEDAQESEVARRDEKGTEQGGSGRSCGRATQTYGGRGE
                     HGAWSSIPLSVPRPDPRVWVPPPHLLFPSPLPSITPVEDEPSARPRCPPGPAEEPSKC
                     SPCPPCPSPDAPQSAVPRLSALSVPSPSTARVRFSLSSLSSSSSSSSSSSPSYSPSPL
                     SPPSPVSPSSPRSPFISPIRSPGLRAKPWVSSGHPVAFPPAPSSAPPFSKRVPSVPSS
                     ASPSAPCIGRSRPPSAQTA"
     gene            complement(156044..156646)
                     /gene="DR3"
     CDS             complement(156044..156646)
                     /gene="DR3"
                     /codon_start=1
                     /product="DR3"
                     /protein_id="AAD49683.1"
                     /translation="MSRVFSCVLRACVCAGLCCWVCMGVICGDCQRWWRRRCARWGRV
                     GPRVLDGGAWRVRSGDGARSVSRTCETERAPSAARSPVYSPPFVLVSSSSSSSCSSAC
                     SSRVPSPPPSPHAASHAVCAEGGRDLPMHGADGDADEGTDGTLLEKGGADEGAGGNAT
                     GCPEDTHGFARSPGDLMGEMNGDLGDEGETGEGGDNGEGE"
     gene            156343..157309
                     /gene="B1"
     CDS             156343..156822
                     /gene="B1"
                     /codon_start=1
                     /product="B1"
                     /protein_id="AAD49684.1"
                     /translation="MQKNMKTKKTKKRGRKEGNTPETERRMEPARSRTSAIPSGLRRR
                     SGPSTPLRPGPEVRHAPTWRTASATTADSHRISPPYTPSSRGRHIHTRGARTRTRETS
                     AAEINGVYARAVTRKTKRSETIDRLLLSVLPGHGPHASLRSHLRARSALRPPPDPPR"
     gene            156857..157309
                     /gene="B2"
     CDS             156857..157096
                     /gene="B2"
                     /codon_start=1
                     /product="B2"
                     /protein_id="AAD49685.1"
                     /translation="MQPMTKKKHTTASKRSPARPPSLSPPLESRRRVGGKSPERLHGN
                     APPTPPRSPLPPSPSPEHTRRLSPQRRRPQRQRKL"
     regulatory      157233..157238
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="DR1; B1; B2"
     regulatory      157259..157264
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="DR1; B1; B2"
     regulatory      157289..157294
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="DR1; B1; B2"
     regulatory      157304..157309
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="DR1; B1; B2"
     gene            158348..160756
                     /gene="DR6"
                     /note="US22 gene family"
     CDS             join(158348..158651,159650..160524)
                     /gene="DR6"
                     /codon_start=1
                     /product="DR6"
                     /protein_id="AAD49686.1"
                     /translation="MTTRHTQTRDGRIAIRRDGARLAHARARARFEWLLLARGRPSKL
                     YGYTSRHRGERIHLPWPRYWCLELHPDPYRDARSATVWGHRWGWPPTHVRPRSVQDCA
                     LDSSLYVCCGYGEKLQPVGFVSSYLTHSPLDTLRVLLVGRDGAVYVHHMRAARLCRLA
                     SNVTEFARRGLQRDPVAYEEDLELPDRRMCGTNVRHLFDVIAAAADEHDLLTVGGLCQ
                     THAGVSCELLETVRDPWTAVPGVRMTLTVARAQYRLWPDARRQLRLHLYAGHPLGPWI
                     VCAVLSRERETQTPSPPIGSGGVILGNVPTPGPREVETAWVIVTVAGPLLSFWPDNGK
                     ICRLANSFAALWRMGPRAMRGHWTYSAPGRHLPGDAWPLCEHVRPPVGKLPRQRAYLD
                     "
     gene            160670..160849
                     /gene="B3"
     CDS             160670..160849
                     /gene="B3"
                     /codon_start=1
                     /product="B3"
                     /protein_id="AAD49687.1"
                     /translation="MSIRLRVCVGCVYVRVTVSLPAFNPMRNKIGECTQSHTMCLRAV
                     LLTPHNKKKKHTSCP"
     regulatory      160751..160756
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="DR6"
     repeat_region   161571..162032
                     /rpt_type=tandem
                     /rpt_unit_seq="taaccc"
BASE COUNT        46455 a        35196 c        34142 g        46321 t
ORIGIN      
        1 tcctcgcgtt tcaaaaatta ctttaaactc cccggggggg ttaaaaaaag gggggtatta
       61 accctaaccc taaccctagg ccctaaccct aaccctaggt ctaaccctaa ccctaaccct
      121 aaccctaggt ctaaccctaa ccctaaccct aaccctaacc ctaaccctaa ccctaaccct
      181 aaccctaacc ctaaccctag gtctaaccct aaccctaacc ctaaccctag gtctaaccct
      241 aaccctaacc ctaaccctag gtctaaccct aaccctaacc ctaggtctaa ccctaaccct
      301 aaccctaacc ctaaccctaa ccctaaccct aaccctaacc ctaaccctaa ccctaactct
      361 agccttagcc ctagccctag ccctagccct aacactcatc ctcgcatctg gccctaccgc
      421 tacccctctt tcaacccctc accatcaccc aacccgctgc cccacccaca tcccccccac
      481 cgccaccgct accgtcacct ctgaacttca cctttttcct ccatctcgcc ccacttctct
      541 ctacatttct ccgcccctct attcttactc ctgttttcta ggatgccgct gacggcgcgt
      601 gccggccaca ccctgcatcg tcttccgctc tcccactatt ggtggcttct gttgggtcga
      661 cactcccttc gtcatgtcca ttcctacctt cgcctgcgca aaggtctacg ccttccttta
      721 ccttggcccg aacaagaatg tctgcattta catcctaagc cttacaagtt tctcctgcgt
      781 tacccttgtc taacaagaca accgcatctt cttcagggct ggcccgcgga ttcttctcta
      841 tgtgagtgac atttacactt ccacttgttc acatgattta ttgtgttttg tctggtacac
      901 caagcacatt tcggtttctc ttttatacat ttatctctat tctctcggtc tcagggttcg
      961 accctaaacc ctaccatcct tcggccgaca gcaagttgct acctctgggc ctcatcacgc
     1021 tgtccgcctt ttccatgcgc gtttcggagc cgacacactg cagcggcttc cacgcggcag
     1081 atccgtctct cagttggtta acgggatcgt ccccttggct cgtgctccta caagcgccag
     1141 gagggtctct gttctgccac gacgtgttcc aaggccggct ctatctcctg tcgcactccg
     1201 tgtcgctctt tctaaagacg ggccttcgcc agtgtgaggc catctatcgc gcaccgctgt
     1261 ggcgcgtacg gcccctgccg agcctatgga cgtgtcgaga tcccgacacg gctttcttgc
     1321 cgaaattgct ggcgagaacc gcccgacgcg gcctggccgc tttctatgcc ctgtggagac
     1381 tgcatctggg atcccgctcg gagctctctc accccgtgtt ggagtgggag agaacagagc
     1441 tggtcctgac ggatcggaga cgcgggtggc cgtgtacgca cctcctgtcc ggctcggagt
     1501 cccagcgcgt ttcctcgagt gacgccggag acacatggaa cgcagcgaca gagaaggcgg
     1561 cggggggaaa agaggaggcg gagagaggcg ggcgacagca agccactgac agactcgcaa
     1621 gtccgcacct gacgcggggc cgccgcgact gcggtcggtc ccttcagggt gaggagccca
     1681 gcgccgcgga agactttgcg aggtgcagac cgctgctgga cgaactgtgc ggggagggcg
     1741 gctggcttcc ctttgcgttt ctcacggcat ctccgcacgt ctgtctgatc ctaacggagg
     1801 gaggccccgt cctggcgctt gacctgaacg acacctccct gtggcgcatc gcggacgact
     1861 tggagctgct gctgcgcctg gggagcctgc tcctgctctc agggctccgg cttcctctcc
     1921 gtcccccgag cgggagcggc gaggcggcga gaaagccggg gtacgagaag gaagagggaa
     1981 gagggagagc gacgacggcg agcgcgacgg ccgcgacgtc gccgcgcaga ccgacccgtc
     2041 cgaggggggt gacggagaag ggacgtgtga caaccgggga cgtccctttc tccgcacatc
     2101 ccgaatctga ggaacagaca gacggccacc acgggcgcca agaaagcggc cacggcgacc
     2161 agcgcggcgg ggacggacga ggacaccgcg atgacggcgc gcgccgccac gcgaatgacg
     2221 aaacagagcc ccagcagcgc ggagagcacg aggacgggga acagaccgac tccgggcgcg
     2281 aggaggacgc acaggagagc gaggtcgcaa gaagagacga gaagggaacg gagcagggcg
     2341 gtagcggaag gagctgcggg agggcaacgc agacgtacgg cgggagaggc gaacatggtg
     2401 cctggtcgtc gatccccctg tctgtcccca ggcccgatcc ccgcgtgtgg gtccctcctc
     2461 ctcatctgtt attcccttcc ccgctgccgt cgataacgcc cgtcgaagac gagccgtccg
     2521 cccgccctcg gtgcccgcca ggtcccgcgg aggaaccctc taagtgttct ccgtgcccgc
     2581 cctgcccgtc gcccgacgcc ccgcagtccg ctgtcccgcg cctctccgct ctgtccgtcc
     2641 cctcgccgtc caccgcgcgt gtccgtttct ccctctcctc cctctcctcc tcctcctcct
     2701 cctcttcctc ctcctccccg tcctactctc cctccccgtt gtctccgccc tctcccgtct
     2761 ctccctcgtc tcccagatct ccgttcatct cccccattag atctccggga ctccgagcaa
     2821 agccgtgggt gtcctccggg catcccgtgg cgttcccgcc ggcgccctcg tccgcgccgc
     2881 ccttttccaa aagagtcccg tccgttccct catcggcatc tccgtccgcg ccgtgcatcg
     2941 gcaggtcgcg gccgccctcc gcacagacgg cgtgagacgc cgcgtgaggt gacggaggcg
     3001 gcgaagggac acgagaagaa catgcagaag aacatgaaga cgaagaagac gaagaaacga
     3061 ggacgaaagg aggggaatac accggagacc gagcggcgga tggagcccgc tcggtctcgc
     3121 acgtccgcga taccgagcgg gctccgtcgc cgctccggac cctccacgcc cctccgtcca
     3181 ggacccgagg tccgacacgc ccccacctgg cgcaccgcct ccgccaccac cgctgacagt
     3241 caccgcatat cacccccata cacacccagc agcagaggcc ggcacataca cacgcgcgga
     3301 gcacgcacga gaacacgcga gacatcggcc gccgagatta acggagtcta tgcgcgcgcc
     3361 gtgacacgga aaaccaagcg gagcgagacg atcgaccgac tcctgctatc cgtcctccct
     3421 gggcacggtc cacacgccag tctgcggagt cacctgaggg ccagatccgc tctgcgcccc
     3481 ccgcccgatc cgccccgata aaaaaaaatc atctgactcg tgccagttca cacagatgca
     3541 accgatgaca aaaaaaaaac acaccaccgc aagcaaacgc tcgccggccc gtccaccgtc
     3601 cctctcaccc ccactcgaat cgcgcaggcg cgtcggcggg aagtcccccg aacgcctcca
     3661 cggcaacgct cctcccacgc cccctcggtc ccccctccct ccatccccct ccccggagca
     3721 tacgcgccga ctctctccgc agaggcggcg accacagcgg cagcggaaac tgtaacggcc
     3781 acgttctttg aacagtgaca gtaacggcgg cggcggctgt cgccgtcacg gtagtcgtgg
     3841 cggagcaccc ggggaggcga cgacggggac taccgatgct ctcagatcat cgccatagtg
     3901 aaagagtacc gaataaaaca agttaaattt cgttgtaaat aaaaaaaaat actatgtgga
     3961 aattaaaaat aaaaaaaatg aaaataaagg ctaaacactg actaaacgta catccttctc
     4021 cgtacgtccc ctttcaataa atggcggacc cgacctctcc ataaacggag acacgccggg
     4081 agactccggc cctcccgttc cagaggtagc ccgagaccta atcacaaaac tgtacctgaa
     4141 accgaaagta tagagggcgg cctcgaatgc cccacctatg aggcgggact tcgcgacgcg
     4201 ccacccttcc tatacgcccg gccttccgcg tgcgcgccta taggacgcat cccctcgccc
     4261 cgaaaccgca acgcggcaga gtcggcgcca cacccccgtc ccccgagttc gcgatgggct
     4321 ggcgccgacc ctgccgcggc aacgaaggcg aaacgagacc ccgacgcatg cgggcataaa
     4381 gagcgagaag taaacgcggg gtcccgaatt atcgcgagac tatttgcccg ggcccgccct
     4441 cgtcctcatg cccttccccc cgccctcatc ccctgacaca cccggtggaa aaaacgaaag
     4501 acacataaat aaaacgaatt ttgttgttaa aaatgtttcc acgtgacgtc cccggtgatt
     4561 cccggagatg cggcacgcgg cggattcgcc cgtttacatc ggggtccgca gacgcggttc
     4621 tgccagggcg ttgcgctgtc ggttccgcac aaaacaccgc ggtccgtcgt cacccttcag
     4681 ccacgcggta gttccgcgat tctatggttc atctccgctc acatcgttct ttttttttta
     4741 ttctttcact gagccgctcc accaccaaga gtgttactat ctacaccgta tacatgtttt
     4801 ttttttatct ctccgcccct ccccatcaca gaccatcaaa caccttttgc cgtatcgaca
     4861 ctgactatac tcgaccgcgg atgacaacgg tcgttggtca caacagagct acagcggaca
     4921 gcaaaaataa cataaataca gtaagagaga ggccccggtc cacataggaa gccaagggcg
     4981 gacgaaaata aaaacccgtc cgtaattcac acacgaatcg ggggttatga caacgcgaca
     5041 cacgcagacg agggacggac gcatcgcgat ccggcgcgac ggggcgcgat tggcccacgc
     5101 gcgagcccgt gcccgcttcg agtggctgct cctggctcgc ggcaggccgt ccaaactgta
     5161 cggctatacg agtcggcacc ggggagaacg gatccaccta ccgtggccgc ggtactggtg
     5221 cctagaactc catccggatc cgtacaggga cgccaggagc gccaccgtgt ggggtcaccg
     5281 ctggggttgg ccgccaacgc acgtgagacc cagatccgtt caagactgcg gtgagtgagc
     5341 gccgccgcga ccggcgacgc tatgcgcaca cgggcgagcg gcggggaggg acgtcggccg
     5401 cagggcgagc cggtggaggg cgagccggtg gagggcgagc gggtggaggg tgagcgggtg
     5461 gagggtgagc gggtggaggg ttcgtcgaaa accaccgaag acattggctg gcggagagtg
     5521 gggacaaaac aacgtcacgt caggggcgga gaaatatagg gtgcgcagac cgtcaaagcg
     5581 cgagtaacgg aaaacgagtg cggatacggg ggggggggga aggaaacatg gtgaagtctg
     5641 tgacacgcgt gaccgtcagc cggaaacgcc tgccacggcc tctggcctca cagacgactc
     5701 acggagtttc cttcagacat tgtttttttt tttgtattca tcggtaatgc ggtatacgta
     5761 aattccccgc aaaggtactt tccgttaagg acggtacagg cggtatgact tccggaacac
     5821 gatgattacg gatatcctgc atagtgtaca ggagaccgct ttttttttag gttccgtata
     5881 agacgtacgt cggcgacgta cacacaacag ttaaaaaaat aaaaaaaaga ggaaacagta
     5941 aagctcctcc tttcctctat gttatcgcgt tcagttagta ggcgccattg ctgttgcgta
     6001 tgcttttcgc gttaacggta cgcgacagga tacgaatgcg ttacacgccg caaaggctcc
     6061 ctacaatgac tctatgcggc atctcccgtt cgcgcagaaa cgcgagttcc cgggacgcca
     6121 gtcttgacgt ccggccgatg ggatgccttt gcgtgtgcgg atgttttctg ctgttttata
     6181 ggaacagaga caagagacga aaatagcgga acgcccacta taacgtgcat ttttctctgt
     6241 gttttgtgtt ttcatgtttt atgattcttc tacggtatcg gccggaacgg tcatcctcga
     6301 tccttctcgt acgcgtgtcc cgccccagcc ctggactcga gtctgtacgt atgttgcgga
     6361 tacggagaaa aacttcaacc cgtgggcttc gtaagctcgt atctgaccca ctccccgctc
     6421 gacacgcttc gcgtgctcct ggtcggtaga gacggagccg tgtacgtcca ccacatgagg
     6481 gcggccagac tctgccgtct ggcgtcgaac gtaacggagt ttgcaaggcg agggctgcag
     6541 cgggaccccg tggcgtatga ggaagaccta gagctgccgg accggcgtat gtgcggaacg
     6601 aacgtcagac atctgttcga cgtgatcgcc gcggccgccg acgaacacga cctgctgacc
     6661 gtcggcggcc tgtgtcagac gcacgccgga gtgagctgtg aattactaga gaccgtgcga
     6721 gatccgtgga cggcggttcc gggcgtacgc atgactctga ccgtggcgcg ggctcagtat
     6781 cgcttgtggc ccgatgcccg gagacagctc cgcctgcacc tgtacgcggg acaccccctg
     6841 ggaccgtgga tagtgtgcgc cgttctgtct cgagagaggg agacgcagac gccgtcgcct
     6901 ccgataggca gcggaggcgt gattctggga aacgtgccca cgccggggcc acgcgaggtg
     6961 gagacggctt gggtgatcgt caccgtggcg ggaccgttgt tatcgttctg gcccgataac
     7021 ggcaagatct gccgtctggc gaactcgttc gccgccctgt ggaggatggg gccgcgggcc
     7081 atgagaggac attggacgta ttcggccccg ggtagacatc tccccgggga cgcttggcca
     7141 ctctgtgaac acgtgagacc gccagtcgga aaacttcccc ggcaaagagc gtacctggat
     7201 tagacgccac ggcggcgacg taaggatgcg acctacggcc agagacatga ccgtaggaag
     7261 atcatgacaa ggatctcgaa atataaaacc aaaaaaaaag tgaggagtgc gtaatcgcaa
     7321 gaaaagaaaa aacagagccg cggtggaaat gtctatccgc ctgcgtgtat gtgtggggtg
     7381 tgtatatgtg cgcgtgaccg tatccctccc tgcctttaac ccgatgagaa ataaaatcgg
     7441 cgaatgtaca cagtcacaca caatgtgctt acgtgccgtg ttactgacac cacataacaa
     7501 aaaaaaaaaa catacttcct gtccgtgaga caccgccgcc ctctagcggg gttgctatag
     7561 cagcgcccga tgccaacgcg acacggtgag tcgcatagat cgggactgct tgaaagcgcg
     7621 ccacattcgt cttttatata gacaccccgg ggagtgggag gagccaacat acacacgagg
     7681 tcggtctgag gttggagacg aacgcggaaa atcaacggcg taaaaaaaat aagaaaggcg
     7741 gagacacata gccttggcgg gaagacgata acaggttcaa agatagacag tgaaaaaaaa
     7801 aagaggagac catgccattg aatacacgtg tggcagcaat ccaatcaacg tgacgtgccg
     7861 gcgcgcaaaa aaaaaagtat acggaagtgc atgcgacaga cagtcacgcg gaccgacgac
     7921 aaaggccgac ccctagcatg gcagctagga aaaaaaataa acaacgctga aatatactaa
     7981 caaaggaaac atcccttcat ccctccctac cccatctacc acaacacccc cctccgtaat
     8041 cccttttctc cgcgtttctc ccacagacgc gtgcacacgc agacacgcag acacgcacac
     8101 accacctcta tggcagtcgc gggtgggcag gcggggagca tacggggggc agatgtgaag
     8161 acaatgagga acggcatcgg gcgcgacgtg ccgccgtctc ggacccatgc tatcctggca
     8221 cgacgccaag ggaaaccgct ggcgcaatct aaccctaacc ctaaccctaa ccctaaccct
     8281 aaccctaacc ctaaccctaa ccctaaccct aaccctaacc ctaaccctaa ccctaaccct
     8341 aaccctaacc ctaaccctaa ccctaaccct aaccctaacc ctaaccctaa ccctaaccct
     8401 aaccctaacc ctaaccctaa ccctaaccct aaccctaacc ctaaccctaa ccctaaccct
     8461 aaccctaacc ctaaccctaa ccctaaccct aaccctaacc ctaaccctaa ccctaaccct
     8521 aaccctaacc ctaaccctaa ccctaaccct aaccctaacc ctaaccctaa ccctaaccct
     8581 aaccctaacc ctaaccctaa ccctaaccct aaccctaacc ctaaccctaa ccctaaccct
     8641 aaccctaacc ctaaccctaa ccctaaccct aaccctaacc ctaaccctaa ccctaaccct
     8701 aaccctaacc catcccccaa cgcgcgcgcg cgcgcctcta tgggaggcgc cgtgtttttc
     8761 accaaaaacg cgcgccactg caagaggggg gtgaaaaaac ctcccctccc cgaccggccc
     8821 gagtggtccg cgcgtgtcgc cggtgcgccc cgcgcccggg cccccccccc ccgggaacgg
     8881 gcgagggtat atgggtggat ggcgtgtagt ttaaaggcga aggtgcagcc gggcgccgga
     8941 gcccggtgag agcgaaaaaa cgatggcgcg cgcgagagag aaagagaggc agaaggcaga
     9001 gccgcagagg gacagacgag gagacgccgg aggaaagaga gaacggccgc gagggccatg
     9061 agctccacct agcgtcagac tacgccaccg cggccgcggt gcgctcgttc ccgaggaggg
     9121 cccgcatgtg gcgcgagaga gggaaaagag cgggcgcgtg tagaaacggc caacgggcgg
     9181 atgcgcagag cgccccgccg ggcgaatcac ctttttatag acccccgacc catttcggtg
     9241 atgcagatac gcacgcgaac acgcacagac atgcctacgc ggcctcaccg agcagactgc
     9301 aacgtgagcg aaagcataca cacacacgaa aaaaacacac acaaaaaaac acacacaaaa
     9361 aaacacacac acaaaaaaat acacacaaaa aaatacacac aaaaaaatac acacacaaaa
     9421 aaatacacac aaaaaaatac acacaaaaaa atacacacac aaaaaaatac acacacaaaa
     9481 aaatacacac ataaaataca cacaaaaaaa ccattttatt tatgcgctgt tctcacaatg
     9541 ttaacatagg acaaagacaa ccacgaaaac gaccactaca acaacagcaa cagcatcaac
     9601 tacagcaaca gacgagggcg ggatcacgaa gtgtcaactc ccgcatctcc gtcgcgcaac
     9661 gtgtcctcgc agtccctacg gactacggta gaagccccgc aagagactgc ggacatttcc
     9721 cgctctacca tgtgcggaga aagttgatag acggcaggta gatttatcac aggcgcgtgc
     9781 acgcacgtca cgggcagctg catggtccac agatgtcccg gagggaatcg atggttcttg
     9841 aacagttttc tgacacccat ggcgagaaac gccctgaagc tatcggacag gcgcaccacg
     9901 gctcccccgt cgagactggc cgcatacacc ctgccgacct gatccatgag cacccgctgt
     9961 cgtctgagca gaggtaaagt aacgccgcgt ccgaagaatc tgccgatcac caccgcgacg
    10021 cctccgccgg gtatgagccg ccacctcttc tccgccctcc tgggtacggc aaactcaaag
    10081 aaagctccgc gcggccaagg caacggcacg agagccttat cgaaagacac ggcgaaagcc
    10141 agggcgtcgt caactccact catgccgccg aagaaagagg cgccggtttc catgagacac
    10201 ttggaaccgt agacgggctc gaagcgacgc aagccgtgct tccagagacc gaacgcgtcc
    10261 tccgcgagac ggtacagcgc gtcgtcgaac acgccgttaa acgcgtatat ctccccgcac
    10321 tctccgacca gcaccagcgc ggaaacttct gcgaagatag tgaccccgat gaccgtgaga
    10381 tccataccgg gacagcaccc gtatccgcga gacagcttgg ccaactcggc ctgcgtgatc
    10441 ccgagcatgt cggaggtggc gaatctcagt tctgccccca cgggccacga gagcgccaac
    10501 ctgcaatggg caaaagtaga gacgaagtcc ctcacgtcgt ccgccgatag cggccgggcg
    10561 acgagagtcc gaacgaacgc cgtccattta acctccggca ctgccgcatc gcaccgcaga
    10621 tcacgtcccg cagggaaaga gcacgaagaa gggcagagag ccgcagaggc cagactccaa
    10681 gaagatatac cgagaaacgg agagcgacaa aacatttttt tttctgtgcg gaatccgaga
    10741 taaaattaaa aggaaaaaaa aaataaaaaa aacgataacg gcagcgttac cggcagtctc
    10801 acataaacgt ctacgatcgc gctaaggatg ctacaactgt tagaaacaaa caacgttgaa
    10861 tcgacatatt cccgacgtct tccacgaaaa tggaagtgaa cctaccgccc acaaaactgt
    10921 gaacacatcc catccccggg taaaatatac aatgatccca gacgtcaaaa gcgcccgtaa
    10981 gaactcgatc taccacgctt ccattctttt tttttttata cctaacctcc cacgttaggg
    11041 cgaactatcg aactacgtcg tgcacggcac tcctagtgcc ggcgtccgga aattcctgac
    11101 gctcatcgtt tctagccttt acaaacagca gatcttcgtc ggcctgcctc caagttttct
    11161 gataaaacat tcgcgagaga tgacaagtcg gaagaagcgc ccattcgggc tgctccctac
    11221 ggaaaacgta gctcttataa tactgaatga ctcctatccg tctaaactgc tgaaaatttt
    11281 ccgccacaaa gcgcggccgt ccgtcttcgt cgttgtcgtt gaatccgaaa atccgtccgt
    11341 cgtcggccac gtagagagaa atccgaccgg cgtccgcaaa gtacttgtag ccgaagctgc
    11401 cgaagaaaca catttccgcg agcctgcgcc gtgcctcgtc gcacctgacg aatacaaaag
    11461 aatcccgccg ccgatgaaag agcagagtct cgttcttggg ccacctcagg gcgaaagaac
    11521 gacctatgtg ccggtctcga aagcacagca cgtcccgaca actgcagacg ccgtccacct
    11581 cggtgtcctc caccacaaac tgcagcgatg ataccagctg atgtgcgtaa tagaacctct
    11641 tcagaccttt acgaagaaaa tcgtcaatgg tgtcaccgac gcggcacagt tgctgcggca
    11701 ataaccaagt atgcgcataa acgcgaccgg caccgccgag cagaacgact atgtcacctt
    11761 tcagaaacca gtaagccggc tccgatccga tctcccccct tttcttcacg taccccagta
    11821 cgacgaggcg ctcccggcaa cacactagat cggccagttc gcccaacttt tcatcggcat
    11881 attcattctc gtctctacag ttgttaataa ccagctcgta tccttcaggc caagccaagg
    11941 gaattcgcct gccgaaattg acgaacgtaa acattcggac gctattcagg cacgtataga
    12001 cgcgcaagag atcgacgaga tctctcttgg acttgttata gagacgttga cgtttcttca
    12061 tcctctcctg agactgcagc tcgtcatccc cacacatcat agaatcttga gccggctcat
    12121 gaaggccttc gataaatcgc accgtagccg tagccaaaat ctgccgttgc gccgaagaaa
    12181 cacgccggct gtttgtcgtt tccattacgg gctcacagcg acagagaaat agcactcaaa
    12241 acttagtaag caaaagttgc aactcgcaaa aaaaaaatga aagataatat agtcacaaaa
    12301 gaaacttgtc acaatgtaca cccaaaaaga acgatatgga tgatcacacg acaacggcaa
    12361 caataatatc gttttttttt ttaaagctaa acaaagtgaa agaagcgtac cggttttccg
    12421 gattcgtctg tatcagataa aggtcacaca agccagctta ggaacgcggc gcgcttcgcg
    12481 aatgtctaac cctcgctgtt gcacgcgtct tataagccta cgtctgagga ctattcgctt
    12541 ttgacgtctc cggtgctcct gcaacctgat gtcaaacgag ccgccgccgc gcacagcgta
    12601 aggaacgacg ttcggataca ccccactcca catatgggtc ccgtaaagat tgcagtcgtg
    12661 aaaacgaaaa aacctcaccg gattcgacat gtaagataac tccagagtat tgaggaagcc
    12721 ctccagaaca tcgtgcctta tctcgcgagc gagtcgcatg gatgcacaca ggtcgcctag
    12781 acagatcttt tttaggcaca gatgctccaa gagcgcacga acgcgatgcc gttccttgtc
    12841 ataacccgat acgagaatcg tcacgatctc aagaaagaaa aaacacaacc gagggacgcg
    12901 catgggatct ttaatctcga actgagaact gacaactaac agtttgatcc tgacaccgtg
    12961 gaggccagaa acggtatcga tgcaacgctc catttctgag atcgctttta cgaagaaacg
    13021 agcaatggcc gtgagatcac ttacgatgcg ctgtttgacg cgtctcagca gaaacagaca
    13081 cagaacaatg ttgcagtaca ccttcaagat gttacgttcg aaatgccctc tccccaactg
    13141 cttatcgtga agaatgggca aatgccgcct ttccatagag ttaagaataa gagaagaacc
    13201 aagatctcgg tcaatctccg cccggagagc gaccgcttca cgcgcgtcga ggtgcagctg
    13261 gcctaaaatg agatcagctg gatcgaattc ggaaatatca gatatgttca cggcccggga
    13321 atctttctta cccagataga tccgaaagag agacgcccgg cactgatcgc aactacagag
    13381 cacagaagac acaaagcgat aagaagaagc gtacgcgaca aagatgtaat cggacaaaaa
    13441 gtgtttcaag agcacactcg tcggagacgc cgcgtcgcca tagatctcct tgggattggg
    13501 caaaatatcg aacaaggtca acagagtatt ggactcactc ctgttcctca gcataaggaa
    13561 ctgcaggaag agggagtcca acaactccaa aagacggttg aaatgcgccg agatagtatc
    13621 cctcttctcc ccatcgacga tgtactccag aatcgagaag tgcgccagag cggtgcactt
    13681 ggtcaggagt cgataaaaag ctgacgtttc gtcctcaaaa gttaaccgtt ctaagagaga
    13741 catgaaagcc gagagatcca tggtcgtctt tccacgcctt tggaattcca cagaaacttt
    13801 ctccgccaga gccgcccaga gaacactatc gtcacaaaat cgtaagccgc gggtcatgaa
    13861 cagatcctct gcggtcaacg tgccgctatc tataatcatc tcctccgtta tgtctttcag
    13921 atcaacatca agttccctgg aatggtgaac ggtcagcgag agatagggat ggttgggaat
    13981 ggtatacgtg acccgttctc gaacgggtcc cttataaatg tcgtggtcca ataactccat
    14041 cactcaagta agtatatatc tgagacagcg tttatttttt tgtcgcagaa aaaaacaaac
    14101 gagcagaatt caaattgcag gagacggcca cgtacatcac aatcgagaaa acacacaatc
    14161 actcatcccc atcatgtcca ttcagttcgc cggcacagtc cggtgcatat tcataatact
    14221 tgtaatcatc cctgaggacg tccaacgacc ccaatttata cccgatagct ctgacgtctt
    14281 tctcgggact tatttgaaca ccccgatgat taccactccc aaaatatttc aagccactga
    14341 aaaaaaaagc catagtcccg tttatgcacc tggtgttagt taaataatct tcggcgacgg
    14401 gcaacactac ccgttgtagc cgctgtaaga aattctcttc atgggtatta acgataaaaa
    14461 aacccggaat gagattatca gaagacacca ggtcacgatc attgtgctcg tggaagcgtt
    14521 ttatatgaag atgatgcaga aaaaacattt ccatgaaccg agtctcgtcg tagtctttgt
    14581 aagcaggaac ggaaaaaccg attctcagag cttcccaaca ctttaagata aactgactct
    14641 tttccccggg acacctaaca atttctttca tttgtttcat cgaagaaaag tagcacaggt
    14701 ctccgaggca cccgttccgc cccagcttca tttcttcctc catggtcaca cacaattttc
    14761 ccacttcttc cgtgaagagg tcgtaatata tgtccaactc agcatttatg acacggtaga
    14821 gggtgttcac gacgaacaca atgaaaacaa tgttagttaa gaaggttagc aatgccttct
    14881 tatccggggt gacagagatc tgtagcgaaa taggcagcct actgtgctct atctgacctt
    14941 caatcatgct caaccctaaa tccttcgcta tgagactcga cagactcaca ctgtagggtt
    15001 cacccaaatg cagaaaagcc ggaagacgaa ttgaacctat cataggaaaa cactgaattc
    15061 ggacacagtg gccaaaatca cacttcctgc ctctcttgtt atacatgata aacatgcgcc
    15121 tacactcgac acaaccacac aggagcataa agtgctcgat gagacaggat tcgatacgct
    15181 caaagaaatc gtatctgaag aagacatcgg atttgttctc caagcagtcc ttcaattctt
    15241 gaccccagtg acaaagatta taacctccca gctgccgagt agattccttt gtcaactctt
    15301 ttaacttgct ttcaaactga aataataaca tggaggcgta ctcacataga tagcgacacc
    15361 agtagcccag cgtaggtttg gacgcgaagt taaacagaga cgctccagca tagagaccga
    15421 taaaagccag tttagtgatg cactgccact tctcatcaaa attgtccata aatttcaagt
    15481 ttttcaccat gtcagcaatc tgatcggctc tgacgtaggt ggaaggatac ttgtaagttt
    15541 catactcata atctatcagt ctgttccaca ctacgcagtc cgaagaggga tgtagtcctt
    15601 taatgccaaa tctagctgct gcggttccct gcagaccgtt cgtcaaccta gcgcaggaga
    15661 cgggaacgac aaacctgctg gtagcgggca gtcgaccgac gaataccggc gtgagaaatt
    15721 ttgtgataaa tttaaccgtc agcgaatcct cttcgtccag acgcaccgca aacagaattt
    15781 tgctgcggtc tttcacgagc ctgttgtaag aaaaaacaag ttaacggaga gtcttcatcc
    15841 tcgaagaatt gtcttttcgg gaaaaacgac acacaacaca tctacccacc tgtcctttcg
    15901 cacgcacata tgccgaggct tactgcggag aacgggcaac tccccattca acatcctatt
    15961 aagattctcc gtctcagtgt cacttatata aaataaggta tcgtcattcc agtccaatga
    16021 atacttctct ttatagagca attcatcaaa tcctctacgt ataaaagtcc tcaaactttt
    16081 agagactttg ctgattctgt tttctacgta gatatagatg tgacagttcg agcccataac
    16141 gatagcagct ctgcaatttg gttcagcttg agagcgggca cacgtcccta tgatagcata
    16201 atccttttct gtgattttct ctagaatgcc aggtccagtc agataataaa tatccgacaa
    16261 ggaacaaaag gaaaagtcaa agtcctggaa agcatccacc ctgattctct tgccacaatg
    16321 ttttgctacg taatccttca tagccgggag attcctctgt aaaaggataa attcctctcg
    16381 gccgcattta gtctctccga accacatctt ttcctgctct ggatctaact ccgcttcggc
    16441 aaagggtgga aattgtctaa gtccgatatt gaagaactgg accagtgatt ctgctatgat
    16501 gtacactttc tccgtcaccg tgtccacggc aatggtcttt ccagttgaac tatgcatcac
    16561 gtatggatcg tagtcaggat tcggatcacg atatatcggg tgagcgtacc caatggcgga
    16621 caaaaattca tcagtatcca gaagactgct ccagtcatag gcacttaccc atctatgcgt
    16681 gtgaaagtga taaaactcac ccagagttaa tgcatacatg ggaggccagg cgatacaaca
    16741 tcgcaagccc ggagaactga tctccaaccc gtctccgtaa gctgcagaca gcacgtctac
    16801 atcaaaatcc aaagtaggca cacatgatga caaggtgaac tcatcgttgc agaccggtac
    16861 gatttctgtt tgaaacataa acgcaaaatg aagtacaata ctttcacaca agactcgctt
    16921 tccgccctcc gtttcaagta tcagacgaaa attcgacatg aactacttac tgaggctcat
    16981 gcacgattga taagtctccg acatgcccaa cgtcgacatc cgtccgaagc gcatggatat
    17041 ttttccaatc ttctcataac cgcagtccgc aaaaagtctg gcaaatccca cacgcaaaaa
    17101 agtcagtaga caatcgccca gcttcaccag cacgttgtct atccaatcgt aataatatat
    17161 ttttccagat ttccctatac atagaatagg tcttgtacat ttagactcat aatcatggtc
    17221 attcaggtaa cctaacacta ctactttttc tactaagtct tcctgttctt ctagatttgc
    17281 caagcgacat gtccctatcc agacactgtc acgagtccct agagtcaaac tcttaaaaac
    17341 cggcatatcc aatctcagat cccggccgac gttgagagac acgaaacgtt ccacatcgtc
    17401 caaactggca caacgggcca gctcatcaaa ctctcgcaac atggcaatgt aatgtttcct
    17461 catagccttg atgcccaaaa cgcctttcct attcaacttc agatggatat tcaaagtaca
    17521 gggactcctt aacacatcat tattccttaa attttccagc gattcgaatc tggggccgtc
    17581 atacaagcca tgacggtaca caggctccgc gcatgtgatg atgttagtac ccaggacgcc
    17641 gtatcttaca aattgctcaa aattatcaca cacgaagtgg agagtatccg tctctagatc
    17701 gtgcaagaaa attcttttag atcggccgat caaaattgga acatctctgt aaggaatctg
    17761 aatagtcccc agtagacaca gtttttccac aaaaccctga tagtgatcat tcatatcttc
    17821 aaacatcttt tctgtatatc cagctacatc tttacgtaga gtgaatctca gccagcagtt
    17881 ccgaggccag ataatagaca gacaccagtt cttatacgtg ccgacaaaat tctcgattcg
    17941 agaaagatca gcagattcac agaaacgaca caattcggca agagcgttct cgttcggaat
    18001 ctcacctgag acctccttcg cctcgaggtc catcttgaaa actccgaata acactagaag
    18061 tgaaacaatg aaatatctga aatataagac ctcgatgcga gacgccgtca catgacagga
    18121 aattggaaaa aagagagtgg tgtgacaaac tttattaaat ttcaaccccc gttttgactc
    18181 acacgctttc ctccgcatgt acagaaaaat ccgttccacc aacgatttcc tgcgaatgtt
    18241 ggacaacaaa caccttcatt tcctcggaat tatgaaaatc ttccttacat acatcagaag
    18301 caaaagtata taaacactcg cattccgaaa gttttatgca ttgcgatttg acatagctgc
    18361 aatccgcatt caaaccttgc accccgtact ttaagcagga gacctccatc gttccggctt
    18421 ctgtattgca ctcctcggat ttcgatttag aaaacagctg tacgactgtc ttccataact
    18481 ttctaacagc catcggcaga tccacttcag aaaaaacgaa ctcgaagcgc cactaaaaac
    18541 agatggaaat agtcacatac aagacggctt cagcgagatc tccgaccgtc acctggtcat
    18601 cgggattcgg acgagctata gcctcaattc aaaaaaggca tcaagaaaat atcaggaaac
    18661 ccctacgctt ctacagcggt ctcctacact gccttataaa acagtatgag cattgcctcg
    18721 tcccgccaaa taaatcaata cgtttcgaca aagggaagat tgaagtcgcg gccctaattc
    18781 tagatctcgg acaccaggta cttggtcgtc agatacacgt ccgacaacgt atctacagct
    18841 ggactagcat cacactccct aaactcttta ctcccagaga actttacttt ttagttgcct
    18901 ctccagaaga cgaagacatc gtatttaatc caactataac aaagggaggg tggatctcgg
    18961 gaagtttttc gtatcccgtt gaatacagat caaacttttc gctaaccgga atgtcggcta
    19021 acgtattaat ggtgccgttc gttccgtata gatacccact aaactatgct cgcttcatat
    19081 cgtcaataga tctgatgata ctaaacgaac aatttccgga acacgaatgc ggagacatac
    19141 agattttaaa gcagcgaaac tacctctacc tgggagtcat caaaaatctt acatggaaaa
    19201 aaagcgtcac cggcacaggt cagacagctc cacatagaat cctaaaagct tcgttcatag
    19261 gaagttggcc ggacacctcc ctgcctgaca gagtagcact gcgtttcttt aataacacta
    19321 ggtttacgat acactgccac gagttcgcaa ttaatattga aaatctcggt ctcgtcaaaa
    19381 ataaagagaa agtctttggg acactagcca ccgtatgctg cgagcaaatc ccttctctac
    19441 taacgactga aaatctaccg agatatttaa tagttcagtt tgaagtagta acgcaaatcg
    19501 aagatcccga acccctgtta ttttccagta acccgaaact atattttaca ggagacgtac
    19561 taaacgcaac gatgcaacta cagcacaacc caaattatta cgatctactc gtacacgcgc
    19621 catacgacat ccatttctat ccaagccgat gtcacatagt aattctacct atccgatatt
    19681 tcacgagggg tgacaagcaa atcctcatat ccggctatca gaacgaaggt ttcttcgaaa
    19741 cccaggtgat gctgtgggct cctggaacac cgttgcatat tacgctgcgt tcattctctc
    19801 caaatctgat cctgccccaa agcacaccta tcgcaaccct gttttatgta gaaagaatga
    19861 caagccagaa cactgaacaa aaagacgtaa tcgcaaagct gtctgagaat ggacatttta
    19921 ttggcaacct gaagctcccc agagaaaatt ttttacatca cgacgcgatc actgacttgt
    19981 ctttggcagc tatacccaag gactcagcga ctcccggccc agggacggtt tcttcatcag
    20041 tttccccgtc ttgacgtatc ctcagaacca tcttttcaat tacatcgtct ttttcttcag
    20101 gtgtctcaac cttcattaat tgcgtgggaa taagagtttc atcctgaccg actttgaaat
    20161 ctgaggtttc tctctcacct gccttcactt tttgaagagc gagatctatt tcccgttctc
    20221 cgttacccgg gagcttcacg tccagcgcat ccttaaatga cacagaatct aaatcgcgag
    20281 acagatcagc atttggcagc ctaaacggag actgcacaga atcgagatcg ttttgcaact
    20341 taaaattttt aaacagattt tgaggatcac taacttcaag aattctttct acgttagctt
    20401 cctccgattc gcgtcccaac ttgttttctg taggcaactt aagctcggtc ccagactgat
    20461 tgtgcaaaat gtcttgaatg cccttctcgc ctaaactaat cagatttgta aattcggcta
    20521 gaatcttgtt aactcgctgc ccaagacccg cttgaacata ctgttcctct ccggcatttc
    20581 tagcagcttc cattaaatta ggtaatggct cttgctcgtt ttgcgtcatt tctttatcga
    20641 cattaaactt tcctgaggtt tccttttttt ctgcattgcc gccagaatac aagtccctgc
    20701 tatttccttt cccccctctt gatacgtcac gagcatattt cttatttaac ccggcaaaaa
    20761 tatcattcgc gtgcttagtt tttctcaaca ctggggaatc ccgagcagtc acagtttcag
    20821 tcgcatcgcc agagtctccg gtcacttcgc gtgagtgtac tatagcctta tcattttttt
    20881 ccttagtcca gcttccaagc agatctaact tcttctgttt cctaaaaccg tctttgtccc
    20941 tcaaatcttt aatgagagaa acgttatggg gcgacactcc ggtctcagta ctgtgcgtcg
    21001 taagtttcgc ctctgatcca gccacatcgg aattattcaa cacgaagggt gtccctgtct
    21061 gctcagaaac caaacgatgc accggatcga aaacatctgc attcgccgct gtgtttttac
    21121 tccacggccg tgaaacatcc gatttattct gacgcagatt gagattagcg agaccattta
    21181 ccacatcagt aataccgcta ctgggacttc tgatcgaagt tttatcctgt agtaaatcca
    21241 cgtctcccgt attagattgc gcctcagctg gaagtttaac accaaaatct aaaatccccg
    21301 aagggccaat tcgataatta ccgtgcgact tatctcgcag atccagattg gtagaagtca
    21361 aagacgacaa cggctcaact ccggacatta aagagacaga cgaaacaggc gttgtcgctc
    21421 taacgtctct acccccgagt gtttctttct ttatcaaaat ttttcccccg gcattatcga
    21481 cgctatccga ctctggaaat ttatgtcgcc tctgcgtttt taagggcgcg tccaaacttt
    21541 tgggttgact tattttcaga cgagccaaat ccgcagatgg tctctttgta tctatagata
    21601 tactaggtaa actcaaatct gaaggcatgc ggccgtctaa agaggcgaaa tccattaaag
    21661 agtgaggccc attctcaggc accgaaaatg ctttcgacgc gctgtatgat tccagactac
    21721 ttttgataat ctcataatca ctggtgatta ttttcaaaaa actctctact ctctgaccag
    21781 ttagaggggt ctgcaaaacc ctctgagaat acacagcatt aaaattctcg ttcttcctca
    21841 aatgacccga gagatgattt tgcgtggtta caatttgaga catagcaacc ttttctagct
    21901 ttgaccagga ctggtttaac gttacaaata acttaccaag ataaactaat ttattaatac
    21961 tcgtcactaa gtaaccgttt tcgtcccagg ggtcatttat gttatagacg gtgtaccaga
    22021 gcatgttttt ttcagcgtct tgcaaattat tttctatctc gctgctgtct tctgcagtaa
    22081 gatttacata aggagtatcg atcggaacat tgctacccca cctaatagaa tttcctaaac
    22141 gcagtaaagc gcgatgaata tcactgaatt gcgattcaaa cttttctttg ttcgtgaaca
    22201 tattttcaaa atttccttta ttcagacctt tggattttaa gtactcgttt acgacattct
    22261 ggagtttcgt gatgtcttgc catatagcat tataatccgg cttccgttta gataacacgt
    22321 agtgatacat aagccataaa ataaatgtgt tatacagtgt ttttaactcg tctacatctt
    22381 ctccctctct cacgacacaa gaattagtca catagggatg ttctcgtaaa tctacattct
    22441 ccagattttc caaattgcta agaaaatttg taagacgctg aactttgtct cgatctagcc
    22501 acgcaaacgg gatcgactgc gctttcaaat ccatctttta gaaaacaaac tcaaaaacaa
    22561 aactgctcgt cttcgccaag actcaatgtt taatagtcct ttttttaccc acacagaaag
    22621 ctgacaagcg acgagatgga cactgtcatt gagctgtcca aactcctggt aagtctccag
    22681 agatcattgt taccgaatat tttattgtag cgtaccatga caataacatt caatatcttt
    22741 aatagcacga tgaagagttc aaagacaacg cttcctgtac ctcgaccccc acgctaaaga
    22801 cagcacgaat cattgagagc gcagttaccg gaatcacgct cactgcatcc gtacccatga
    22861 tcattatagt gattaccacc atgattctct atcacagagt cgcaaaacat aacgctactt
    22921 cattttacgt catcacactc tttgctagcg attttgtgct catgtggtgt gtctttttta
    22981 tgacagtgaa cagagagcag ctgttctcat ttaaccgttt cttctgccag ttagtttact
    23041 tcatctatca tgcagtctgt tcatatagca taagcatgct agctataatc gcaacaatta
    23101 ggtacaaaac tttgcaccgg cgtaagcaga ccgaaagtaa aacatatagc acggggcgaa
    23161 acataggaat tctcctacta gcttcctcaa tgtgcgcgat tcccaccgct ctctttgtgc
    23221 agattaacgg agcaaaaaaa acgacgggaa aatgcgtcgt ttatctatcc tctccgaaag
    23281 cttacgaact gtttctagcg gtgaaaattg ttttcagctt catttggtga gtcctcccaa
    23341 ccatggtgtt cagcttcttc tactttatct tttgcaaagc tttgcacggc gtcaccaaga
    23401 aaaaacacaa aaagactcta ttttttatta gtatccttct cctgtcattt ttactcatac
    23461 agatccccta tatagctatc cttatatctg aaatcgcatt tctctacatg ccacagaaca
    23521 cctgcttttg gttagcccgt gcagagatat tgcagttaat cattcgatta atgccacagg
    23581 tacattgttt ctctaatccg ttagtctacg cattcactgg aggcgaacta agaaaccgat
    23641 ttaccacctg tttccaatgt ccattttttc ccaaaagact atgtagtaca cagaatcgca
    23701 aacagtcaga cgtctccgaa catgatcaga actcgccatc agaatcgtca gtggatgaaa
    23761 acgaaccccc ttaaacacgt tttccaactt aataaatgct acccacataa aatcacgtgc
    23821 tagctctgtt ttctttgttt tgtcttccat agagcatggc gcacgctaaa aagcaggcac
    23881 gacgaaaact tttaacttcg acggacgatc ccatattgtc cagcactttt accatgcgcc
    23941 cgacaagtaa gattgcagac gctgaaatca tttcaagaga acatgattat atcgcaagca
    24001 aaacacaggc ggattcaaaa aaaaaattat cgtccctgtc tgtgattttt gacaaaactg
    24061 tcctgtttga attttacggt ataggagaca acaacgaaaa agctatcgtc taccctatcg
    24121 atccagattt cttattatgt gattcggaaa ataattgcac cctatcacct ttcttataaa
    24181 atttttttct cctgatctca cgtcacagtt tttttttcat atgtctcgcg ttgatacatc
    24241 ccgtatgaaa tatttaaggt ggttgaaatc acaccaatga tcacacacgc gatggaaggg
    24301 tcgaagacat tcaacattcc cactttcgtc ttagacgaaa attgtaactt catacccgat
    24361 gttctctcac gcgccaacgc taaatttatc aaagaggtac tcatccgaga ctcctacaat
    24421 gcggtttgtc ttgcaaacag ctttattccc atggcgactc aaaccgtaga gcaaattctg
    24481 attattatca caaagtttaa gttctcacgt tcacgagatc tgctcatgtc agtatttcgc
    24541 ctcggcgtac atataaacag attttatgcc ggaaaaaatc aagtcaaaca tatgatcaca
    24601 atgatgaaaa gtcttttcga taccgaagaa gccatgcgac aactcgacag agctcttatg
    24661 gggctgtttg tcgatgctcg tgataattca tatatgcctc tcatagcatt gtccctgcac
    24721 gaaaacggct taccggattc taaattcata aaagccgtca gattaataca aacaaccgta
    24781 aactcctttc ataatcgacc ggacgcagat atcgaacagt atgcagaaaa attacgagca
    24841 tacaattacc tctataaaat acccaagtat tctctgaaag aagctgtcga catttattcc
    24901 gataatctta aagatctcac tattggagtc aataaaaagc ccaccttact gtttacgtct
    24961 tcagatgacg catatttatc tcacatttac aacgacttac tatttttaac ttctacttgg
    25021 aatatgattt ataattgcaa aaaagagata aggcgtttga atacttggat caaatacgaa
    25081 attaactcca taatggaaac tgctgtattg gtaggattcc aacttccaga tctgaaggaa
    25141 acaattctag acctagcggc actcatatca aatatgaatc tcgtcagccc cgataaagaa
    25201 cttttccctc actacaaact catattagca aaattgtttg aaatctgtat ttttgcaact
    25261 aaggcaaaca tttgcatttt accatccttc ataaagggtc acctaataga gttcgaggat
    25321 gtcttaaaaa gaagcaatga tgacgaagac ctcaactatc tgcttctgaa atctcgagat
    25381 tctgatgacg aatacgatga agacaaaccc ccaatacaag tcgatccagg cagagtagac
    25441 aacgtgctta cagattctga cttttttaac gtaaccccgg aaaatgcttt ctcttctata
    25501 gcgatcatgc caatttctta tgataagacg atagatgtgg aagacaatga aattcaagtc
    25561 ctagaggttg agatgcagag cctctcagca gttgtctacg gagccgttgc aagcaaatac
    25621 ggcttaagcc tggagcaagt tatcagaaag ttaaatcgaa atgaaggacg gacctcttct
    25681 cgtgcatccc ccagccacag tacttctacc gtcccatact cccccccgca aagcgatcgc
    25741 tccactccaa cttctattct aagacaaaga gtaccaatgc gttccaacag cagatcatca
    25801 tcggtttctt tctcacagga agacagcaat cgtagtcatt actctgacga aacaaatatt
    25861 agtgattatt catatcccat ggcagatcta gaattagaag acgaagaacc catggaggac
    25921 catccgcact cccctcaatc aacatcatct aacaactcca tgtctcgtca aagccgagct
    25981 ctacaaaacg gacaaagaag acgtgctccc acaatggtcc catcatctca gacacgaaga
    26041 caaaataatg cccgccccag acgcgtagcc aggcgcctaa cggaaatgat gaacgacgca
    26101 aggttataat cacaaataat tttattgact gtgaaaagtg ctttatccgg ccaattcatt
    26161 gtacgataat aaaagttcca ttgtttgatt gatttccgta ttcttgagct tgtagataat
    26221 ttccaataga acatcccgcg ttagatgtaa ctcatcaacg taagaaaaaa aacgaatagc
    26281 attctgttct tcatcatcac caagtctaag gtgactcttc tctaaaaact aaaaaaaaaa
    26341 acacaccatc aattttattc aaccaatcta agatagtttt gcattaaaca ataaattact
    26401 gccagaaaaa ctatagccta gcaagctagt gaatcaaata cctaattcca atttaatata
    26461 tcttgaaatc taccataacg cgtacaaaat caaactcacc gcatatatca tattaaggaa
    26521 aagctgtttc tcttgtctac tggttaacat gtacaacaac acaattatct tcctgtaaaa
    26581 gaaaaacaca tcaatcagca tacattagct tgtcattctc tcttcctgta acaaaataaa
    26641 caatttatgc aatccaatta aagtcccttg tctttgtatc gaaagaaaac tattaaagcc
    26701 cgcttccacg tatacttaaa tcaataccca cctttttaca ggaatattgg tgaactgagc
    26761 tacgacgaaa cagtcgttta ctttccggat gttcaatcta aaaaattgat taatctcttc
    26821 ccatcttttt aaaataaata acatttcaat aactacggat ttagtaaccg tcatactcaa
    26881 cgtcagagcc ggcaaaataa atctatacat agtagaaaag tccattttaa atagatattt
    26941 aacgtatata atttcggtat ttgacaagat attcgacagt gacattaatg caggcaaagg
    27001 acacagttca cggcattctt gaagccgttg acgcttccac acatccatcc tcgtcacagc
    27061 caaagctctg ttccgctcag ctcggcagct ctccgtatta taaaaacaga tactgaatca
    27121 cacgctttaa gaattaagaa tcattggctg cttgcccatc cgttaggaca tctcattctt
    27181 aacacatatc caatacaatg gtaaaaaaac aggattaaaa aaacaaacaa cgacaaatct
    27241 tatcatcggc tgaaattttt attctgtata ctaacatcca acatctccat acatcaagtt
    27301 aaatacaact caaagtatga cgtatctatc tactcttcat cctcagatga taaatcataa
    27361 atgtaatcat tcgagaatgt gggccctaga aaagtatgag gacacaacgg cagaatttct
    27421 tggacggtgc taatgttctg atggaaaaac ttatagcgac gatatcccct aacaatcccc
    27481 tgtcttaaaa aagattcaaa ttcgtctgct attttaacac atgatccaat tcctgttccg
    27541 atcgtatcaa taccataaat tgcccccgat aaatccatca tcacaaacat cgtcttcgga
    27601 tacagtaatg tttttccaat gctcccaata acatgcccgt gatacggcat gctctcgtag
    27661 acatccgaaa agaaattcca ttccatccta ctaggaaaat cttctttcct agtaagaaat
    27721 aaaacaaaaa ctccgtcgtt attttccaaa caagacttca taatgtaatg cctcccacta
    27781 tttttataaa cgatcgtagc aaatttccat aaattatcct gcacatcaat caacgattga
    27841 agaacatcat caatttttgt taaaaagcga atgtcctttt ctcgatatac cggatcataa
    27901 cgacgcaatc cgagaactgc aaatcgttcc gtcgtttccg ccaacaaata cagtgtctca
    27961 ttcacgaagt cgagaccata gaatcgttcg tcttctccca caaacaccaa cgttttagtt
    28021 aggcacacat cacgagtctc ctttccccag gcagaaacat atccaagtag ttgcaatctc
    28081 tctgggcagc aaagcaataa cgaaccttgt ttaaaaggaa aaataacttt attttcacag
    28141 caaaaaacga gaaagacaca ttacaaaact gacacgaaac actgatactt acacatttct
    28201 tgcaactctg cggcagactt tgtgggaaat ggaattttac acagtgtcga aatcaccaag
    28261 caccgacttt tcggccaatt aaactgtata gttaagccgg tcttctgttc aacgtatgtc
    28321 gataaagaat cacgaaaaac tgcaattttt atatcgttta aattcattag tgcaatgtca
    28381 taacgagttt taacatagtc gccgattcgt tcgtctgcca tctctacgtt atgaaaccgt
    28441 caactacccc tttggaccca aaactacaaa taaaccagct cgcatttctt atccatcttt
    28501 tatagcacac agagataaaa aactcaactt aatcaactac catccaaaaa caaggaacgt
    28561 catagtgttg gactaaaatt accatttcgt tcgcccatag aaaatcaaca gagactaccg
    28621 gacaattccc tacgttaata atatccatcc ttgtgtatgt aaaataatac aatgtaaaca
    28681 ataatgattc aacaatgacc ttggtttctt ctcatacaac tgatttcccg taaaggaaac
    28741 gaatgataaa aaatcacagt cgcggaaaat tcaaatactc gtcatatgag aaattcccta
    28801 aaatcttata tataagaaag ccacaaaccc tcacaacctc atagacacca aactttctga
    28861 agagcaaaaa gagtagcaaa tcacggccac cattacaact atgttcgcct tcaacatcaa
    28921 cattttcttc atctattcta ccggaagaaa caatccagag attatctctc aagataaaca
    28981 gatccataag cggcagccat cgaatgatac tgacattgaa gtggtaagaa atatcaaaaa
    29041 acgcggatac aaatttttac cgatagaaac gcgatattta tttaagcact gttcaatcct
    29101 ttccacaggc agacttctta cccgaaaact acagtagtcg gatccgtaat tcccaccgac
    29161 aaaacaaaac ggtaaacact tttatcgttt tgttatacac taatacccag gagagctcag
    29221 attttgactg atctgcacat tacgaatacc ccagaatatt tacacctgtt tgcgattttt
    29281 ttataggtct cactgctcca cattctaacg acactgggaa tgaacgttat ccgtgcttct
    29341 ctatcaaata cgcattgacg cagatgagta agttttttca ctaatccatt ttaaatccga
    29401 cagaaaaaca caccattgac tatatgtaat taatattttt ttatttccgc agatatgatt
    29461 taatccgacg accactacat gttttactgt ccacgatcac cttttcctta atgcaaatag
    29521 cactcacggc actttataga aaatgtctca cgataatgca caccaatttt ctgaatgttt
    29581 tcatgtaatt taataaacat ttatttgtat cctaaatctt tcacaacatg tttccgcgta
    29641 atcattgata aacagcatag caataacagc atcgtaaatg cacccccagc caaaaagaac
    29701 aacccagcag ccgacattga atgcgtaatt tcagacacat tctcgtaatc ccttgaaaaa
    29761 tccaacaacg cttcaatctc cttgtattta taccaattag tccatgcaga cttccatgta
    29821 tttcttaaga attttttcgg catcgtatca tttttaatta atgaaaaata tttcgaatgc
    29881 acaacctttt tcttgtaaat ttcatccgac aattgaggac agatcatgct caggaaatag
    29941 ctatccagag acactctctc atttaaaatg ttcaaagtgc cattggcatc tggcccgtca
    30001 cttgtccatt gactcgcatt catttcagtg ctggacttga gaacaatccg ttccgttcca
    30061 taaaatagag tcatcacacc tcctgcgcta tgaccttcta gccagcaatt tacagtactc
    30121 gatagctgag cggcatttgg aagcctttta gcgatcaaag ctctgagcat cactcctcta
    30181 aaataataat taataatcac acgtagaaaa gccgtttttt cagagataga tgtgatattt
    30241 ccaactttca tggctttaaa gccatctgtt agcatcgcaa ggttgatcag atatgaagtt
    30301 ctgacagaaa cacagctgga attcccagct aacactccat tcacataaca agtagagatg
    30361 catatagctc caagtttctg ttcctgaatt aaaactattt tttgctcgca tgtgagattc
    30421 gatgtaaagc agactcccat tacaaaggta taaactaaca aggactccat agttaacttc
    30481 ttcatgatat ttagaattca cagatcgttt gcaatttctt ccaaaaaatc tgccgcatct
    30541 ctgtggaata caatagaaac aaatttgaaa ctttataaaa gaacaaaccc atttaagacg
    30601 cggcaacaca attcagtcat ctataatcca catccacttt cgtgcactct tgtaccagca
    30661 cttgccacat gcatcaagta aaaacatcca ccatccctaa aactaccctt tgcgcgcacg
    30721 ctctccccat ccgtgaaaca attaaaaaac ctacctcagc acagctgccg attcatgaac
    30781 agcattttct gggctcttaa gccaatgaat gttcggtttg cattccgatg gagtagcaat
    30841 gatacaataa ccttttaaag gtttttcttg cgccaaagac gcaccaccct gaacatgttt
    30901 acaacctaca tcatcggttg ccatagcacc gaccactgtt gtatcgtaca ccgagtcgat
    30961 tcgaggatca gagacatcaa aggtattttt tgcggtcgct tggacttccg tttccaaaat
    31021 tgactgatga accaaatttc caccgagaaa cagagtttct gaagaattat ccaccacgtc
    31081 ttcagtttga gtggcagcgt cacacatcgc ctcagaccga tctgtctgtg tatgcctcga
    31141 taacataatt tttataccag gagttttggt aagtccatag attgtgcaat ggcgagcgga
    31201 gttgtcttct tgacacgata aagccataca caccgtcccc ccaacatctt ttttcgcaga
    31261 tggctgcaac aattcttccg tcggccaaca aaatggaccc ttagcaccga aagagtcaga
    31321 ctgaattggt ctcatggaag cacgagcatc ttcttccacg caagcaccac tctctacctt
    31381 ctgaaaccgt ctaggtaata cacctgtcaa agaaattggg gtatgtctca ttctcgtaaa
    31441 atatttttga aattgatcac tgtattcatc gcgggacttc tgtgcaataa aattactcaa
    31501 gatcgcgttc tgacacgaga actccatggc agttgtccag aaatctgaaa acgtaggtga
    31561 caaataaaat atcacaccat cttcatatcc aagcacttga ccagttgacg ataacaaaaa
    31621 aacaacttgt ctctccggag ccgcagatgc accttcccat tcctccgtta caccaaacat
    31681 actcatccta ccctcaaaag gatacaaccc gtttattaat aaacatctca actgacggtc
    31741 agatagaata tcggaattgt cacagatccg aactttgata caagtgatat gttgaagaac
    31801 aattccggaa gccatagctt cctgtacaac tttctcaaat ctcagagcgg accccgccga
    31861 agaaatcatc ttatccttaa actgcaacat gcgcgccagt tcatcaccgg tgaatgccat
    31921 tacgatgttt tttctcgtta atgattaaga taatcggcca tccaaatatg taagaactgc
    31981 acaatcttag ttaaatttat acgaaaaaat actgcaactc cggaaatggg tgtggcataa
    32041 tctctaaaag caccttaaga aaaaaaacag acactgttaa caaaaaaaaa aacaatttat
    32101 ttaaaaaatc tctgttcaaa tcacctcaca gtcatggaaa cattttacaa aggcaacatt
    32161 tctaacttga cattgctaaa actttcgtga gattttattg actgtcgttc tatatcaaac
    32221 gaattatttc cgcagacaac tgctattgaa tcatcacgga cgttttgaac gctatgaagt
    32281 tccatgtcgt gattttcagc ttcgtagttg cagtattcta cttccataat caccataggc
    32341 acttcatcat tccctctacg cctttttagc accctatttg gattcgatga agatccccca
    32401 gaaacaaaaa actgaatata ccgcgttaaa atatatagaa acatacaccc agcagcaatt
    32461 ggaattacaa tgaaaatcca caacagctgc aatttattaa atttttttct gtgcggcgct
    32521 ggaaaattat gacgaggaaa cgtgtcctcg gattccttca cgggattcac aaaacctttg
    32581 aaactaaaag catcctctct tgttaagaga gctggggtaa ctaataattt atgcgtaatt
    32641 tcacatgaaa actcacgatg tgtcatgctc aaagctctac tcaatgctct ttcataagag
    32701 tatagaagtt gaccggaaat ttcggttcta atgaaatcgt cagtcgtatg atcatctgaa
    32761 actgtttggt tgtgaagact ccattgaatg ttcgttccaa tgggccgata tcgtcgagct
    32821 gtacagacga gcaaacctgt atctctcttg ctgaaaactt gcggaggacg atatttagag
    32881 tctccgaaaa caaccttacc atagaaattt aagatgtctt ctacacaaaa acgtcttgca
    32941 taaaacgaca atacgtgcaa agaacgattt tgtaaaaaac tgctcacatt tataagatcg
    33001 tgaacaaaac tacgattctc attaaacaga tctatctgta cataggttgt atttctcgct
    33061 aaaaaaacgt agctgccaga caactgcgta ttattgttga cgaagcaaac caattcgctt
    33121 acagaaaaat tttgaactga gacatactga agcccagcgt gcaatctatg aaattcacgt
    33181 attaccacat gtcctaaaaa acggtctacg gtagaatttt ttccttcttc caggcttccc
    33241 gcgaggtcaa acaacgtctc tccaacagcc gtatggttcc gcaaagtcaa atctccataa
    33301 agcctctcgt aagcaaaaac gatatcgtta tcaatgccga taacggtctg aagtttaccg
    33361 attccttcag ccagagtagt cttgatgtaa agtttagccg gcaacgaaga aacgcattga
    33421 aataaacatg cgacaaaaac agttatcatt tttaaatctt taattcacgt cgaagaaagg
    33481 tacggccctt gaagaaacag ttaaccgccg tagtcaataa cttattacaa aaaggccaca
    33541 tggaattaac actaacaaat ataaagtata ttatctcctt cagtcctaca aaacaggaaa
    33601 tacccagaat acccacacaa accgccaccg cacccatgaa cataaggttc accatgatag
    33661 atgttatctc tgcgaatgct aacatagtcg aaccttcgtt ataaatctga atagactttt
    33721 cgacattctt ctccggaagc gtaacgataa cattatcgcc actctcctta ttcgtgcaca
    33781 tgcagaaata tttatcccct acccacttat ccaatgaaat aagtccccac gtcacatcat
    33841 cgcgaaacaa agacgtatat gcaccggacg atctcatctt taccgttttc cataccatat
    33901 caaacgtcag cggctcctcc gcaaagatct cgatctttcc cagcttgcta acaccccaac
    33961 ctgaatattc acaaactgca aattctcctt ctgcgcccag ccacctagag aacgaacatt
    34021 tcaaatcatc agctctgaac aatctttctg aagaagatct aataaccggc ataaaattta
    34081 gttttaactc ctcgtcgtaa gacagagcca ttcgtctaaa ttcgccgtac aactcagata
    34141 ggactttaac gtcgttattg cacgaagata tcaagtactg tcgatatgtc gagagttcag
    34201 tccaaagacg taacatcgtt ctgtcttcac cctggaaatt cttatctgca atccaagagt
    34261 tattgctacc atcgaggaaa aaagcaacac gtagtacttg tttcttgaga tttgtttcat
    34321 tcattctact gagtcgtatc gattttttat taacagagca ttggacttga atgctaataa
    34381 atgtcatttt tccatgacca catttttgaa cacgctttct tgcaagatgc atggttgcac
    34441 tactcacggt attaaacaat agtttatgta cgttatgaaa aacctggaaa catcgaaaaa
    34501 ccaaaaactt tccaaagtcg tattcaattt gactgtcttc cattcctccg taaaacactt
    34561 ggttgtttac cgccgcacta ccccataact ccattttacc gcttctccaa tttctgtatg
    34621 cagatatctc taagagcatc tccccagatc taaccgcttc accgttccct gcgccaaggg
    34681 ccggacaagt ggaaggatag atttcacccc ggacgaacgt taagacgcat aagaaaacaa
    34741 agcagatcat catgctgcgt tttccttctc ttttgcgatc actagcgccc actaactcca
    34801 gcgatgcaat ctttaatata agatcgccgt cataccacag cgtcgagggg ttacgcccac
    34861 atattaaaca aaggatccaa agcaaaccag caagaacaaa aaacggcaac agcaaaaagg
    34921 taaaccgaga tgcagtagta aacgaagcgc tcatagcggg gtaaaaagcg tcttctttct
    34981 tttcggcaga atgctacaga aatgaagcaa tcacctctct ctgtagtttt cctagcgtaa
    35041 tccactacat acgttttagt tctaattgac tccatcaccg attgatttag taattgtaac
    35101 tgcacaccgc tcggaaagga aacattacac gtagtatcat tgtccacaaa cacaacacca
    35161 atatttttat tgtatcgaca taatatctta gaccccaggg cagtctcgat aacgcatcga
    35221 gggttaaata aaaaggctat atctctttcg aaataagcat taataggcac actagccatc
    35281 cgccaccaag cagttccact tctctgagcc atttttacaa aaatcaacca atgtcttaac
    35341 tccgtttcac tatgtgttcc gataaaaact gaattttcat tgttaataat atgcaaagac
    35401 ggtatcaccg acacgtataa tacactcacc catgctaaac tccaaccctg aggcaccata
    35461 atcactagta acaatctatg ggagcctcat ctgcaagtct ttgcatccct cctgatttgc
    35521 acatccggtt tattctcttc atcccaaagc aaagacctct gcttgtcttt cttataccaa
    35581 ttatacaaaa taactatcac aattatgaat gccccgacaa aactaatccc gcaaatccaa
    35641 attactaacg agcttagaaa atctttaaaa tactcttcat ctccctcatt tgtatctgtt
    35701 aactcaggga cttgaacagt atcagtttcc caaagagcct gaaccgtctt ttttggtgtg
    35761 gatttcgtcg gcaaaccctg aggcgtcttt tcagacacat cggaaagagt cgacgctaag
    35821 attactgtga aaaacgtctc aatatcctgc gcctcatcac ccttgaccgt tggaaacgaa
    35881 cttgttgtaa catttacatt attgccactg gatcgatttg tggttcccac ggctagcgta
    35941 gaggtcacca tagaagactg gtttaaatat gccacagaag ctattgatat ttcggtaaca
    36001 tttttacccc acgtttcggg attcgccgaa aacgtagttt cagatttccc agttaaatag
    36061 tcgctggatg tcgatacatt cgtttccata tttttagacg caattgaggc aaattcagtt
    36121 gccgaaactt ctgtagtcgt taggttgagc atttgcacct cttcacagag acacacgagt
    36181 aaaaaagaca agaacaacat gtttttgcga ttacccaagt gcaacggttt tttaatcaca
    36241 cccacaccaa gatagcagaa tgaaaacaat cttttagaac aatgttccgc attagttttt
    36301 ataatacaac tcgacgaatt caaattaaaa acacaaatgc cgatcataag aaaacacgat
    36361 tttgcattaa attcagactt cctcatacat tcagatttgt catgttagtt taatagtcga
    36421 tgcctgctat tccttttaaa caatagagat ttttcaacgt tcatgtttcc gttccacatc
    36481 gggtcagcaa atgcttctaa gacaggtaat tcattttttt cgacgattca cattgaaaac
    36541 gtaaataaca aaagcaataa acaaaatcat tgcgatagcc aagcccgtca aaactaaaaa
    36601 agcaaacgtc tttcgtctct tgttccacaa attccacgct gagcgagatg actgcggagg
    36661 cggtaagcat tcaacaaacg atgtatcatt gctagcgtgc ggagaaacct gtccgtacat
    36721 gacgtccatc atcagcacct ctgaatagga cggcggcggc gtccgagggc gatccatcct
    36781 cttcccgacg aagattcacg ttgaaataca cggcgaggac aaaatttctc caaacggact
    36841 taaattacta agataatcgg agtagacgag aaatgcgagc acaaatgcga ctacgagagt
    36901 gtatgttcct tcccagagtt cctcggcact tctaggaatg gggaatagag ttttgcttat
    36961 aagcaacatg gtaaaacaat acaacctacc ctctttcaat acaattaatt cccctgacta
    37021 gagacgtaca tatctttaat aatcctcgat cccggcgcga cctctgacag tgctcacgga
    37081 gaggacagag gacgtctcta gaaaacatct catccacctg cttaatatag tccgtatctt
    37141 gcgtaaacca ttgcgtatgc aaccgacgat tctcattata acgcagacat ccaattttta
    37201 aaaaatctga catattgcga gctataaaga gaaggctctc ctcgcggtcg acgcaaaaaa
    37261 gcataccgtg gccgtcaaac actactacga gctccctcca gtcaccgaaa aaattatgct
    37321 gtacaataaa cactacatct agtagactcg tctgcagttt cctccgccac tgaatcaaat
    37381 gtttactaga aaacccagtc atgctcagat tgcaaaagcg aacaaaggtc ttgtacggat
    37441 acgttttcaa ggtaaaaaaa gcattctttc tttcatttcg gtaatgtaag agctcagaaa
    37501 acgatttact gtgagcaatc atatccagtg ccacagtact gtccagtgca taatcacacg
    37561 tctcataaat cggataaaaa aaccgcaaac cattagaaaa caaatcgtga aaagaagaag
    37621 ccacgtgata aagacttctg tcaaaaaaac cattatacac atagatgtgt ccccgcgccc
    37681 cctgaaggac aatcggtccc ctgcaggttc tggtttttgc cttatgtata accccgacca
    37741 caaccaattc gccttcgcaa cacatatagg tcttcgccca gttttgaaca tcttcacgtg
    37801 aaatatccgg aatgttttct acactatgta gagtcaaccg ataatcctcg ggccagggca
    37861 aagctaaagt ggcgccctgg cgattttcga taaaatttac caacaaatcg atgtctttgc
    37921 ttgaagacaa acccataacg atgaactgcc cggctcagag caaataaaca caaatttgaa
    37981 aaacattaat actgcaaaaa attttattgg tgtccaccaa aacaagcacg ataaattgtc
    38041 taatcacaca ccaaaataca tgcaacacac gactaaacaa aaaaagccgt tcaataaatc
    38101 acccgcataa aaagatctgt ctttcagatc gctgctcaaa gtcaacataa tcgaactaaa
    38161 cccgagacct aaaaaggctt caaagataat tcgatatagg cagacgttca tcatcagtcc
    38221 cgacaagatc gccaccattg cgcacgcagc agctttgaaa acatttagtt taaaaaacac
    38281 gttgttgacc accgtcagaa aaaaaagatg attagatttt ggcatactca agaagatttt
    38341 tccgatccag agtatcgtaa ataataacaa aaattcgacc gtaaacttta caaggtattt
    38401 caaatcaact tcacgaaacg acgttgactt caaaatcgga cgatattttt gcaaactaat
    38461 aagaaatcca gatgatcgta tcatccatcc atatctcaga gtaaacggca ggagaaacgc
    38521 agtcgtcgtc aagacagaat aatcatcgaa catttgactc ttaaaaaata aagacaccat
    38581 catccccgta aacacagcgg gggaataaga cggcataatc aggacacaac gacttaaaat
    38641 cattctcaac ctcatctcgg aaaaaatcaa gcagatcatg accactgcag acaagaatga
    38701 tggcagtttc gccgccatta aagacagaaa cacaatcttg aaatcaccta tgggtttata
    38761 aaagcgtgga tcaaattttt taaaagtcaa caaaaaggaa atcgcaacgg ttatcacaac
    38821 gcctatctgt tcgagggagg acctcccctc tgtcattcta aacggataca gccccggaat
    38881 aacggcaccc ttagcaagac cgagaataaa actatctgtc agacgacgca tctctgtctc
    38941 ttaggattgg agctgtattc aaaatgcatg gaatcgtcgc tctcgctatc ttctttctca
    39001 ttaaataagc tagagcccgc agtcccgttt ttagtgggaa ccatgtagtt ggttatttta
    39061 tattgcgttt cctgttttga tgccaacgca cttccgtctt cgttcttatg attcctatcc
    39121 ccttttccgt catcttgttt acccattcgt tcaaagcgag attcctcttt aagctgctcc
    39181 tgagttaaaa atgcttccac cgtcaacaac gtgcttttgg aagttaagat caatttacag
    39241 tctttagcgg ctaccgtacg taaactacac gacgtcttga ttacagcaca catacttaaa
    39301 gcctgctgta aatttttggc agataaatta aatcgcatgt tattaacatc gtaaaatata
    39361 accttattgc tgtttgaaaa ctccagttca ttcatctctg tcacgaattt tatagtcggg
    39421 gggttaacct gtactataat gtgcgccatg aaagcgtcag atttaccaga gcgtttagtt
    39481 ttagttacgg gcgaaagcca ttttaacacc tcggaaacgg tcgaatgatc aaggtcaatc
    39541 ctcaacggcg atttcccgct gtctcgcacc acttcttgtc catgcacaca gggaaccgac
    39601 gcctgtgtac atgtatcgga agccgtcacc aaaaccctcg tatacaaatc actatcatgc
    39661 tgaatgtaca gcttcgtaac ctcaggattc gagatgatgt tcataaaact ttcaaagagt
    39721 ggaatatgat tattaatggt tttcgttaaa aagtgctccg tatctgataa aaacaaacat
    39781 tccgcctgaa tggtcagctt ttgcacgaga tgatttttag cagactgaat tattatcgaa
    39841 ggctgcggag tgaaagtcac tgtagtattc tcttttaaca gttttgtaaa cgctttaagc
    39901 ggtttattaa tagttttcca gcttttcata tgaaaagcta gggtcggcgg ttctctcagt
    39961 tctctatgtt cccgatgatc acggtgatca cgatgatgat ctcgactacc gcgctccatc
    40021 tctgtcaaga acgaagtcct agcaccaact cgcgccttct gtgctttaaa aacaaatgaa
    40081 atgaccaaca cattatatac tgtatttttt tggcgccaac attttattac atcattataa
    40141 aatgttcttt acgtgcataa ccacaccatc cgagcatttc ccgatcaacg gtaacggatt
    40201 tgataaatca aggtgtttat acatctcaga actacacaaa accttataca tagcgacttt
    40261 gaatccagtt ttatacagca acggtagcaa gtgtttcaaa ctcacagtat cgttgaaata
    40321 aaatacattt gcctgcccct gatccaaaaa aggcaaccca ctcttataca tctcaatcaa
    40381 atcattcaaa ggataactaa aaccatcttt gaaaacagct aaatcatcca actccttgtc
    40441 cgtaaataga ttcgtgtcca cgtttaaaac cctatatccc acagtcttca aatattgctg
    40501 atgcttatta aatctgttga gcaacagatt gttatacacg ggaatatata acgattttaa
    40561 ttctgacgaa taaaccgaag tgacatcatt taaaccgtct tttccaatta cgactttgat
    40621 gtttgaccgc ctgagaattt tattgtcttc catcggccag aacgattcag aagagttgat
    40681 gatatcgaat tctttctgca tggcagtacc ggcagtgaaa tgaatattgc gaactccgtg
    40741 catcagcaca tctttcctta gcgttgtcca caattcctcc ggaagcgtgc attcgacatt
    40801 atcgaattga tcaaagtata acatccccag tgcgtatttt gacctgtcaa ataaattgca
    40861 tggctctgct cctttcatgc aacaatccac actcgttcga acacaagtat aataaatgtg
    40921 ttcacacatc attcgatata atcgacaagc atctggatgt gcataggata acccgacggt
    40981 catgaaaacg gaatgaagac ccgtaataca gatacctaga cttcgtccat ctacaattcc
    41041 ctcacgcaga aaatctttat tatctacagc ataatcaatt acagcattag cgaccaacac
    41101 catttttcga accacccgcc ttaattcatt aaacataaaa aatttacact gcaaacgcac
    41161 aaaatcaatc tcctcggtta gctcatcgct tacttcgtca cccaagaaat gcaccacatt
    41221 aagcaacatt ctcaaacaag tgttaatacc gtctctgaca ggtaaaacat ccaaaaaatc
    41281 acccccgcaa tacaaaggca catgaggaat catagaatac tgatatacgt tttttcggaa
    41341 aataagtccc attctgcccc tttttaaaca acggcaaatt ttttccacaa aactagccat
    41401 agtaattttt gcatgatctg ttgtccgctc aaactccaaa tattttgtcg agaaagtaac
    41461 ttcgtcacac tttcccagtt caaaagctat atttttatga aaaagagacc actgcgctct
    41521 ttttagctcg tacctatcca tgaaaatccc aggaatgatc aagcaaaatg tgacccgaga
    41581 agtctcaggt agaacttgat acaagtccag ccacgttagt gcggacacat gccagacttc
    41641 cacatagact gtcaactgaa ccgtcttatc ggtatcacgt tccaccacct gaatttgaga
    41701 cagtaatatc tcaaaaatat tcttggcttc ctgttgataa cgagtcacat tcatgcttat
    41761 atttgaaccg tttaacaaag ccggaaaaag atgctcgccg tttactgtta taaaatccgc
    41821 aagcgaatat aaacatgtat tgtaaatcgc cacgtcgaaa accgtactat tagccttttc
    41881 cacgaggccc aaatttgtca tacaagaaaa cggtaaaacc catttttgag taaaaaggga
    41941 aaacgccaat tcttcgaata tcacgtaagg attctcctga tatatctccc gcagataacc
    42001 atttcttaac acgatctctg tcaaagtagc acacatacga agatagatgc atggaatact
    42061 ctcttcgaca ccgtttaaag aattggaaat ctcctctaaa aagcgagatg cacccaaaac
    42121 tcccggcata tattggtttt tccaactcac acttacttta tagaggacgc tacgaataaa
    42181 atctcgatac ttctttacaa agttcaatac atttggcata atcacattag ggcatgataa
    42241 aattaaatcg tccggacaaa agtcgtaaaa aatactcgtc tttagatacc atcttcctag
    42301 cattcgatcc actcgtggaa cgcaatgtgt agctctcaaa acagagatta tggcatcccg
    42361 caaacaccaa gcatctaaac ctgagtcgag ccgatccatt atcttagcga tgtcacgaac
    42421 ccgttcatac aaaacagaag cgcatgaata ttgagaataa caaaaacgtt tttgcgacgc
    42481 ttcgtaatga caaacgcatt ttctgttgta gccaaaatct ttattaatac gacgctcctt
    42541 tctcttcatc ttcagacaga aggctcagaa gctatacgaa cacttttttc tcagaaaggt
    42601 caacgaatat gttctctagc tttatcaccg gcagggtaat tccacgatac tgcagaaaac
    42661 ccgatttaat gtcctccgtt gcgcaacgac caatgcgctg aacgcttcca aagtaactca
    42721 gcgtggtatt gctattaatg agatagttca aaaacagaaa ccgctccttt tcgaaatact
    42781 gtcgcaagat atcaactacc aggtcctcgt tctgaaaact ggtcagaact acgtagatcc
    42841 catactggag ctttgataaa acctctttgt aaacatgaac cacgtaaacg tactgggtgg
    42901 aatgctgccg cggttcccag tctggctcta ggaaaatctc ttttaatacc gtaagcccgt
    42961 gaatgttttc tttgttagcg tcatagacat ttccttgcat gacgcatgac aacagacaac
    43021 tgctgccgca agaaactaag ctcgtcacac caaacaaaga cactttgtct tccaggtact
    43081 tacacgtgtt gatcatcgat aacacgttat caaccattga gtttgtatac atggtagtta
    43141 aagcggttct cacgcaagca gacacattga aagcgttcga acaaaggaaa aacagaccca
    43201 caaacagaat tttagggttg tccacatcag tctcaaaacg atacatcaac attcccaaat
    43261 tttcgagctc cggagccaat aattcgcaag gcgtgaaaac ccttgccgct atacgtaaat
    43321 tctccctgcc ggacaaaaac tgtttcagaa atttcctttc tttttctaca acattattta
    43381 aggttcccgc ctcgatagat atatattttc tcttcttcac agcttccaca gtatccacaa
    43441 tggcagctcg tgcactcgat ttagagttca ttcttagttc actcaaaaac agcacgtccc
    43501 cagaatcatt actagccgct acggcaaaaa tcgagatttt atccctggca gccgatagcg
    43561 taacacacaa cagagtaata gcttttatta atcgactgcc cccgaaaaaa tatcactttg
    43621 accttatcag ggaatataca gttttctact ttttaaactc tacgacctta acatcagaaa
    43681 ataaattgct ctccgcagaa cttttacacg aagaactcag tcaaattcgc tcttcgagtt
    43741 cgccgggcac agaacttgaa aacttaaata atgcagaggt cctttacgtg ttcgatcgaa
    43801 tactcaattc cattaaaatg ctaaaaaatg agttatcgtc tccaatcggc aaacttcgag
    43861 tacaacccgc cgccaacgac ccaggtaccg ataaaacgat aaaatactcc aagattcaat
    43921 ccatcataca aaaggtacac agctttacac gagaaaattc acttcttgcc aactgccgcg
    43981 ccgtcgtaga actgatagac gatctatatc ggaaacttta ctcatggttt ctacatattc
    44041 tcactttcga ggacattcag tttccaggcg acacatttct agacaggctg ttgaaaatgg
    44101 actactgttt tacatattac ccttcttcaa atcgccatct aatagatctt ttcgaaaaga
    44161 cgttggacaa tcaaacatcc acagacatcg ataaattttt tgacacttca ggaaacagtc
    44221 cagaactact ttatcaaaaa acgtttagct tgaaaatatt ttcaaaaaat ctcacagccc
    44281 aggacaatgg attatatatc tatccactac ttaaaaccga cctgtccatc ctcgacttcc
    44341 tcggaaccga aaatattctc ttccatcgag gtctcatcta tcacatactt catcaaaaaa
    44401 caatccctca agaacgggag aatgatctca ataaaatcaa tcaatttttc gctactgtca
    44461 tccagcaggt tatcgaaacg agaagctcat gcttacccgc gtcgttatcc cgactcttag
    44521 atacgatttt tcacttcaac agaatcggtt taaacataga aacgtgcaga atctacgtcg
    44581 agatcctctc aaaccacatg gcgacaccag acacccaacc cataatcaat acattcacca
    44641 tcaacttaat ccatattgtt ttcaccgcgc acgtgttttt catctgcatg gaaaatttca
    44701 gcccgacatt cttattctat aataggaaaa aactcatatt agaacaacag agagccattt
    44761 tgatcatcga acgaaatgaa tattccacac tctggaaaca aatatctgat cacatcgact
    44821 gtctcttcaa catctctctc tccgaatcct tttttaaaga atataccaaa ggaggaaacg
    44881 aagaacataa acagtttcta tacaaaaacc tattcgaaaa atggggtgac gtctttttcc
    44941 ctttcacgta ctcggtaacc acctcaaaaa actccacggc acaccatatt acaacccttg
    45001 agctaagggc catctgcaaa gaggtctatc agagcgattc cccggaggca tacgaatcgt
    45061 tacttcccta cagcactcat ccagctttta aaacattatt cattaaaatc tacgttatac
    45121 ctatggtcac atacattacc aatcttacct ttgataaatt acaatctgat tacagactca
    45181 taactctgat ccacgcctgt aaactcctac tcccctcgca acatctacta ctacactaca
    45241 tggtgtggct atacgctttt tccataaacg tagaccacat agatctaggc actttcaccg
    45301 taataaagtc cgtaatcttt aaaatcgctg accacataaa cgtgatgacg catacgatct
    45361 actcccctga gacaaacctt ctcgtaagca ttctactaaa cgcgtatacc gactaccttc
    45421 aaaaatacgt aaacccctgg atcaaacaga ccataacggc aaacttctcc ctgttacaga
    45481 cgtacataac cttcacgaaa caatgcgcca gcatcttagc gaccaaatgc aacataaact
    45541 tagacaatct atttatctcc atgactatcg gaacagacaa aattgtaacc acttcgtttt
    45601 gctccttcat cgctacatgc agaaatttag tacgtcaaca cgaagaattc aaaaaatcac
    45661 taaaaacgat cgaaacttcc aaaaccacac tcacgaatat gctactaaac ataatcacaa
    45721 gcgtctcctc ctccaaggag ctgctgacca acgaagcact acaaaaattc atcgacactg
    45781 tccaacgcat ctcccaacac gtaaacgaaa cataccaatt aatttccgtg aacctcgaaa
    45841 aatgtaaaat ctcaaacgac atcctaatcg aatccctaaa gaagaccatc tccatagttg
    45901 atgtactcag ctccgatgca atcctaaaca cgtcgttaac ttctagatgt ctggaggccg
    45961 ccacgctcgc ggtttcaaac aattctttca caatactcga aattaaaaag gacgcagttg
    46021 ccgttttcaa gccttttata acacaactat ttgaaagcat gaaacccacc acgagtctat
    46081 ataagaaatt gatggctacc caaaaactga ccaccgaccg cattccattt ctcgatatct
    46141 tcgacgatag gtacaaccta gtcagacacg tcgaacgaca attaaactgg tacgccgcat
    46201 atgccgaagc agcgcagcaa gatcttattg ctcctcttac gttttaacgg tcgcgttcta
    46261 acccatgaaa atcattacca gtagcacgaa ccaaaatgac tctaaatacg gaccgagagc
    46321 cggaaaacaa tgcatgtcga acagcttttc atttctccac actgtttact taaacggaat
    46381 taacaattct ctcaatgcgg gtactataga cgccataatg gaagaaggct atcacttaga
    46441 cacggccagc accttagctc taatgctaga taactcagat tcgcaagact acagactcct
    46501 caccgaaatc cccagaagga tccattctag gtacggcgtc acacagcatg aactctcacg
    46561 gccatttaac ggaaccctag acacacagaa aattgacaat gaggtctatt ttggcctcat
    46621 agatttcata ctgtatggca aaaccaagaa ttgtccagct tttgcagtca tcacgatcgg
    46681 cgtgctatcg cgagcaattt tttttcttaa caatactctc tacttattcg actctcaccc
    46741 gactgaacga gaagccacag cagccatcta catctgtcaa gacattgaag aagcttatga
    46801 actgctcacc gcccacggca ctgaaggctt ctactacgac gccagcttca tttttttcat
    46861 agaaacctcc aatttgtcgc tctctagtca cgacgccgag cttcttatcc taaaaactta
    46921 taaagacccc gacatagcga ttacgctaga taaattttct tccacggaaa tccatgatat
    46981 aaaaaaaaca gatgatatcg gatcgcaaca agacctcgtt gcggctaaaa cgacatatct
    47041 agaacgcgcg ccccagaaaa gaaagaaaaa ctctcatagt ctagaactag aactaaatga
    47101 caagaagaaa aaagataccg catccttgac atattacgca acggaagtcg acctgattcc
    47161 gagcttttat gaactacgat cacaatttca atctttattt cacgatctca aatcttttcc
    47221 tataatgaaa tctcaattca actggaccat atacttacaa gattctccca tgaatcctaa
    47281 tcagcccttc gcaacaccct ttctctggaa cagagttttt cacttattgt gtcaaatcgt
    47341 cgacgtgttt gtaggcgtcg gatccacaaa tgacgattct agcaaacaaa agcagcaaac
    47401 gattttcata aattatttat tgcctttcaa ggacttttcc gaagtattca acgaggcgtt
    47461 gacagcttgt caagaaaaca atctggacat cctcttgatt tacaataatt acctgtgcaa
    47521 aaccacgacc tttcgaacac tcgagagaat cttactaagc aaatttctgg caatagctga
    47581 taatgagcac gaaaaacatt atgaatgggt caaatcgtgg accacacaaa tgctccaaga
    47641 gatgccaaag aaactagatg acatagagaa ttatctaaaa gcctatgtga gccagaaccc
    47701 tgtgaaacac ttccatgaat tcgtttgtct gaataaggca gaaaaacaca acatagctgt
    47761 tctgctcaac gaaaaacgaa aagagattca agaagatatt gaacgagaca agaatatttt
    47821 cgcacaactc tctaatttta ttgacaaact cggcgaaact cccgcacttc ctatcgaatc
    47881 agaaaacgtg cacaaagttc acacgagcga catcactgaa gccatcgttc cgcgtttcat
    47941 gactgaatcg attgaattac caaacatctc cacactgaac aacacccaac aattatccct
    48001 agaaaaacaa atcagtgaaa aactcaccaa caccatccac acactcagaa acaaattcac
    48061 aaaaatcgta caagataact ataacaatct cgctgccggt ttcatgccag ttaccgaact
    48121 gaattgccta tttgcctacc tggtaaacct ttattttaac attgaagttt taaaacacag
    48181 cggcctaaac attaacactg agttgcttca agaagtggaa aaactgtatg acaacacgca
    48241 atttctacgc ttcggaactt ctcacttcaa tataaacaac ctttcgaact ttaccctatc
    48301 tatcagaaaa atgttcgtcg atttctataa cagtcaaaaa ccctcggaca gagcttccga
    48361 aatcctagcc gcaatcgaat ccatcttagc ggaccccagc aaaaacaaga caatcgtaaa
    48421 tatagaaatg atcaaatcac aactggaaga actggggaaa atggaaatct ccaccaccga
    48481 aaacaagcaa acagctgaaa tcacaaaaca aatccttggg gaccaagagt taacccctat
    48541 ttacgatttc ctgcaccatc tctctgctta taacctacct aatactacga ccgtaaaaaa
    48601 tttacacctc catttcatct tagaaaaacg accagatatc gctgcgattc tccacgataa
    48661 aatacaatcc atacttgaca tatgtataga cgacatgctc aatgacataa cagtccctga
    48721 gcagacgttt tcaaccgttc tatttcttgt agatctcttc ccaaacagca ccgaaaaaac
    48781 agcactgttc gaatccgttc tcacactacg gcaattagca aagaaatgcg ctaacttaaa
    48841 aactctagaa gaattcgacg atctggccca gttcatcacg acgaacagcg aacaactcca
    48901 aaacatgatg aaacagcatt ttggaaaaaa aataccaacg ctgatggatc atatcaaatt
    48961 tctctactct caaaaaataa tcaccgctga agagaaaaat tggatacaga gagcaaaaac
    49021 agccgtcatt acatctcccg aagaactgac agccttctta gccactgcac ccactaaaca
    49081 cgccttacaa acttgcaagc ctgagctcga taaagcacta caacgacata tggaagagca
    49141 aatgaaacaa actgctgaaa acgacaaaaa acacatcctc acaatcagaa acaccctcga
    49201 aaaaagactg aacgacatct tactcattct aaaagacggt caattctcgt ctttggaaac
    49261 agtgcatttg aatcttttag aaacctttct aaaacaattg caggataacg atctcatcat
    49321 tcacttcact catgcactac tgccagtgtt aaaggacata gaaacgacca tcagcaagac
    49381 catctccgac attctcgaaa agatattaat caaaactcct ctaaaccccg aacagatgtc
    49441 caaggaagaa caaaaatata cccctttact cagtttctta tccaagttca aaaaaacaac
    49501 attctgcaca gaagatgtaa aaacagagat cgaccaaatg caaaaaagta tcacgttcct
    49561 cacgaaaatt gctacctcca ctaataaata tactagaatc agccactccg tctacggaca
    49621 agaattaaac ctctacgaag aacgcatcac agagctgaaa aaagagacga acaaaataaa
    49681 agaacagctc tccaaagaat acgcagtagc tgagaaaaaa attcttctct cgtcacaaga
    49741 tgcaaaaacc aataaaattt atctagtcct aaatacgcac acgctgaaag aaataaaaaa
    49801 cacccaattc agagaaacgg cattcgctaa agctctcacg gtcgaagtca acaacaaaga
    49861 aaatcaactc caggagctgt taaaccactt taacgcacac ctaaaggcga aaatggatca
    49921 gaaccatata acaaaacttt cattcgatac aaaatggaca gcctttgttt cggattccag
    49981 gctctacttc ccagacttcg ttgacatcaa actgcaggac tttatttctg atccctttaa
    50041 agttataagt cagctgatga acaaagcagc caacgagatg ccttacattc aagcagagat
    50101 aactctcaaa tggttaacac aattagtaca cgacatcaac aaattctgcc tgtcagctat
    50161 aagcgaattc gggaaagaag caatcccgtt caattacgcg gccctacgag atttggaata
    50221 ccagattaac accaagtacg tagaaattga aaacaaagtc atctgcaacg aaaccgtcga
    50281 gaacacgaaa aacattccga aactgactaa gctcttgaag gagttagatc ctaaacgcgt
    50341 tgccggtggc cagaaacagt atcaaactct catgaacaag attctcactt ccgaaacttc
    50401 tatgcaacag acctacgaaa aagaacaact caaaaaagaa tacttcgaga ccgtcaataa
    50461 tgtcgccagc ttcaagttag cattcaactt tcctaagcaa cgacaaaatg tggaacgact
    50521 aatggagaag ttcaagtcgc tgcccaaagg ccagccattt gaaaaatttc cagaggaaaa
    50581 tgacctattt tctgactcac tcatcacaga aaattatatt aacggtctgc gcgcactcct
    50641 caacttcata acggctgcgc aaaactacat ccagaacaca cttctgaaac aatgggcggt
    50701 atttcagcaa caaaatttca tcccgatcga ttactcagta gcgaatgtca agcctatttc
    50761 ggatttatat gcccgcctca ggattgaacg ggaccgtcaa gtgttctacc aagtaaactc
    50821 tgtctttgga actcaactaa ttgttgacga aacaggagtt ccgctgcaat tccacaacat
    50881 cttttacaac gccgtagtga agtttttctc cctgaactac aagcagattc atgtaccaga
    50941 agacaccccc cgcctggtat ctagccaata taaactcctg tccgtgtgta aatctttcat
    51001 aattatacta cagcagttct gggagaatat aatcactctg gacctaggcc cgtacctcag
    51061 agacggtaca caaaatttta aaagagaact tataccgatc gtgaacttga aattatttat
    51121 atacatcata acacaagcct ggacagcatc tgaagacagt actgtttcca cagcgttcga
    51181 attgcccatc aagcaattca cacttttgat actatgctca catcctgaat atctctacgg
    51241 ctgtctcagt catccaacag atctggttat aaattcatta gccaaaagca tagacaaaga
    51301 cagtctctat gacacattcg tcgttagcca caaccctccc gagaagccca tgcatttgat
    51361 gagaagtata tgtatcgaca cccagctatg gcaatccgcc aaacttatga aagatacctt
    51421 ccaacaaaca ttttttacac aactgtgccc ccaaaacgaa aagtttttta tctatctcac
    51481 tgccttctta attctcccct acaaatttct gaactatatt tggattcaat acaaaccgat
    51541 cacttttacc caaagatctt atcaaaactt aattaaggac ctatgctccg aatacgtaca
    51601 ccaaaataag atcaccatgt cctcggtaac tccccacgaa ccggacacaa taaaatccgg
    51661 agaaaagatt acctcaaaaa tcaccgtaca caaagcacaa aacacaccga cactcactcg
    51721 cctgcaggct caggaatatg tcttcgacta cattctttac tctttcttga cggggtacga
    51781 aatgacattc gctatgtaca tcgacaccat cgaaaaaaca tacctgcttt gcatgagaca
    51841 cctggaaaac gtactccacg ataaagactt ccaatccgtc ctcagagcac gcacattcga
    51901 catcaactac atcctgaaac agtcatggac taagaacata gtcgaacatt caatcttttc
    51961 agtacagctc aataaaatcg tctcctacct caaccacaca aacagagcga cacccaatat
    52021 tcccctgata ctatttaatt atgacaacga agttgtcaac gtttatctac cgccgatgtc
    52081 cactgatcca aaaaaagtcg ctttctacat aaaaaatcct ttccactttc ccgtgcaaga
    52141 atacgaagcg acagatttaa tttcctttca tctctaccca aaaacaacag atattttaaa
    52201 ccaacttccg cccaataaaa ctgtgtctac tcgcccatac aaccttagct ctgaaacttt
    52261 aaccaccaaa aacctctccg aaccaaagtt taaacagcct accgttactg gacttatgcc
    52321 caagagccaa tcaatcatcc tatccactga taccaacgta ctggaaacca gtccagacat
    52381 aaaagctaac acggccagcg cagcgataaa agatgtcact ctagctcgag aacaaatcag
    52441 cgagttctcc gaatcgataa atacaactct ttcaaaatta aaatctttgt atctgtaaca
    52501 ttcgacacac aaagtcatgc ttcttttata aatttttatt agttaaacat acgaaataaa
    52561 tgaagctttc atcaatcact ccctgttttt gtgttcagtc tatgcagcgc cagcattctt
    52621 atcaaatcga gtcggaacgc cgttttatcc acgttaccgc cgttctgctt agcgtatttt
    52681 ggcaaaaaga ccccaaggac gggatgattg gccatggtag gctgcagccc taaaacaccg
    52741 gtaagcatct gctgcttctt cttttcctcc tctttttttg aagaacttcc tgaaatctga
    52801 gtgatctgat tcgacaaatc atcaccacgt atggtcgtca tttcaaatac acctcacgtt
    52861 ttgggaaatc tgacaacctt gacagatatt aacacagtct tccagatcta agcaagtctc
    52921 tctaaacgaa tgctgacaat gctgacactg aaaatcagaa ccgtgtgaaa caagccgtaa
    52981 caacttcttg acggtcacgt tgtagagatg cacagtagaa taacaggatc tacacgaaca
    53041 aggaacaata acatcgaact tcacattgtc atttaaaata gtgcaagcag aatttgttcc
    53101 gatcaccgcc ttccatgaaa cagtttccac cttcatcccc aatacacaat gctcagacat
    53161 ttcatatatc cgctcgaaca ccaactgctg actcccacac agcgaacaat acattacatc
    53221 cgtatgcatg ctgtatatca aatttttctc ctgcttgtct ctaaaataga acatggagct
    53281 caacgaaaag ccctgcggcg aacacaactt ttcttttccg gagtttaaac agtgaccaca
    53341 ttttgcacaa ataacgcaaa tgtaactctc ttcaagtata aaccgagaac atttagtctt
    53401 acaatagcac atgacgggta acgaaataac actggtagct aagccatcct ttaaggacgt
    53461 tgccagggca aaggttagaa tctttggaaa atcaccccgt tcaggtttgc tcggcaccat
    53521 aggtactaga ttattatgct ccactggaat aagatatctg tctgcgctaa aacagaagtt
    53581 ttccaccaaa gccttcgcca tagtaaacat gaaattcccc gccggagatt tcaaagcata
    53641 cttttgcaac atggagggaa atgacaaaac gtgctctctc tgcctatatc gcaacatcac
    53701 cgtctcggtc tgctcatagt cacgtaaaca gaatagcctc atacacggta agttgacgtg
    53761 cgtcggaatc ggaagcaaca actgttgctc gaacagaaac atgtgcaact cattgatttc
    53821 ggaaaacgag ggcatctcca gcaacttatt aagcttgtac gagggataaa ccctaaatct
    53881 agtctcgacg tccatccatt tgattctttt aagtttataa agagacaaca attcgagaac
    53941 tttgcactgc cgatacacga aatacagata ggcgagcaaa acaaaaagac cctttgtcat
    54001 aaccattttg ttaaaaagtc gcttagtgat aaatcgtgtc tccggcctgc aacgcagcca
    54061 aattgcaaaa aactcattgt aaaatttttc cgttacttcc ttattcagga attttttatt
    54121 tgtcaagaac attgtaagaa cacattttcc tggcacacag gcgtcaccca tcacaaacaa
    54181 ttgcaaatga gtgtacggcc catgtttaca caacggggcc agaagctggc gtaggagttt
    54241 ttttaagtag aacataacaa aaatacaagg ctaaaagaaa gcagatgctg acaatcgcaa
    54301 cccgacaatg cctttcactt agtctcgaaa acttcacacc ggacaggaat gacttttctt
    54361 tttcatagaa ctggtttata ctctcctgtg atgtcacaac cgcagaagct ttatttgcaa
    54421 tttctccgct acttccgagt tgcccctttt ccaaaacatg tgaagacctt cttcgcaaac
    54481 cttgacaaaa cctattcgat tcgagatgct gtttccccat agaacacttc tttaagaaaa
    54541 ttgccttcaa aagcgaaatg tattcagatt cgttttcagg cccaaacgcc acaaactcca
    54601 caacgtaagt ttcgtctcga ttacgcctaa ttatacattt cgtgaacact gcaaaagttg
    54661 aaggcttcat agccactatg tcgctcatgc gaacagtcaa acattcatta acacgcagaa
    54721 tgttgcattc tctcacagca tgatggcctt ctgctttaac cggggcatgc aaatagcaag
    54781 acatcgacac agctccgcct gtgtttttga acacaaatct cggttcctgc ttagttacat
    54841 gttcccagag actcaacaga tattctagat tataagcgta gtctaacttg agaataatat
    54901 cacacaaagg aaatttcgga tttttcgaca ataaattccg ctcagtcatc ctatagtcat
    54961 gagaccccaa ctttaagata cgacaggtcg cactcagtag ttcatcgtac atcttttctt
    55021 tgagtacgtt agccatttca cctatttaaa agctattccg tatttaaata ttcttgatgt
    55081 tctaatattc catttacatt taacagcttt gacaatatcg aagtgagaag taccattttc
    55141 tgagccatga cctctcgatg cacgcaatcg acatccccgt gaacgtatct agaaaaagca
    55201 acgtgtctat atccaacact aagaaaattc agtcgcgcct ccaaagaagg aagcatcatt
    55261 tcatataatc gtggcagcat tggataaaac acgacctcaa actcccttcc ctgctcacag
    55321 acttgctcat acaaaagttc aagattcgtc ttttcaggtg aggagtccat catgtacaaa
    55381 ggatgggact cagaagcgtt gtctatacaa tctgagatag taaacgagat tctgttatat
    55441 tgctacctca ctccccaacc accaattcct tccgagacga caacagccac cagccccacg
    55501 aacatagaaa acgaaatctc caatttagaa agctctgaaa acctagagga attaaagcga
    55561 ttatccgtcg cattaaatat agacagacga tgcaatatct gctccatcgt aaatctgtgc
    55621 ctcaaacaaa acaaatcatg gatctacgac tacagtctac tgtgctacaa atgcaactac
    55681 gcgccaaaga ctccattgtc tcttctgatt gtctccgcgg aatttataat gttaatacga
    55741 gaacgatttc caaacatcaa ttttgacggc ctttttcaga acaacattgt ctccatcttt
    55801 gacttccacg ttcatttttt tattcacaga tgcttcgcaa atacggtcaa cgatcacatc
    55861 caaagcgaaa acataaccct gaatcacatg gccataatcc gatcgaccct actaaaagaa
    55921 gacagtatac cgcacatcaa aataaaaaaa tttctaacca aaaaaatgaa cccgaaaaaa
    55981 acacaaagcc ccgaactgaa taaaaaactc acagtgccca tgaagactcg cttcacgaca
    56041 ctcttattct atatgtggtc tggcacaaac gtcttcgacc gagttccctt cacggaccta
    56101 actatccgca aacatcgctt catcaaaaac ctgtattcca acaaaaccga catcgaactc
    56161 acagctggtc ccattctctt ggcacagatt ccattttcca tcaccaaaaa caaaacaacc
    56221 agcgtctgtc tgctatgtga actgatggca gcttccaaac aagattacct atttttaaaa
    56281 tatctacatc aaagcatcat ggactactgt caaaacaacc taaagatgat agatagagtt
    56341 cagttcgtca ttgccgatat cttcgagaag acaaaaatac acatgcacgt caagaatctt
    56401 tccgactaca gcaaggcgat attcgataac gaattctcat tctccgatga taacttcact
    56461 ctcgataccc acgtttacct gatactccgc cagactggaa cagtgggagt ctataagcac
    56521 ttcttctgtg atcctctgtg tctggcaaac tgtaaaacca ttaacccgga ggttctcttc
    56581 aacactacag acgccggaga aatccaagac ttgaaagtca ccatatgcta ccgtaacgaa
    56641 tatttaagca tcgtcgaaaa acatgtttgg ctagcgatac atcttttcaa agcttttcag
    56701 attattaaac caaaccataa aaataaaact caaattgcag agtttctcaa agacttcact
    56761 aacttattag cgcttcacca cttcgatatc gtcgatccca ttttcaccgt caactactac
    56821 gtttaaagaa tgactgtaca caaaaaccgt tttcgacgat cgcgaagcct gtccgtgaca
    56881 cacagaatac aaaaacgacc tgatcacaga gaaaaaacaa agctttactt acaactgaaa
    56941 ctccacgatc tacacgccgt cttcaacctg tttccagaat acgaacagaa atttctagcg
    57001 atcataaaac tgccaattac cggtaaagaa cccatcgacg tcccattcag tctcagcaat
    57061 caccatcaac acacctgcct agaattctct ccctacgcta acgaacaaat ctccaaaagc
    57121 gcctgcctac actgcgaatc cgtctccgtt ccaacctcct cagatgcaat ggtcgcccac
    57181 ttgaaccaag tcaccaacgt catgcaaaac agattttact tctacggctt tcgaaaggac
    57241 atggagctga tacgcatgtc cgccaaacaa cccactatct ttcaaatctt ttatattgtc
    57301 cacaacacga tcaacaacat attccctatc atgttcgaaa aaaaacaaaa gctcggaatg
    57361 cacatagttt tccagtctcg cactctgcac attccttgtg aatgcattaa acaaataata
    57421 gcggtatctt cgggctacaa cgtttatcta gatatactac aagacagtgt aatcctaact
    57481 gtcctctgcg aaacactaga tactaatact aatattcaca ttgacatagg gatgcttcaa
    57541 aaaaagctcg aagaaatgga catcccgaac gaaatcagcg atagactcga aaaatacaaa
    57601 ggacatctaa taggtttcca ttaaaccact ttattgttaa catgtacaaa cgacaaaacc
    57661 gaaatacgtt cacattacct ctgcaatagc agaaaacgtt tcatccaaat acactttcat
    57721 aggaagtaaa tacaatagta acttctcttt ttttatatcg gtcttcggaa aaatgggtga
    57781 aatcgcatta gtcacagcct tgataatctg atcgaaatac ttctccgcat gtataggaat
    57841 cttgtgttct aacacatagt ttggatcttc tgctaattca tagttatgcg tctgtttatt
    57901 accagtagat ggtgctatta acacatacat aattcggtca ccaacattcg gaatttcttc
    57961 ctttctctgc gccaaccttc taatgacgct aaggtgagcc agattcggct gcttatatgc
    58021 agccacctcc ttggaaagca cagaagacaa catcaaatgt ctcacgtctg cccgattttg
    58081 aaaaagctcc tcccgcgctt tgcacagacg acgcaaaatt ttatgaatac ccacaggcac
    58141 tccttgctca cgcaactgtg tttgcgtcat gtgagaaaac tccacagcag cagtctgaac
    58201 ctcttcatca aagaacaaca agtccacgat gtctttcacc acacctttca caaaatcgca
    58261 agaagtcttt ctcaccagat ctaccccctt aaaaattaaa agcgagtcat cctgtctacc
    58321 aatatatctt tttttacaaa tcaaaatgag cggacataaa atcttctcga actcgagctt
    58381 gataggcgat ttgaacaagc gatctgtgat atgtttggcg atcatcggcg caatcctccg
    58441 cagagactca ttagccatat ttctgacaga cataaagatg ctatccgtat caccatagat
    58501 tacctccact tttaaatcac cagtaaaatc tgatgccgtt agacccaatt cttcgcaaaa
    58561 gaattgctcg gactgcatct tggaattaac ataatccacc gtggaacaaa gcatctctct
    58621 tccaagacag gttacagaag cagcaatcgc aacacacggc aataacccgt gcgccgctcc
    58681 cgtgacaccg tacaccgagt tacatgttgt tttgagagcg agctgctttt tatccagaag
    58741 gagtttcatc attggatccg aacagttttg catctccgcc ttcacttctc gtctcttggc
    58801 cagccagtcc tttagtagac ttccaagcac agactcgcga acacaaggct tcacaaaccg
    58861 atgggtctca tcccccaact tcacggttaa gatgtcactc tctgataatc cagctatttg
    58921 ccgttcatcc aaaactaagg tactataaca cagattatgc gccatcataa tgctcggata
    58981 caaactctga aaatcaaaca ccacagtggg cacagcataa taacccgtct taggctccaa
    59041 gacggtagcc cctttgtaac ctatcccttg tctattatgc gaagacacca tactcggaag
    59101 aatcatgtta cgacgttttg cttccgtaag aatgcaggga aatatcttct tctgctgacc
    59161 ctcgaacacc acacatctag ccgtgacgtg tgccaatctg gcgacctcgg caacctcata
    59221 atgataatta atctgtttaa agagacgcac aactaagaca gagtcctgca gacaatattt
    59281 accgacaaca gccctgccac tgggtccgct aataaatttc tttggtattt ccttgtacga
    59341 taactgctct ttttcttgct ggagacagat cttagcaata gtatccagtt tgtaattctg
    59401 cgccgttatc ttactagaat agactggata catatccaga tataacactc cggaagtaaa
    59461 caccttggtt tgcgcctgaa ggaacccctt cttgtactgt tcatgaggaa cagagattcc
    59521 aatctttcca ttcttcagtt tagaaaaaca accaatctca tagtggtaaa tcttatccat
    59581 ccttatacac aaatatttta aatcaaaatt gttaatatta taaccggtaa taaactccgg
    59641 agactcaatc cttaaaaata tgaaaaatcc caaaagtaat tcaaactctg acgcaaattc
    59701 atatatatgc acgccgtcaa tttgttcaca ggttcccaga gtaaacagat gtctctcatc
    59761 acggtcgccc tcagtatcaa aactaactac agaaatctga ataactatat cacccaaatt
    59821 ttcggcatcc gggaaattcc cattttggcc caaacactct atgtcgaagg accagcatcc
    59881 atataagggc caattgacgt tttccaaaga aactaaatcc gagacatgac agttaatttc
    59941 cacctcaaga ttactccctt ttcccatatc ttgaggaata tattttttta cattatacca
    60001 tccgaaactc aaaaaaccat tatcgacgaa gaaacgagtc aaaacatcta catcgatttc
    60061 ataaactacg aatccctcat tctgcagaat cttcccaata cgttgagata cataaaaatt
    60121 tccaaaactc actttaaaca gattaacaac agtgttggca ttgtacccat acaatgacaa
    60181 cttatcagcc ggctcaatga caaaagaaca cgacatctta acctcgccgg ttaacatcaa
    60241 attgtttata gtagccttca ggctttttcc gtcgacacat tcgcagtaaa aatattgctc
    60301 ctgtccaaac acgttcacac aaatcttctc accgtcctca gatctcccaa acatcctaat
    60361 cactgtcccc gaaggaatca caaaatgtct atactgaaaa ggaagattct cgatcgaatc
    60421 cgtaaacatt aacgtttcta cagcatcata gatgtggaac ttcatcctcg tatgatcata
    60481 atccttggac cgaactctgt ctaaactcgg ccaagtcatt tctttgctca gtaaatactg
    60541 tcggtctcga taaaacatac gcggttcaga gtcacaaaca tcctttatta agcccgcagc
    60601 accatcatgc attataccgc gaggaagtat acgaatgtaa ctcgatctgc tttttttctt
    60661 taagcgattc gcttccaaat atggattaaa aaatgacacc gaatccatca cgcttcttct
    60721 acatttacac tcttataacc tctatacctg atcctgtcta tcaaactagg ttttgaggca
    60781 tgagactcag aagacgaagg ttttcttctg taggactcgt ctaaagactt tatggccttg
    60841 agcattttta aagcatcttc ttgtgaatat tcatcaccac ttatttgtcc actgacgtca
    60901 gccataccct cctctttttc cgaaaccgca acagatgtgc ccccgtcagc atctttaaca
    60961 ctaggcgtct tgacgacagt ggtccccgta acactggaca cagtagtcac cggattggtg
    61021 gcataaggaa acatcatgtc aataggctta ctaagcacat gtttttgtct aacgaaaacc
    61081 acaattatta taacgacaac tactatcgct aaaatcaaca tgagaccacc cccgaatgga
    61141 ttttttaaaa aagacaccac tccacccaca atatccccaa gtgctcctgc cgtaacactt
    61201 ataaccgagc ccaatccagt gcctatagcc ccaagccctt gtaaaaaaga attaatccca
    61261 ttgacatacg acggcgtatt agtagcaatt ttagcttcta tagtatatag tgcgctctta
    61321 tatgagttat attcacgaag aatattctct aaatcgaaaa cgtttgctct actcaattcg
    61381 tccggcgaat ataaatcaag tagtttaaaa tcagcatttt cgagagggtc gatctttagt
    61441 ctaataaaag catccaatac ctcaatgtct tctatgggcg tcgaattcgt atgcgtataa
    61501 tcggtataca cgtgtgcatg atttccagat agaaatatct ttgtactagg tatctcacat
    61561 tcctctgtcc tatgatcacc caacagaatc tcattatcta accctagctg accaaggaca
    61621 acctcaggcg tggagttcac aaagctaaac gtcaccaagg gccgattata acacatcgtt
    61681 tcactcctta ctcccttcgc atcgacgacc cgcatactct tataaagctg aacggatgat
    61741 tgattaactt ctatgcattt cgagatagct aacacatcac catgcaactg tgcagatatc
    61801 ggacgaccgt aaacctcaga cacgatactc gatggactga tcttactaag ttcgtgcaac
    61861 atcgttatcg ttcgtttttg atcgaggcac caagattctg ccaaattccc caaggcatcg
    61921 ttgatataat ctttcaaagt atcatagagg tactgtaatt gcacataaag aatatcatgt
    61981 ctagacttga catccaccaa atctcgcctc ctacgtaagt ttactgaacc ctgctcaaga
    62041 accataagag atttttgcac aagaggctgc caaatcaaaa tcagatctcc cgtagtctta
    62101 aaaatttgat aactaccgtt catgctgtat gcatcattat aatctgacat atagacatct
    62161 gtaattatct tctcaaattc attcttaata cacgtttgtt tgggatcggt aagatttaaa
    62221 gactccttgg aggcgacgaa agcggctgtc aactccttag aaataaagtg ataagtctca
    62281 tccgtctccg ctcgaagccc gtgagtcacc gtagtccagt gctttagcat acacaccgat
    62341 tcattctctt ccttgatttc ccaagaaaac aaagtatccc ctttctccag aaaagcgatc
    62401 ttccttacta acgtagtagc cccattcata ccattcatta gatcttctat catagtatag
    62461 ttttccaaga ttgtcaattt ttctaacggc tctgcaaaat gtttaccgtt tgaaccgtcg
    62521 aagaacggag acccttccac gatttcacca gtcgtcaaag caaagtaact aaacggatat
    62581 ttcgccttag ccgtagcctc cgtcacaata caattgagag acgtcgatgt agaatagagc
    62641 cacaaaggac cccttgcaaa gtagggttct ttcgtagtga taaatctttt attagtaaca
    62701 gacttgaaat tcagaggaaa taattctaga gtttcgtttt tattattatc ctcatgatag
    62761 gcactaaaca ccgtaccatc gggtcgtttt atcgctacgg ctgaataaca ctgcgcacga
    62821 gaattaacta aatttgcttc gtacaccggc atggccaaac ccatcaccgt ccgatccaga
    62881 aaataaacca cacccacatc acggtaactg gttgggaacg tcagctcgtt tttatatgtt
    62941 ctcactggaa aagtgtaggt ctcgatattt gttttgtaaa tgatgaaaaa accctccgac
    63001 atctttgcat tagacttata tggcgaacac gaaatatctc tgtcgaaccg catcaaatca
    63061 gtgcctttgg caatcgaaca aatccgaaaa ggatatttgt gattatagcc cgctctgata
    63121 taatcatccg aatcgcaata tatcattaaa acactattca tcaaaaagac agccaggaat
    63181 aatactctca tcttgctcat tctccctaac gagatctagt agattaggcg ttcgaacaga
    63241 gtaacttact ccttccggca cgtctacagt ctccctcgac aactgagctt gcaaatcaca
    63301 atataacagc gaatacacgt ctttaaactt tgtcatgcca ccaccggtgt gaaataatag
    63361 aggagactcg tgattaaatg tcaaaacgac atttccattc aaatcctcct cctcatctat
    63421 acgtacaatt tttaatcgct ttccgaaaac atcattatat agtgcaacag aaagtgttaa
    63481 ctctctgatg aaattccaca tttttttctg catgtcattt acatcagtta caccggaaaa
    63541 gttaaaaaac tcattatatt cgcacaccat ccacacactg ggatgaatag tgccctctat
    63601 gcatctcgct aaatcttcct tcatatgcgg taacatttct gcgtggtcgc aaccatacgc
    63661 cattgagata ttcgccggaa gtggataggc agatttatga aaatccgata acggacccgt
    63721 taacaatgtg tacataatct cacttaaatc cggcaaaagc tccaaaggga gcttcttcgg
    63781 catcagatta tttttaatat aaagatgttc atcgtatgta cagctatcta cacgaataga
    63841 gccatccaag tacatttttc tgagaacgaa accgttcata atcttcgata aagcctcaaa
    63901 aataaaattc ccatacacgt tcacactcac taccttattg atgagtgatt cctgctctcg
    63961 aatacatgcc atcaccctat tataaccaga ttcagaaacc ttttgaaaat acgccttttt
    64021 ccgagccaag acttcctgct gaagattatg agtttgaagc atgcaattga tcgtgttcag
    64081 ccttcccggt gtttctgtcg tctgtggatc ccgaatgtca tgcaacagac tcttaatttt
    64141 atgttgaacc tcatcttcct cagccaatct tttaaatatt ggactttcct cgagattttt
    64201 aatgctcaga ccagtgacaa gatctatcaa cctcgaagga gacacataaa tagagccaac
    64261 gtacaagcgc tcgtcatgcg tgagcaaatt ttcactcaaa gccaagaagt cttcagagac
    64321 ttcaccgtaa agataaagac taacatcatt ctgtaattgc ttatacaacg tgtgacaact
    64381 atttaactgc tgaagcgtaa tagcaacatt tcttactatc gtttctgata ttttagacca
    64441 atacgtaaac tcacttaaag aatatatcac gtcaggtacc ttgctaaaaa tattatactt
    64501 tttcagagtt ttctcagcat cactaacatg caacgattcg gctgaacgct gctgcttaaa
    64561 aatcttcttg atttcagtca caacagactg aatagtccca tagttcaaaa tggcctctcc
    64621 taagtctttt tctatcgtct caatattttt ttcaatatta aaaaaagctt tttgctcggt
    64681 caaatgatta cagaactttc catgtaatct tttccgaagt gattttcctt ggtttggagt
    64741 caaagtcaat tcttcataac acttcatgca agtcttggtt tcgagataac tctccggttt
    64801 cgcaaccata catgcgccac acatgatagt tagcaagtct ataatttttc cgcaaatctg
    64861 caacccttct tggggcagaa gtaaagcata tacggagttg atcttactga ttaattgttc
    64921 tatatcattt agcgtagata attgcacgat aaactcaaca ccgttattta atgaaatgtt
    64981 tattgacaag tgctcagcac aacgtttcaa acacaacacc ttttcaaaat atttttttct
    65041 atcctggtct accataaagc tttccaacgc tgcatccaaa agaagcacct gttcatacat
    65101 agcttttagc agcacctgca tataaaccgt caaagctgac gcacaaagaa gattctgttc
    65161 tttgatacct tcaaaaaaag tttgatataa atgcagaatg acaatcccat tctttttgaa
    65221 atttgccata tcagacaata ctattacagg atcacaaaac tttaaacatt caaggtccaa
    65281 agcacattca ttaagcctag cgcacaacac acacagagat tgtaacgaat tcatactctg
    65341 attataatcg gtttttctta gtcatcggct catccgtttc ggtttccgtt tcatcacatt
    65401 ttaatacacc gcttgcttga tcgtcctcct ccgctagaat ttcagaaaag tcatagaccg
    65461 gagcatcgtt tgaagacacc gcctcaaata ccgactgcaa attagctatt gaaaaatctc
    65521 tcacattcat atcaactaag tgattcagtt taagcattat ggatgccgct aaagcttccc
    65581 taccatccac aaaaaaaagc atatcatcca tagtcggctt gtcctcccta tccctcatca
    65641 cctcagctat tattaataat tctggatcaa tatcgttagt taaattctca acaatgctga
    65701 gaaccttgcc cttgaccact tccgtatcaa acataattgt ctcacgccga acctttttca
    65761 ctataacttc tgagaacttt gtagcaataa tcgttttctg cctcataaat ctaaaatctt
    65821 gcaatgcaga agaggtaggg tttaagttcc tatccacgcc acttccacct atccaaccta
    65881 actggccaaa ctgaaaatat tccctattag ccaagctcac aaatttctct aatgtcaaac
    65941 caaatgtaac caaagatcga cttgtaaaaa ttgtaccaaa attgggttct ttggacagtg
    66001 acgcaatcac aggattcgga acgccatcca aaactaactt tttaacataa actaaatatt
    66061 cctgaataga agaaaattta ggctgcttgt ctaacaccac aggaaacaac acaggattct
    66121 gcgtaaccag cttagatgta agaccatgta agctagtcaa gtagtcatga aaacctaaag
    66181 ccgacaaaaa cttgttatga aagtaacaat ctataaaagt tgagagacac tctggctgta
    66241 tgtcgataat gtctatctca tcataggtat tcgtaatact gaatgcaaat ttgataaaag
    66301 tcttaacttc ttcggggtta ccaatatcta aagttttcgg aacattgttg agcagaaaac
    66361 gttgccataa ctctaagcac gaaattttga cattcggaaa caatttatca tgatatttaa
    66421 ataaaagaaa ggagatacag ccagacaagg gattcttctt gtgtttcacg ttctttttaa
    66481 aataagggtt gttgtgtgct gtcttactgg acttgttgaa cggtctattt tttattctaa
    66541 aatctcgaag acattgcata gacaaacggc aaagtttcgc ctgaatcgta gttttcacat
    66601 atttacccga tttatataga tcgcaatcta agatctgctc catatcaaca ttcgaagcga
    66661 ctttaaccgt tctcgtattc agaaaaccct ttttgagata actgctgtga aacgttccgt
    66721 acagtgattg atactgctga acgagccatt tagaaattga attaccagta caaggtctgt
    66781 cgacaacatg acctgaagcc actatcaatg cgaggttctg caaaaccgtt aaaatgacct
    66841 tataatatgc aaacgtcaaa aaaggagaaa atgcagttgc ataaggggtc gtatctacat
    66901 taaatgattg tagacaattt tctatctgtt ctctaggcgt ttgtgtcctt ctcatttcaa
    66961 caatgcatct agaaacacat tcctcgatac attgtgtcaa tccgtggatt atagaaacaa
    67021 aatctttttt acttcggaca ttgaaagtat cttcgcctgt tacaggatca atcagagaat
    67081 tttttttaca gtaatcgaag atctgagata caaatttacc cctgtccagt gagagcgtgt
    67141 tttgttgatc ttttccaatc tctttgagct cgctgacagg cttcctgcca aaagaaccta
    67201 atatatcaac ctcggcataa taccgagaaa acatgctcat aacaagtggt tcctttttaa
    67261 cattttttgg tattgccggc aaacgagtac caacccgcac catggcagtt ccaatacacg
    67321 attgacaaca tttcccatca cagaattcac ataaattcgc cgaacaattt accagatgat
    67381 tgtaaatttc agtgtacgca ttacccgcgt tataaacgct catacgattt aaattccaca
    67441 ctacataaga aagcagctgt gggcaagtcg cacaggcata agccaagtga ttagctgaaa
    67501 atttgtcatc tttgcctgat gtcgaatcac atttgatgat ttttctatta tcgttataca
    67561 catcctcagt caaagacgac aacgcattac aaaaagacaa agatcgcagc agtaattctt
    67621 gagtcatcac cgaattaaac gcttgtttca cgtttggtat aaatgccaat tttgagcaat
    67681 ataagataga atttggcgca aagatcaaaa cggcaagatg actagacaga tgtaacttta
    67741 aattcgtgag ctgcgccatg cgttcagcgt gtgtctctga gtttcttatg attggccagt
    67801 cattgaaatt cattatctga ctggggtcat acaccgaatc caggtattcg gctacatgac
    67861 taaacgataa ttctgtcaca acggaatcaa ccaacatcaa aaaatctttc tcgaccgctg
    67921 aaattttctg tccggagata cccagataag ttttgtgggg tgctaatttg acagtttgct
    67981 ccccatcctg tgtaaattgt ttcaggccag catcgattaa ttccttagta ttagaaaatc
    68041 gtaacgttgt accccatgat gtaaaaacat aataaaaaag cgtttcactt aacgcaggca
    68101 gaaaaaatcc tcgttcctga ataaattctg tacaggaaga taaagaaatc gtttcttcag
    68161 tttcaaataa agttgcagag tatagaggaa ttttcacaca cgaatactcc ccaacttgta
    68221 cttgaatttg ttcttcaaca caaggaatta acagaccagc gaacaacaac tctttgaaac
    68281 cgtttccaca cgcaacatgg caaataacag aatctgcatc tttgccgaca gcagaacaaa
    68341 gagctttgat atcgattact ttgcgtgctg taggcacctc aaacgactgc aagtgaaatt
    68401 tctgtctggt ttgctcacat aatcgaataa gatcaccatg atcttcggcc ataccaacta
    68461 actgctcagt tccatggaaa aaaaaacaca cgggcataaa agacgtaatt ttagttagaa
    68521 ttgtgcctcc aaagttagtg ataggtgttt taaccgtggt cgagaaatcg ttttctacag
    68581 tcaaattcat taacaacggc gaaataacta caggagaatt tctctccatt aacgataaaa
    68641 cagataaaac atccaaaagt tctttctctt ttggaaaaac atagatccaa gcagcagtag
    68701 aaacaggagc agaaaccacc gtttcgtttt catcagccat ctttgtggat tcgatcacaa
    68761 aaacaaagat aatgggtttt tgtggtgaaa tccttatata ttatgtttga cgtaacataa
    68821 cacgcgtcat caaacataaa agtaaaccac aagttgaaat ataccgtttt ctatatgagt
    68881 tttacggaca aaagaaaaac gattttctta tgcaaatatt ttccacgcag atgacatgac
    68941 acgcccctta atttaaattt atgtaaatcg tcgtccacct caggtacaat agtatattat
    69001 atatatagtt ttttaataaa cttattgagg acgggagaac gaaggcgtgg cgtttacgtc
    69061 atagcctaat tatacattct cagaacagga tttaaaaagg ctgcgagcgg ccggctgttc
    69121 agagggacgc tggggtacga cttgagacgt ttgactgaaa atgatccttc gtgtactatt
    69181 ttctacaaaa aaattaattt gccggcgaca gtaaactttt cagcggaatt tcaaaaatta
    69241 attccacatg taatttaagc attttaaaac gtataactca caaggtgaaa acatatttac
    69301 gaatacagta gttttcgtga tattttttaa aaattaataa attttaaatc gtgtaagtaa
    69361 taaagcatac tattagattc ttcacgttaa cagagcaagc tcttcgaggt tttcagtaga
    69421 atttcaatat ttaattccac atgtaattta agcattttaa aatgtagaat tcacaaagtg
    69481 acaaaacatt cacaaataca gtagttttca cggtattttt gaaattaata aattttaaat
    69541 cgggtaaatg gtaaagcatg ctgttaaatt cacgttaaca gagcaagttc ttcgaggttt
    69601 gctatgtgtt tatcagtgaa tgtatttagt atttcaattt tagatcatgg ttcggtaaag
    69661 atataagtcc gtgtaaaatt ttttggttta gttttcatat ctactagact gtgaggtgtt
    69721 tgaagtcgat ggtttagctc atgtcaaaac gcaatgtcaa attgtaataa gtcgttcatt
    69781 tcgtgtttag aaataaggaa ttggtattta gaatagcttt gtcgcatttt tagccgcgac
    69841 gagaaggtta tgacgacgtt ttcgattgca ttgtttgaac ctttttcgga gtttgaattt
    69901 accgtttaaa gaaaaacagt ttcacgaata gaatctaaaa caggcttcca aattttagtt
    69961 aatatttatt tcgaatttca cttggggtac agaaagcttt ggcatcgaga tttttttgat
    70021 tttaaaaaga aatagttcag agtgtgacag caaaaacctt tgtacaaaac atacttgtaa
    70081 gaatttgttt acagtaagat agttattctg agtcagaaga atatgtgttt aagttagttt
    70141 cacaggtgtc agcttcatag tctaaatcta agtccatttc aacacttgat tcactttcat
    70201 gtttagagtt gacgttttca ttaatgttaa taatcacaat ttcgtcttgt tttgcttgat
    70261 tgaagtttag ttctctagga tctggtattt tgttgtcggt ttccattgat tcttctatga
    70321 gaatttcggt agttgttttt gtcgttgtta ggtttgaggt gtctggtttt tcgacgcaaa
    70381 ctttggattt aaccttaggc gtaccttggt ttttatgtga acgatgagag gtctgaggta
    70441 ggtcgcgact tgttgaatag ctgcatgaag gttccatgtc gacctttgga caagtaaaag
    70501 aaagatttcg gtattcgtga ggaagatttg gaaacagctt aaactttggt gcgtctttgg
    70561 cgaaataagt gcagaaaaat agacttggtt tccaaggagc catgattcgt tcgattctat
    70621 tttgacagct aacatcatcg catttatggt tgctgaattg ctttccgatg agcctgctta
    70681 tcagaccgca ttcgtatcgc tcggctacac gttctgtgtc gaaatcgcgg atgaattgcg
    70741 gtttctttgt tcgtatgata tgttctttaa tttgtcgtag tattcgagcg aacgtcacaa
    70801 cgatggacat ggcttgttga attgggtgtc taaatgagtc tggagtttgt tgttgtactt
    70861 caaattcgga gtttggcatc tctcgatcta gtacaggttt accgcagagt tgcctgagtt
    70921 ttcggtattc gatgtcgccg tgtccgttgt cgttgaaaac acaggttaat ttcgccatgt
    70981 tgagtttgtt gaaaaattcg aatttcatga cggtgatggt atacatgaat aagtcttgtg
    71041 ggttgaccgg taggttgtgc agatcgtgaa atttaaaata actgcaggct tcttctactg
    71101 tagcaactgt aaaagcaaga caaggtgagt tggtcaggga gaatatccgg tcgcccatta
    71161 gttgctgatt ttcttctcgc gtgagcgagt cgagacattg tcgatagcga agcagcaggt
    71221 cggtttccag tatgtcatta gttaggagac aaattcgttc atgcgtctgt ggaaatctgt
    71281 ctcggatgcg ttgttttgga tcacgggcgt ctccgttgta aggtctcagg ccaagagatt
    71341 ttatcgaaaa gtttgtgtcg gcaaagggga ctgttggaag gttaggcaga aaggtgattg
    71401 cattgttttg agcgcgtttt tcttgttgtt tctcttcgat gatggtcttc agctgttcta
    71461 actctgtcag acttagtgcg tctagtctag attcatccag ttgtttcaga ggtgcgagtt
    71521 ttcctcgaaa atttttggcg aaatggctga tgaacttgct ggttggtcta tgcgtgatgg
    71581 aacgttttat cgttctgaag gcggtttgtt tatgacgatc atgttgtgag cgttttactc
    71641 cacgaggata catgtttgct tataataaat gaaatgacat aaattggcct ctttatatgt
    71701 tttttgagat gctttccgtt ggcgcttttt tgcggttaag ttgtgtgaaa gaacgaagga
    71761 cggtgttgct aatgctttaa tctccggaaa tgctgtgata tggcgcgatt tagttagcat
    71821 gtgcgttgga gtcaaatggt aaatactaaa agaaggtctg ggtttatagg tagtaagtta
    71881 gttttttaat tgctctaagg cgatggaaca atgtacttgt ttgctgttgg actggcattt
    71941 agtagcaaag catgtgctcc acaagatgag aattaaccga tttccgtcgg ctttgagttg
    72001 tatgtaaact aggacgttat ctcgatttcc tctatgttgt ctgttcaggc agctaaaatc
    72061 cgaaactctt ccaaattgtg tttttttgat ctgaaggttc tttgaatcta ttttgagaaa
    72121 agttacttgt gaaaactgtt gcgctatcct agtctcgtaa tgagtaatta attgcgtttt
    72181 aatgattggc catccgatta atctaataaa cgataaaagg gagtcatccg ctgatgttgc
    72241 attgttgtta aaaccatgcg tgttcaggta cttggtgatt agagtgtctg tagctatgtt
    72301 aactttgttc cacagttgtc tggattttaa atccatgaaa cttaggtttt ctttagggca
    72361 gcctttatcc gttatgctat agattaattc ttcgatggga gccttcttag taccgtgatg
    72421 tagaaggttg tttaaatcca tttgcatctg aataaacgtc ttgcaagaat ttcggtaacc
    72481 ttctgggacg ataaatatgg gagttagccg tccatgtagc attttccctt tgtccatgtc
    72541 tgtcttgtac atatagccta ttctgatgca gtgacctgtg tggtaaatgc cgatgtcgaa
    72601 acattctccg ggaaatgtta gggaattgag gatctgacta agctcttgat ctaaacacat
    72661 aacgtgattt aaaatcttgg ataattgttt taatggttct cccccggcga tcgctgtgcc
    72721 attaggtaat gggattgata ttctaagacc gatctttttc cgacaaatac agaattgttt
    72781 gatttcggtt ggatcttcag tatagtctag tgcgtcgtta gtcgtgtcgc actgggtttt
    72841 gaagaagaag atgggatgtg tgtgtgtgtc gatgcttgga aaaatttttt tccaggcgtt
    72901 gatgagggta agtcttatga ggcgacacat cgagaaaaat gtttcctccg taatggttgc
    72961 tgtatcttgc agcggaagat ccaagtctcc tatgtaattt gtgactggta tgcgttcgtt
    73021 gaatatttcg tgtcgtgtag tatagaattg tttttcgaag tcgtcgcaga gaaaatgtgt
    73081 gtcttgtagc cagatggcgc gagttagagc ttcatcagag atatattcgt cggggagata
    73141 ctgtaagatg cggttaaatc ccatgttttc gtaccaatct tcagagttcc cgaagcaaaa
    73201 aatattttta tgtaaaagct gcactctgaa tacaggaaag ggacggtgat aatctttgtg
    73261 taggtgttgt cttctgtaga tgcgcttatc ttgtatctga acgtatttat cggaagcgga
    73321 gatttctaat aatccttgta atcctggttt tactggagaa aaaagacctt ctccgttttt
    73381 attacatttc gctatggcac gcgttatttg ttcggaagtt aatgcttgga tggtcttctt
    73441 tttagaggcc agagcatact cgtattctgt aacgtttaga tctggatttt tcagtctttt
    73501 tatatcgatg tatgttttaa agtaacaatc cgcattgaag tattgcttca tgatacacag
    73561 taaattttcg tgcagggaat ttccaagaat gtggacattt ctctggcatt gttgtcctat
    73621 tggtaaatta gagtcgtaag aagtgatatt gcagtaattg acgaattttg tcgtctctag
    73681 ggccgtgttg taagcgatat atatgtaatg gacacggaat gtgttggtta gatgtgaact
    73741 ctttctaaat agattgattt gagtgtctag atatttaaat tcttccttat cgcggagatt
    73801 tttttgtctg gcgtacgttg cgaagtctgc aaatagtttt ctaaattttg atttcaaagt
    73861 aatgtttata aattcggaca tggaagaata cgtgaacacc atgcttcctg tgttttccgt
    73921 aaagcattga acataatttt tggtagttgt gatggtgctc ttttgttcct cgaacaaata
    73981 gtaatacatc gttaataaaa gcagaccttc tgtttgcccg taggtcgata gaaaccaaaa
    74041 gggggaagtg ggcaatagga atttaccggt gagatatttg ataatgagcg atttgtggaa
    74101 ataggccatg tatttaaatt cgacgtcctc tttttctttt ccagtttgag ataatatcat
    74161 gtcgacatat aacaattcgg tttctttgtc gttgaggctg ttggcaacat cttcagcctt
    74221 tatcggactt gcagtttgta tgtagtggct gagatttaat ttctcggcgt ggcagacgaa
    74281 taccgtgtcg attcgctttg aatttttgca tttttgagtt tgaaggcaga agctgacgtt
    74341 atttgatggt ttatatttaa caataatcgg aaagattaaa tgttcactgg gacttctaca
    74401 taggatacta aaaatgacgt ttgcggcatc gtattcagtc gcaaacacta cgatggtcat
    74461 tgtgtagagc tctgttgatt acagatgaat ttggctttaa atgcccttag ggtattgggg
    74521 tgttatggga aattgttttc gacgattatc tctgtttgga cagccgactc aggcaaatta
    74581 tgagatgttg tgctcttccg acgatttaga aagtgaagag ctgacgtatt ttctggatat
    74641 gacgtataaa gattttggag tttatcagaa tgatattata agtcatcaaa aagacacgga
    74701 aactatgaaa actctgttag gtttattacc aatgtacaaa aaaactaagc tcaggcatac
    74761 cattatggag cgatgtttat ccaattgtcc taaccacgtt aaagatgcac tctgtgtaga
    74821 gcttatgaaa gctgaaaaaa tattacaaac gatggatgtc gtttttatga aaactttaat
    74881 tggcgagttt tctatgtgca ccgataatct taatcagttg cttaacaaat tcgctacaga
    74941 tcagtcaaca cttagcgatg tcgagaaaat aaacagtctc atagagattg atggcgaaaa
    75001 cagcaagcgt cttttagtag agttggatcc gattctccat gaggagacag gattatatca
    75061 agcgctgcca aatgttgtga cggaagctcc gagtgaaaag gttaaatcga tacacgtcga
    75121 gtctgaaggt gagagtgtat ggtcaagcgt tactgaaggc ggcataatga aacaagaaaa
    75181 aggaactggc gtctagtacc tgtagccggt ttattgcgcg ttcaggcatt aaactgaggc
    75241 agaaatgtcc gcaagtaaaa attattctgg cgatgcagat gcctgtaggg atgtagatag
    75301 ttttgcgtgt agagttgaag atctttatgg agggaattgt gtctttgttc cagatgtagg
    75361 tttcaatcaa taagccgagt ttgataattt ctttggaggg aatcatgaga gcctttagtt
    75421 catcggcgca aacgtacatg gcgtcgaagc attgtatcgt atagctgttc ggtttaatta
    75481 taaattctct gcatgtcttt agatggaaaa ctgcagattc ggggggagac agattgatca
    75541 tctcccatgg ttccgggatg tagcaaggga gaaagttgat tgagaattcg acatctcctg
    75601 ggagaagcat tagggagtgc tcggataagt tcattagaaa aactgaaatg tcggtttcgt
    75661 cggttataat ttcagtgatg cattcgcaga atacgtcgtt gctatggcca ataatgactc
    75721 cgaagaaacc atccgggatg cacagggaaa tatctagttt tacgattcga acttgatcgt
    75781 gcggcaccca tatgagttct ctatttacga gtgtgatttt gttggcgtcc ataaaaacgt
    75841 ccattttact attcctgtga tggcttacta agatagatgg ttcttccgaa atacaagtgt
    75901 ccgtatttgc atttcttttt gcgcggtgtc ttgggtagaa agttactggg ttgccatgtt
    75961 tccttacata gttaacacaa tcggtttctc tttgcttttc tcttttgcag gtcttcgaca
    76021 ctgttccatt ttgcggaata cctagaagcg agattgggcg ttgataagag gttagttcgt
    76081 tttctagaaa ttttttaaat gatttctcat ttatagctgg ccacacatcg tgcgttttgt
    76141 cttcagatat gtctgtagtc caaagttcat tgatgtccac gtttcgaaag acgaaaaatt
    76201 caatgtatct tgagctcgtt tgtctctgta gggtaatcgt ttcagagatc ttttctgaaa
    76261 ttacgctgta catttttcca ggtgacagag ggctgtctgc tgttaatcac gtcgacgcga
    76321 agactagttc aaaataacac ttaagatgag ttgtaagaaa ggcgcaaggc aacgcttata
    76381 tgtcagtctc tggctctttt acattcttgt ttttgcggcc gctacggaaa tggactttta
    76441 ttcttcagag tgccattcgc acacctatga gatcgtcttg aattcatttt cttcgatctg
    76501 gcttttgata aatctttttt tactcttgtg ttcttttgcg attttcttga agtactggtg
    76561 ttataagact tttgcttcag agacggtgaa gggctattag atcgcatgag acgcctattc
    76621 taattataaa tgtagcacac gacaaataaa agcatttttt gatgtaattg gatcgtgttt
    76681 tattatctcc aatagatttc ataacgacaa aagacaaacc tgatttcaga attgagtttt
    76741 tattgaagac tgaggatgag tagctttgac aaacgtatgc ggttatgtgc tatctgtgtt
    76801 gtttaaatcg tgtcgttcgt tgtatgtgta atgcgttgca ttttgggttg agtatgcttt
    76861 ggtagtgagg ttatctggat ggttgtgtga gtttttatcg gtgacgcggt agtcgtttcc
    76921 aggcagagtt ttgttagctt cccgactttc tgtggaactt ttttttttaa cgtccgtaga
    76981 tcgttccgtg attgtttggg ggtagatgtt agtcgtttgt gacgagacgt gagcttttgt
    77041 tagtttggct gattgagttc tgttgctagt cgttagctgt gttgtgatat gatttgtcga
    77101 ccttagactt gtattcgtta atggttcctt tggcgttgtt agtaagtttg accaggttag
    77161 aatggcagac tttgaagatg tcgttaagga cgtttcagcg gtgaagggcc attgaggtgt
    77221 agtcgatttt tcccatgtgt gagcgttaag aattggtgtc attcgtggta tttctgtgtg
    77281 gttgatctct ccgtgagtgg acgccgacat tctattttgc tttggttctt cggtgacttt
    77341 agtgattgag tgtgatgaat tactagatgg taaagcattg ttagttacct gtacttcagt
    77401 tttggcagtt acatttgacg gtagtttttt ttttggagtg acagacaacg tctgaacggt
    77461 aggtggctcg cttgaggatt tcaaagttgt cctctggaat ctgtcctctt tgaaggtttt
    77521 gacggtctgc acttctgtgc tatgggtttc gtttgcgtat tctgtttggt tttttacgtt
    77581 gagaagttgg gtaggatttg tgggttcttt aggcgtgatt cccatcgttt ctccaagaga
    77641 aattttaata aaattttcgg tcatgttttg tacttccgtg ttgtggctca tgtatgtgcg
    77701 cgccgcgtct tgccaagtgg taaactttaa aatcggagtg gtgtgttcgg tgtcggtgaa
    77761 ttttgtcgtg ctctgctgtg atttgctctt aagataaata gagttttttg gtgaagaata
    77821 gatattgtcg ctaatttcct cgattcctat tgttgttgcg aaggtggtgc tttcgagctt
    77881 ttgagtcgtg tttgttgcca ctgtagtgct ctcaaacgtt tcgggaattc tgattgtggt
    77941 attttcaaaa tttgttggtt ttggtggact ttttgggttt tcggtagggt tttcggtgtt
    78001 ttgttcggtt ttaatagtgg cgttacgacg gattgtaaga gttggaatgt cagtcggggt
    78061 gtacatcggt cgaggaaaat ctgaacgttt aactactttt ttgatgcttt ccgttgtttg
    78121 cgctgttatg gtgggtgtgt tcggtgtaac ttttatggtg tctgtctgca attctgtaaa
    78181 gttttttgtt acgggggaag gttctggggt tggtgtgttg gtactaggga tatgtggtga
    78241 tgtgatagac gctgacgtcg atgatggcgt cgatgatggc gtcgtagtca gtatcgaatg
    78301 aaagtttacg atggctcgtc caaaggaagt ggtaacattt ataggttttg gcgaatgttc
    78361 gaaatattga tcatttgaac ggatgcatga tgttgtgtta tagagcaaga agtaaacaaa
    78421 gctggtgtaa ttaaagaaga tttcaggagt gaacggagtc aatgaccgtg tcagattcga
    78481 gttggaaaat ttactgattg ccatctgcaa ggattcgtcg gtcagtttta tgtcaaataa
    78541 ctgtgttccc agaattttaa acggtagtag ctctacgcat ggtggatctg cggtatatgt
    78601 agatagtgtg gcaaacagaa gataaaatag agaaaaactg ctagcgacga tagatttgtt
    78661 tgcagctgtt gaggatagca ctattttggt ttctgcccgc ggtaaattct gtaatggaga
    78721 caagttaacc gcagacttgc attgtaaatc tcgaatgttc caagagaaaa cgttagttaa
    78781 aatttgagtg aagcagtcga gggatagatt tctctgacaa aaagttgtat acaagtttcg
    78841 gaggtcgtaa aaatgttctc tttgttcgtc gctccaattg tggcggttga cggttttgaa
    78901 agcttctaag ggatcagatg tgtattttat tagattaacg gagtgcatga ctatcgcgaa
    78961 aagggccaga aaaaggccga gtcgcgagat gtgaagcatg tcgggtgagt tgaccacagt
    79021 gaatttttac aaggagaatg tgtaactaaa atagtatttg ctttttttat agggttggac
    79081 gatgacctcc aaatgcatgc tgtgctggac tgcgattgtg aatgccctgg ctatcttaat
    79141 gttcttacta gtaatttatc gggcgctaat cggatttaat gacgatattt tcacgagcac
    79201 gttgtcggcg tttagctgta tacggacaaa tctatctaat gccaaatata aataaaacgt
    79261 ttattcaaca caatctgatg agtctatata agccgaataa agcaattatt gcgatcagaa
    79321 cataaatgat aaccaatatg atagatactt ggtctatatc gattccgact tcagacatct
    79381 caaaaacaga gccgtttttg gctaacaaaa ggtagtgcgt cctggtgttg ggaacaagta
    79441 aattgttgtt gggatcggtc agtgttttta gttcgtctat gttttttatg tagatgtatt
    79501 gtaagggacc gtcgatatca tcatattcca tgactacgct ctgacaaaac tcgcatgttt
    79561 gagatgatat gtttcgtagc acaagcagat cttgtcctgc atatttataa tttgttgaaa
    79621 cgcaggtaga attgagaggt atggctgtga ttattatact cgtagccacg attgtcgttg
    79681 taattgttaa actcactcct ttaatcacat aagagggaga aattacaaat gtcacattcg
    79741 gcagaggcag agaagctgct ggctcacttg gagagagaca ctgaatggcc gctactctcg
    79801 ccatatctgg cggtctgtat acggatagca tctccatcat gtctgatcga taacggtcga
    79861 gggaagcgta cgtgagaact gtttttacaa aagaatttgt tacatctctg cgtacgggag
    79921 aggcacaagg cgaataaata ttttctagat tcggtgcctt gtcagctgta agcatgtggg
    79981 cccatgaaac tatttctacg gggttacaca ggtttccaat tagtagttgc atgtgcctct
    80041 gcatgcgttc atcggcaggg atgaaattcg ctatttcggc tagcatgaat agagtttccc
    80101 tatcggaaaa tgtcagattc gtaaaaaaca tgtgtttttc atagatcttt tgtagagtgt
    80161 tggcaatgtc agaccacttg tacctggaaa tcgttacatt ggtttcgtac gctgtcgcta
    80221 agtacgtgag cagcgtagat acgggaatgg atttgttttt ggtgatgtag ctatagtccg
    80281 agggctcgta ttttaaaaat tccttcattt ttgggtattg tatcgtacct tccgagacgt
    80341 tcacacatcg gttgacaaat gagtcgatgg acaagagatt ttcgtgtgtc tttaacactc
    80401 ttaacacggg catcggtcct gtgttttttg tgctatatga gaaatgtacg ataccgtaaa
    80461 gaaacatcat ctgcggtatg ccggcatagt cgggtttttt acagtctccc cttaataggg
    80521 tttggattcc taggttatta aatttgagta gtagagcttc tacttcatct acgtcatcca
    80581 acgtttcgtc tacgaatgtc gcatctgata tgaaacggta ttcttcatcg actacgtctt
    80641 tttcgactat caatagtaga tcgtctgtca atgtctgttt gaatatgaat gaacttttcc
    80701 tataaggggc tttaaagttt atgtcggtgg tatttccata catcatagtc agatctcctg
    80761 cgggattttg gatgtacagt atcataaagt ccggagtaaa gaaatgggta tagatgtttt
    80821 cgcccgcata gcgtgtaatt ttagcgcatc taacttggac tggaaagatc agttcgttga
    80881 gagaattagg cagcttacag gaaacgttgt cgtattgcat ctgtcggact tccacaaccc
    80941 tgatgtaata aattccgtgt gaagggtaca ggtttaagga atagacaatc tgcggttgga
    81001 tagagtgatc caggttaaat tgcttgaccg caggtacggt agaaagtctt aaaatatcgt
    81061 tcattggcgg ctcatagaaa cgtgtgacgc gtttttcata attggttaac gattctgtcg
    81121 tgttgatggc atcaaacaga tggtacgtga tatcggatcc gagtaagcat ttagggactt
    81181 gatatatccg agtgtcgttt tttgtataaa agttaaaagt tataaagccc gggcgaacaa
    81241 ttggattttc agagtttcca tttttacaat ggctctcgtc cgatatggtc cacggtctcc
    81301 aactgtaaca gggagtcaac agaacaaaga cccagagtcg gaagagcata gttgttcttc
    81361 atcgatgaaa tgtgaaaggg ttctgctatt ctttgaaagt tgaacacttt ttgatctttc
    81421 catattaaat agattacaaa aatgatgtgt tatggaactc ggaattgttt ctaaattctc
    81481 cgcgtctttt tttccccgtc aaataacatg tctttgacag gtttgcctga tattcggaaa
    81541 aaaattggac agtttcacca tttgaggatc tataagcaga tcttatcttt gcaaggaaat
    81601 tttgcgcgac taaattattt tttaggagat gtgtttccgg ctaatttgcg atcggcatct
    81661 gtctcggtgt ttttcgaggt gcgtctaggg ccacgcattc cggattgtat cgtcttgcta
    81721 aagagtgtag atgccaaaga tgagtttgct tttcattgtt atttttttga gtttaagacg
    81781 actttgggga agtcgacgat gcagtctgtg catcacaact gcattcatca ggcgcaatat
    81841 ttgcaaggtt tgagacagtt gcatcagtct atttcgttct tggatcaata tttaattgca
    81901 gacgaggttt tgtggaacgt tgttcccgta atttgttttt tcaggcagtg gggactcaag
    81961 ttagattttt ttaaaaagtt ttcggggaag accaagcggt tgtcattttc gtttatatgt
    82021 gatttgttcg ctaggtctca ggatggcgca gtgcaatctc ttttatcaat acccaattac
    82081 accaatttta gaagggcatg tcagaaacat actgatttgt acagaagaag atatcagaag
    82141 gcttcaaagt cagtcctcac taagacttcg ggagaaaata gatcaagggc atcgcgacaa
    82201 gttgctaaga atgcgcctaa aaaccgaatt agacgcactg caaagaaaga tgcaaaaaga
    82261 cagtgacgtt ttgaattctc atttaaaagc gatagaggat gctttgctgt ttacgaatga
    82321 tggggaggta aacgtcgaaa cgaaagctga tacacaactg ttaccgaaat ctcctgagag
    82381 gctggaaaaa tttaatcaag ttgccataac cccactcgac ccctttataa gatttacaga
    82441 cgattttaga ggagaaatga tcaatacttt tttcaataat gctcagatgt ggaattttac
    82501 gttcgggtct tggttttata agctcaagag ggttttttac aatgagcctg gcttaagaag
    82561 ggctttaaaa attactaatg tggattcttt gactatttcg aaagagttat taacagttac
    82621 cgtcaatgcg ttggagcaag cgacggtgta tcctatattc ggaagtgaga tgtcagacct
    82681 ggaagcagcc ttgtgtatcc tggcagcttt ttattccact tatgagaatt cacagatcga
    82741 cgaacgtaca accctagtag atattataac ccttctgccc gtgatattta gattactcgg
    82801 tagtgaaatt acagcattga aaaatgtctc tccttctggc acctattttg gatttaatga
    82861 tccttcttgt atgaaatttt ttgttcccat gagaaaaggc aagcattatg cagaaaacac
    82921 atttgggaat catgtgcttg taaagatgtt gctaggtaga ggagtgatgc aaaaaattcc
    82981 cggtgagaaa gacagccaaa attttgatgt tgaagctcgc ttacacggag ccattaagaa
    83041 tgatgttctg gtgtattgga cgtatcagct aatgagacca aaattgggaa ataatgttcc
    83101 aatctttata cacgatcaac attatttacg gtctggcttg gttgcaattg aaagtctctt
    83161 tttattgtgg cggatcttga actcagaaag tttgtttaac aagagagttg ggaagtttct
    83221 cctgacttcg atttttccac agctggagaa tgttgatttc gccgaaaata actttgaagc
    83281 tggaaatatt caaaattttg aatacttaat gcaccattac gttgtgccta tgtacaacct
    83341 gcagaatgac atatcaattt cgactctttt tcccggtctc gtggccgtgt gtgtaaatga
    83401 gagtgtgaga ttgggatggg aacataagtg tgcaggggct ccgtccgatg ccgttcaggt
    83461 tcaatctaaa gaaaatccgt tcgtggagta tatccgcgca caaatggaac aacaggcgga
    83521 tgtggctata cttgaaaagc atgactgcat tctctttcat tttgaaaacg gtttaaacat
    83581 tactctatct tttacattac cgagacagag attgtttgca atggcctctt cattatttaa
    83641 tgtaaatgat acttatgatt tcatctattt tctagtttta ggttttctgc caataccggc
    83701 cattatataa ggcgggatgt tgttgtgttg attacgtcaa tacggatggg gttttgaata
    83761 taaagactta cagagctttt aatgaatcat tgcttcgttt cttcgggatg gagaaagaaa
    83821 caaagtcttt ggcttggcca gccactgcgg agttttatgg ctgggtattc attttttcgt
    83881 ccatccagtt gtgtacggtg gttttcctga cggttagatt taatggtttc aaagtcggtc
    83941 gagaatacgc tgtgtttaca tttgccggga tgagcttcaa ttgtttttta cttccgataa
    84001 agatgggatt gctgagtgga cattggactt tgccgcgaga tttttgcgca attcttctct
    84061 acatcgatga tttttctgcc tatttctctt cgtggtcgtt ggtgtttatg gcgattgagc
    84121 gcatcaacta cttctgttac agcacaccgt tgttgaacga gaattccaag gctctggcaa
    84181 aggtgtgttt cccgatagtt tgggtcgtat cgggagtgca agctcttcag atgctgaata
    84241 attacaaagc cacagctttg cagaacgaga ctggacagtg ttttctcgcg tttttaagga
    84301 gcggacacga catgtggtta atgttggttt attcggttgt gattccagtc atgttggtgt
    84361 ttttttacct atacagcaaa aatttcatgc ttttgaaaga tgaactttcg tccgtgacta
    84421 cgtatctctg tatttatttg ctgctgggta caatagcgca tctgccgaaa gctgccttaa
    84481 gtgaaattga gagtgacaaa attttttatg gtctgcgcga tatttttatg gcgcttcctg
    84541 ttctaaaagt ttattatata tccgctatgg cctattgcat ggcatgtgat gatcacaccg
    84601 tgcccgttcg tttgtgcagt atctggctgg tcaatttatg taagaaatgt ttttcgtgta
    84661 cgcggcgcga aaaggggtcg gatttagagg ttggaataaa aatgttaaaa tgagtaagga
    84721 gtttatcgtt tttattcata agagaataga tcttcggcgc tgattcctgt aaggtcaaat
    84781 atggcagagc tgtcgagtaa ctgtgggttt tcagacatgc cgcagaagac tttaaagtcg
    84841 ttttggagaa atgaaaacag tccggctttg tgctcggctc tttgctgatt gtacgccagc
    84901 gtggatatct caaattttcc aaacattata aggtaggcga accataggtg tttgcagata
    84961 agccgtactg ctggttctcg ttcttgatcc ccccaaaatc ggttaaagaa tctgcagatt
    85021 tttaaaagtc ggtgattata gatagctcca acggagaaaa ctatattgcc ttcgcagatt
    85081 atttcttccg gaattttgag acttagacca aactcgtcca tgaagagaaa attaattatg
    85141 tgactgacat ttccgctgta gtgcagcttt tttgaaatat atgctgagtg actttcgtta
    85201 aacatatgtc ggagtagttc cgcgtcagaa tgctgtttca gaatagaaaa tagtcgaaac
    85261 cagtagttgt tgctgatttt gcgattcaaa atcactatgt ctccgattcc agaattgtat
    85321 aaactctcgc gtagtagtaa gatcttgatt ccgtgtgaca gcattgatgt acagacatgt
    85381 tgaattaaaa gtagttcttc ttgtttaaag ctagtcagat tctcgtttct aagcagtttt
    85441 gtggttatgt gtaatattaa attagggacg gcgtcgttca gttttatgta ctgtcctatc
    85501 tgggtcatct caagatgtct aaagtttggg taggtggatt cctctgtgtc tatggtgaag
    85561 aaccgtcgga agaatgttta gctctgccca gagacacggt tcaaaaagaa ctgcggtccg
    85621 gaaatattcc tttgccgttg aatattaatc acaacgaaaa ggccactatt ggaatggtac
    85681 gtggtctttt cgatttagag catgggcttt tctgcgttgc gcagatacag tctcaaacgt
    85741 tcatggacat cataagaaat attgctagta agtcaaagtt gatcgcagca ggttcggtaa
    85801 ttgaaccttt accaccggac ccggaaattg agtgtttaag ttcaagtttt cctggtctat
    85861 cgctttctag caaagtttta caggatgaaa atttagacgg taaaccgttt tttcatcatg
    85921 tgtctgtatg tggagtcggt cggagaccgg gaactatagc gattttcgga cgagaaataa
    85981 gctggattct agataggttt tcatgcatca gcgagagtga aaagagacaa gttttggagg
    86041 gggtcaatgt ttattctcag ggtttcgatg aaaatttatt ttcggcggat ttatatgact
    86101 tgctcgcgga tagtttggat acatcctata ttagaaaacg gtttccaaag ttgcagttgg
    86161 ataaacagct atgtggtttg tctaaatgta cgtatattaa agctagtgaa ccaccggtgg
    86221 agattattgt agcaacgggc aaagttgccg gtgatcaagt tcagttaact acggaacctg
    86281 ggtctgaatt agcggttgaa acgtgtgacg tgtcggttgt gcacgggaat tacgacgccg
    86341 ttgaatctgc gacagctaca acggctatga gtaatcaaaa tctgccaaat actacccctt
    86401 tgctgtcaag tccaccgttt tcggattgtg tttttttacc gaaagatgct tttttttctc
    86461 ttttaaatgt tacaactgga cagcagccga aagtagttcc acctgtttct gttcatccgc
    86521 ccgtgactga acagtatcaa atgctaccgt attcggagtc ggctgctaag attgcagaac
    86581 aggagtcgaa tcgatatcac agtccttgtc agacaatgta tccctattgg caatattccc
    86641 ccgttcccca gtatccggcc gtgttacacg gttatcgtca accgaaaacg tttaaaaagc
    86701 ggcatttcca gagtgattcg gaagatgaat taagtttccc gggagatccg gaatacacaa
    86761 aaaaaaggag gcgccataaa gttgacaacg acgacgataa ggagatggct cgagaaaaga
    86821 acgatttaag agaattggtg gatatgatag gaatgttaag acaagagatt aatgctttga
    86881 agcacgttcg cgctcaatcg ccgcagagac atgtcgttcc gatggagact ctacctacga
    86941 tcgaggagaa aggcgccgcg tccccaaagc cgtctatttt aaacgcttct ttgacgcctg
    87001 aaacggtaaa caggagcctt gctggtcaga acgaatccat ggatctgcta aaactcaaca
    87061 agaaattgtt tgttgacgcg ttaaataaaa tggatagcta aaatgtgttt ttttatgttg
    87121 tgatcaagtg gtgtttaggt gcgtgttatg gggaagatct atgagaatta tgactgacaa
    87181 ggtatatggc gaatgcccac atttccttca aagtgaattc ctggacatgg tgaaacttaa
    87241 cacataattg tttaccgacg cgttaaataa aacggatagt taaaagttgt tgttttggtt
    87301 ttttattttc gtataaaatg gtatttagga gctagttacg gggaagatct atgggagtaa
    87361 ttattgtgac aaggtatgaa acgaatgccg acgtctcctt ctaatatcgt taggctttgt
    87421 ggggtttcag gcggcatgaa ttccatgcga gtagattctc cgggttttag aaaaaagtgc
    87481 aagggtacca aatgttcttt gtcgaacgcg atgcggagtg atttcaaaaa aatgcccatg
    87541 ctgatctctg gtgttacgtg cgcgaccgtg gttagacttg gtgctcgcga tactggctgg
    87601 cttgcgagag ctacaatgtc ttttacggga ccatttggag attctatgtt tacataaatg
    87661 ttgctcattt ctgtccagct gaattcgata ttattccccg gtggtaaaat ttgcttgggg
    87721 aagaagaata ctttgcctag ttcttgcgag taattgatgc gacagttctt tttctgtgct
    87781 ttcatggtga tgtagagagg ccgcgtctcg tcccaaatgc aggtggttat agagattccg
    87841 tgcaagagtt tggggataaa gaaacccgta aagtttgaat ttgattcgaa gatagtgtgg
    87901 aaagagcaat ggaaaggcgt aatcaggtta gagacgatat ttttagttgc gccgacagtt
    87961 attgaaccga cgttgcattt tagaagtgtt tcttgattct gcgacattgt gatgtctgcg
    88021 gtgtgggggg tcagtgaaag ttgtatgtta agtttttcgg gaaaaaaagt atcatcaagg
    88081 agatagtcgt tttcgtacac tgtcttcaaa attaatagat ttccacaaag taagattcta
    88141 gagatggaga cgtgtcggtg tgatataaat tcaattttag cagagttaaa aatttggtcg
    88201 agcggagtgt tttggagatt gatccatata tctgcgttaa ataaataacg tgttggctct
    88261 tctggtgttt tttctgtcca tcgtatatca gccgcgtaaa ttttaatgcg cgtgagaggg
    88321 ccatatagaa taaactgcgc ctcgcactgt ccgtggggta tggcgtggcg atcgtaggct
    88381 tctatgcgtt gcaccggtaa atttgataca gtcacgttcg cgtaagggag tgcgaatatg
    88441 ttaagaacga tgggtaatct gccgagatcc agatctagat ctgagatgtt atgcaccgca
    88501 aagggtatgt tgccataatc ttttggatcg atgtaagtaa aaggcgatgc tgcaaaactg
    88561 ctttcgtctc tacaagtgca caccacgctg gatgaagggg ggcagatacc taatccgcat
    88621 ttaaaatatc tcagttcgcc gggttttaat atggcggcag ttgttaatct tagctgtagt
    88681 acgtacgaag accattgtag agtggcgggt tgcatgtttg cttttctgga tgtatgaggg
    88741 gaatcctgtt agtgtatttt ggatgttaaa tagttgatgt aaacgtagag agtcatatgc
    88801 gcatttttat aatagagtgt ttttccacgg acgggaggat ctgcgggttt ccacgcgcag
    88861 gcttgtcttc gtattctaaa ggatgtagtg tgagttccgg tagcaagtat gctggaaaac
    88921 aattgcccat gaagtgtact tcgaatggct tgtcggtatt ctccgtgtgt gttaaaagag
    88981 atttcatgtc gctgtttgag agggaacgaa acggctttct aaacaacttc ttcgtcacaa
    89041 aaaagatacg acctaacatg tcgtgttcgg ttacggaaac tgttttttcg cacgaaatcc
    89101 gcaattttaa cggttcttgg gcaaaccata aaaatgggta cagcttgaag acatgtgtct
    89161 gaacagggat gaagatgcct acgatttttt tgttagtgaa cttgccgcgt agcgtgatct
    89221 ctttgtttgt attaattact aaggacatat cgctgggaaa gaaaacctct agactctttc
    89281 cgtctgcgca gattttgaaa tacggcatat tcatattcag cgtgacggta ctccgattcg
    89341 gaggggaaaa ggtcaagcga agataacatt ctttcgtgat tggaaaccgt cgctcgtttt
    89401 ccggcaacac tacgttacgt aaaaagattg tgagaaaagg atcgttaaat tctattttgt
    89461 agatagaaat gccgggttcg gaaatcatgt tgactctgca gagtggaatc atacttttga
    89521 ataggttttt ccaataggaa cattttctgg tatcgatgct gaacacgcta aaaactatta
    89581 gcagctttct gccatagcgg tctaattttt gagactgata aggactttct gtccagctta
    89641 ggttaagtaa gatcaaagac gtttcaacgc tatcattcga aacgacttta aattgattta
    89701 tcacgttggt tgtcgagatc ggcatgttgg tcaggccata ttgttcgtat acgattggat
    89761 cgatgttttc tttttggcat agcgcattga tgtcgtcaat ctccagtgca ggtgacggca
    89821 gataaatggg tatggagaat aaatgaatcc gtacgggaac tgtcctagaa ataggtaaaa
    89881 tttttatttt gatagtcatt gtattttcga gaaactgtac atcgaacagg acgtcctcag
    89941 tttctgattc agtgccatct gttatgaata ggattcctgg ttttgtgctt gagattcgac
    90001 atttcaacgt gatttcttgg taagaattcg gaacaatgtg attgcaatca aaaacaagct
    90061 gtaagacatg atttagttga ggagaataca tgttggtaca aaaaaacatt ttatgtttca
    90121 ccttgctttt taaatactgt gtttttttaa gggatgaggt aattttacat gacggatgga
    90181 ggacgcgggt gttcaggcgg ggtgtgtttt tataatcctg cgtataagtg atagaaaagt
    90241 tatagtaggc cagtgtgttt ttaaaaagca tttaattttt ataaatacat gtagccattc
    90301 tgttatctgc ggaaacgtca cagacaacaa aatacgtttt ctcgttggtc aaagaattaa
    90361 tttggtcgat catagttaag actgatttga ttttttttaa ttcgtctttg atgtccgtag
    90421 cgtgaagttg tccgcagcgc tgtgtgctta acgttgttct tttagataat agttcttggc
    90481 atttgatcaa aagcattgaa tggtcttcca gcgttagccg atctatgtaa gttctcacga
    90541 tgtctggggc catggccgtg atcatggaca gcgagatgca ggctgttttc atggagtaca
    90601 ttgattgttt gtcgttgact atgtctggta atttaatgag tacgtctctg tattggatag
    90661 agcataactc atcgatgatt gtttgcatct cattgtattc tctgtgaact gctataagac
    90721 caatgcatag caatctgatg ttgatctcgg ccgcaattgc ggtcggaacg actaaaggta
    90781 cagtgagctc ccaatcaccc agtttcaata gcttttcttc cgagtgcgtc gataaaggtg
    90841 gaatcaatgt caaggtgtca cccttttccc aggggaaggg tcctgtgttc tttatggcat
    90901 actgctggcc ggtcatcggc tttctcaaaa ctagttgatt accttccacc ttctgcagaa
    90961 tggttacgac catggtccgt aatacgttcc ggatgtggac gtaatctttg ttggaggaga
    91021 cgatgggata aagacctaaa ttgccgctac ctattagatg gtggtgagct gggatcggta
    91081 tgacgatgtt catgagcttg cagagggtgc tgatatcgga aagtgacagt ttgtgatcga
    91141 aagtgcagta gacggtttcc attttatatg gaagattcga taataagttg gagaggtatg
    91201 gtttctccta tggcgtagtt acaataatgg gtttcgctga tctgcgtatt gccggtttta
    91261 gaccgactct ctaatagagc ttggttggat gaacagtgaa ggggcagagc gttttgtaag
    91321 aactggcatg gtctgcttac gaagctatcc gtgccctcag agcacgagta ttgtatttcg
    91381 ctatcgctgt ttaaacatga atttgatttc atgcagtatt cgtttatcac tttgtacatc
    91441 atcttgttcg tttttaagat gtcagattcg gtaaaaaatt gagcgttagg actgtatgtc
    91501 ttgggattgt aacatagttg ttctctgtgt gccgtgttgt acaggatatc gcctaaggag
    91561 cctggtagag atgcccaagg atttgtggtt gcggcaaatg tatcgctgtc tgtttgggtg
    91621 tgatcgtaca atgcttttct agccgcctct tcgttgtgtg ggtccgttcc catcatacac
    91681 gattccctgc ctctggggtt atggggcaat ttgaaaaagt taatatttgt cgtgaccgga
    91741 gtcagtatga cttcgcagat agcttgttga ccatgcagca gtatggaggg tgggtttttg
    91801 ttaattccgc cgaatgttat gatgtttagt gcctcgccct cggagggatt aggtttttct
    91861 atcccgacgt gatgccgaat ccacgtattt atgtccgtgt tggtaaacgc gtgtatcggg
    91921 aaggcggaga aaaggttttg tatcttgctt cccatgtctg atttaattcg cttaagattg
    91981 gcagtggcgg tggtagaact aaaacctaag cccatatcta caaaacttag atgctgggtg
    92041 aagttgtaag tggttacgat atctttagct tccgcggtga ccgtgggatc gtctaaaatt
    92101 atagatgtgg ctgccctgga gctgtacaac aggcactcga cgtcgaaatt atccgtccgg
    92161 actagtgtgg ccgcaaagcc cggatggatt ttgcttttgc tttggatcgc tatggcaacg
    92221 ggagacagtt ttgagtgcat ggcggcaagc gtcataatgc tcaacaggga attggggcag
    92281 aaggctgagt acacggaaaa cggtgttcgt tgccaattat aaaattctaa tgctaatggg
    92341 ggcgggagag gaaaaccgcc gtcgtttctt tgatagtgag gaaatgtatt taggaatact
    92401 tggatatcag cattcatggt gccgcagatt cccgggtcag agaagaatcg atgaaatggg
    92461 attggctgat agtaccgtct tagggtggtg atcggtgaga tcaggcaaag cccattgtat
    92521 agaatgtgtt gtagtgattg aaaatgaacg gaattgccgt gtcgctgcgc agggtctaag
    92581 gagacctcca cttccagtat tttcgtattt tcattaatgt agattagcga tttaaacagc
    92641 tgttttgcga tagatgatgt attggctacg gtgtagccag gacccatagc ttctcgtatc
    92701 agagacatta ggacgtcgct gctgatcgga ttctcctgga aacaatcatc tggacagata
    92761 aacggttccg tgtagaataa gtctagaact agttccttta cgttgacgcc agcgccacag
    92821 gccttgttat ttgatagtgc cgggagtacg cagaagtaaa agatcttgct caggatggtg
    92881 ttttcgttcg atggtctgtc attgtcggtg aagacgacgc ttgaatctat tagattcatt
    92941 ctttgcacat cggagatttc gtaatttcta actcttaccg tgttctgtgt cagtggtgta
    93001 tcatccgctg ttatttttgc attcgtgtcg tttctgggca tggtatgaac gaacgggcag
    93061 aacagacgtc cgtcgaacaa cgcgttggcg aaattcacca gaggttcgcc gcaaagttgc
    93121 tcgttgatgt tggagataga gattgtcctc ttcactaggc gaattagcga cacaagattt
    93181 ctgtagtgag cgaaagctgc tcctgggatc agttcgtcac ccatgtggtt agagattagc
    93241 atgatcatct cgaagctgtt gcaaaaaaga agtatatgtt tcatgttaaa ccaataagaa
    93301 atacactggc taattacttg ttttaagatc atgaaagcat gcttgtttcc atgcactaag
    93361 atctcgataa cgtaagccaa ttctgggtat gagccactcg tcaagctttc ggtgacaatt
    93421 ttgagggtga agtcgtagtt gtgggagttc gtctttgcat gttccagcat ttgatttgta
    93481 cgggcttcgt ggaaagagat tggagctagt ggtaaaggca tgttgcctat cattattctt
    93541 ggtgtgcaga gtacttctgt ggctcggttt ttctggatat acgtgagatc aaagaagggg
    93601 tgtctttcgg tcggcagcgt tggattgtcc ggtttgtaaa agtcttcaac gtttagttcg
    93661 ttttttaaga cgttggtgtt cttgggtact tcttgtcgac tttcgtataa gttgtataag
    93721 gtctgtaaga tcctggttgg gttttctcgg gtaattttca gttgacatag ttgagaaaag
    93781 cggtggccgg taggcaatgg ttcgtttttc atgagtcgtt cgacgatggt cgagtcgtgg
    93841 acaatgggat ggcaaaccga cggcagtatg tcggcaaaat caattcgctg cacgacttgg
    93901 tctttattgt ggaaaaaaac gctggtgggt aggttgtttt ccatggtgtc gtttaatttc
    93961 acacgtgttt ccattgtact gaaaccggtt tctgtcggta tgtagatacc caaagggaaa
    94021 aagaatgtca gttgtaagct ttgttctagc ggatcgttga cgtctgtgtt tttgtaaact
    94081 ttgtgtaggt ggtcgaatgc gactaattta tctcccagtt ttaacgtgtt cagttttagg
    94141 tcggcgtacg cgcggctttt gtcaaagatt tctgatttgt tgttagtgtc ttgttgttct
    94201 gtcccggcgt tcacggtgaa ttgagtaaaa tcggccatga ttgcacggta tgcaatcgca
    94261 gtcactgcgt tttctttgcc cataataaag tgaccatatg agatgggggc ggagacgacc
    94321 tgtgtggaga tgtactggga gagtatgttg gtgagttttt ggatagagcc gatcggtcct
    94381 aataaaacac cgtctagggg gatgttttct ttggaagtgt agttgttcgt atcatttaga
    94441 atgctttccg tgaccgattc catcatgtcg ttcagaattc tatagatata cgaactatta
    94501 ttattcctgt tcaagaaaaa taatgacgtt aacaatctgt tttttaggct ctgaaacatg
    94561 ttgctgcgct gtactcggct cagagcttgt ttattatgta ctttgttctc attcatggtc
    94621 aggacgataa attgcggggg agattttctc aataaggttt gcatgaatgc gtgaatcaga
    94681 cctcgttcga gcgaatcggc tgaattcttt aaagatctta aaactgtatg caacgcattg
    94741 atgtttaaaa tctgatcgat gactgtgttt ttaaatgtgt tttccagatg ctccagacag
    94801 gcagcactca aatcgaacga tatgtttatg gggtgttttt ctgagtgttt ggctaccatg
    94861 atggtggttt cttttggagc agttacgtcg tttcctgtgg cgactctggg taattggata
    94921 aagaagagaa ccttcccgag ggtcattcga ctcacatcgt tgaagcgaat tacgttcgcc
    94981 gcaacggcga tcggcgtggt gaaaaagttg atccattcta ttttgttgca gtagattccg
    95041 agcaaggctt caaaactgat gttgtaacgg ctcggatcgt caccgaaata aattcgcaaa
    95101 ttgtcaaaaa gttgttcggc cgtgtatgtt ttaatgtcat tgaaaatatt tagaggtgct
    95161 tcgattttag gtaaaatttc ggtcgcctgc caattttcca tgtttcggcg ttatgcagca
    95221 caccggtaat tgtgaaactt taatagttaa ttcatgtttt ggttccactt gtgcacggtc
    95281 gattccagtt tttatagatt cctgtgatct gaccgctgaa gtgtctcgcg acgaggaaac
    95341 tcgtttagcg cgatctgtgc ctgtagttct ggaaaagatc gagtcaatca tagagaaaat
    95401 ttttcaaacg tctgggccaa atatcgttca cgataaagac agggctaaaa ttgccttgtg
    95461 tcgtctgttg ttaggaccgg ttgcggtgcc atgtttctgt gaagaatggg acaccaacga
    95521 ctatttatcg aaatctggat gtaaatgctt aggtccgatc ttatatattc ataccagtcg
    95581 atgtcgctgt agcgatattc cggtttttaa gttttccatt atgaaagatt actacgcttc
    95641 acacgtgttc agaggtttat tatctctgaa agagtggaat acacatctac cgaatgtatt
    95701 gtgtacgtgc gagttgtcga tgagtgatag atatgtggcg accgtgtttc ctaagcagaa
    95761 ttctatatat ctagaatact atccgtattt tttgtgttat ctgtgtcgct atcttactgt
    95821 cattgagatt gagcagtgta caaatgattt aatttcgctt cttggtccta aagtagctca
    95881 gcgagtcata attcatttta aactgctttt cggttttcgt cacaagccgc atatgggcac
    95941 tgttgattcg tggttctggg aaaatttttt tatgctagaa ttgcataagc tttggttaac
    96001 cgtagtcaaa cataaccggg tgacaacaga tttctttaat gtagtctatg agaaaattca
    96061 aaactataaa caatacgcca tcaagacttt gaggatgtcg tctaaggcgg ttcctgcaat
    96121 acagaggttt tgtttggcaa aatttaagca gcaactcttg tatctaaata ttaaggttac
    96181 ggtaaaaaaa aataagcgag aactgtgttt aaatggtttt gtttacggta aaacattgta
    96241 tgtcgttgaa tcttctcagt taatctttcg aaatttgctt ctgttgtatt acgattacag
    96301 tttgccggac gaatgcaaaa caaaagaaga aaacgttttg acgactcatt acatacgggt
    96361 aatttcgaga ttgtcgttta agcagtctcg aagtgcggtc ccgccaggcg tgaaaccaga
    96421 ttttaccttc gtggcacaac tgcctaaacg taaagagttg cctaatgttc ctggtggtat
    96481 tgattttgct gaaattacct cagtgaggca tggcgcggta attcttaacg cgtttaatac
    96541 gaacaaagtc atgaatttaa aagcaaccat ttcaaaaagg gctaattttg tgtatcatcg
    96601 cattcctaag acaatgactc acagttttgt catgtacaag catacattta aagaacctgc
    96661 gtttaccgta agcacgtttg tttcaaacga tgatttagat atgagttcat tgaatatcaa
    96721 tatacgtgga ccttactgcg actttttata tgccttaggc gtttataaga tgcatgtttc
    96781 tatccaagat ctgtttttgc cggcgttcgt ttgcaatagc aataattcag tggatttaca
    96841 gggactggaa gatcaggatg ttgtgagaaa tagaaagaaa aaggtgtatt ggattactaa
    96901 ctttccgtgc atgatttcta atgccaacaa agtgaatgtg ggatggttta aagcaggaac
    96961 aggtattatt cctcgggtgt ctggaaaaga ccttcaaaat gttttgcttc aggaattaaa
    97021 taacgttcga gagattccag ggttagtctt tgatatggat ttgcatcaat tgcttgtttt
    97081 gctggaacag cggaatctac atcagattcc gtttctcgtt aaacagtttc ttattttttt
    97141 acgtcttggc ctgttaatgg gttacggaaa ctctcggcgc aacaaggtgc atgatatcat
    97201 gttacactta atttcgaatg gcctgtttga ttttaataag aactccgtag caaatacaaa
    97261 aatcaaacac gggtgtgctt tggttgggac gcggctcgcc aacaatgttc cgaaaatcat
    97321 tgctaggcag aagaaaatga agctagatca catgggacga aatgctaatt cgcttgccgt
    97381 gttgcgtttt atcgttaaaa gtggggaaca taaaaataaa actgttttca ttaaactgtt
    97441 ggaatattta gcggaaacct caactgccat aaatacgcgg aatgaagtcg ccagattact
    97501 tctgactctg acgactaata tgaaaacatg aatgtaccca tggccgacga atggttcgat
    97561 tgcgcgatta ggttagattc ggaaaccata gctgtccatg aaattttcaa ttcggattta
    97621 agtaaactgc ttaacttgca ctcgaaaaca gtctatatgt ccgatctgtg cgcctttatt
    97681 tctggttgtg ttaatcggaa tgttggtaaa cttaccatat attggcacgt gtacggagac
    97741 ataatctacg cattgacggg tattttacat tgtgtaaaaa taacgataga gtgcggggag
    97801 agaattgccg atggtcgata tagattatac gaaattccga aattattttt aatgagagga
    97861 cagtcaacac ccctggaact gaagtggaag cacgccgtgg gtatcgcgac gacgaataag
    97921 cctttgctga cgcacgtttt aacagatgtg ttggaaacct ctccttttac cttgccagat
    97981 acgcttctgt cggtgcagga gttgtctatt ttcagagaga gattgtcgta tatttactat
    98041 gtgctcgggt tagatgttga tatcgtagcg agaacagaga gggagatttt tcaaaaatgt
    98101 gcagaactag ctcgcctaca acaagtcttt cttattcaag gaaatattat ggaaaacttt
    98161 gtcctcgttc aggcgtgtct atttcagctg ggggctgatg gtttgtggga agagatgtct
    98221 ggctctgtac gtcctaggcc ggagttgatg tctagtgcgt tcattcaaca cagagtaatg
    98281 gtgaataatt gttattgtct cgctgtcatc ttcaatgcca tttataaaca caaagtttcc
    98341 ctgcctaccg tagaaagaag ccacgaaatc gttcatcgtg tagttcagga atattataag
    98401 tcttatgtga atgctcctct ctctgttctt gtgtgtgcga ctaaggtgct taccttgttt
    98461 acagaagaat ataactttca gtcagctctc gtatttgtca gtcagttttt ccaggtggac
    98521 gtcgaggctt cgagagcgga tgtgattcgt ctgtttttag cgtgtctgaa gggtgattag
    98581 atctctcgga aagaggctga actgtttcca gagcacacat aaatcgccat aattatggcg
    98641 ataattaagt cgtcagaaca ggcttgtttt ttagcgctgt atgttatgta attgttaacg
    98701 gagatctggt gaatgtttct gatttgttct agtgcgtatt ctacgggatc gtaggtgatt
    98761 tttattgtaa acgatatcaa ttcctgtgat gccttgatgt ttcctgaatt aaaattcgag
    98821 atgaaaaact caactgctag ttttttttct ttaccgagta ggtaaaatgg ctgtgctatc
    98881 tgattctggt ctggggtgtg gaaaaaagtc acctgtatag atttattagc cgtgatgttt
    98941 tcctttatga tacatgcgat ttttacggca gaagcttgat tggaattccc ttctatgatg
    99001 atttttactt ccgtgaagaa aggatgtagg tctaggattg acaatatcat atgcgcggca
    99061 cattcagcta ttgctgtgtc ggaactcgtc attaaacttt ctagaaagta gtgctccatg
    99121 ccgtagacga tatattgatc tagataggtg cctatcgctg ctatgccagt gccagaagca
    99181 cggcggttgc ctgtataggc aggatctagg tatacgtaca gatctttacc taaaaaagga
    99241 attagatttt tattgatggt gctgtatcgg aaaaactcga attcggtttg tccttgttcc
    99301 gtaattaaaa cgtcgttgat cacattgcaa gtggctccgc ccatgatttc atggatgaaa
    99361 gctccttcta ggaagaggtt ggccgttttt ttaacttcgg cgttaatgct gatgaacttg
    99421 ggtttgtgga gtcggtagca agaacaggct gtggcgttac cgcgttcgtt tagcatatgg
    99481 gcgtgatctt cgcatacgta agaaactacg gagagcattt caaacggaga gttgttcagc
    99541 ttcattaaaa aagaagttga atggtttccg gaattggtcg aagatataaa taggatcttg
    99601 gtagatgctt ggggcaggaa acctaaaatc gtgctgaacg cgtctttctt tataaagtgg
    99661 ctctcgtcga caataagtag attgaagctt tgtccgcgta tactctgaga ggggaatgaa
    99721 ttcggcgtta aacgagataa aagacgattt tgagaactgt gaaacgaaaa acgacctttt
    99781 taaaataatt gataaaataa gcaaaaattg caattttata gtggaacagg tcgagtcctt
    99841 gcctcggagg gtggattcag cggctatcct atttgataat ctcgcggtgg agatatttaa
    99901 cgatgtaata tatcgacaaa atggagatgg cgttgccgcg aaaatacgac agggtaacgg
    99961 gcagaatatt gacacataag aataaccaga tgtgcacaac cgaatgttct cagatgtata
   100021 atttacacaa tcctatcacg tttgagttgg gacttggaaa cgtgtttgtc tgtatgcggt
   100081 gtttgacggt tcaccactgt gatatgcaaa ctgactgtac cattgtcaac acgcatgagg
   100141 ggtatgtctg tgcgaaaacg ggtttatttt atagcggttg gatgcctaca tatgccgact
   100201 gtttcttaga accaatctgt gagccgaata tcgaaacggt taatgtcgtg gtggtcttgt
   100261 tatcttatgt atatagtttt ctgatggaaa acaaggaacg atatgctgcc attattgata
   100321 gcattattaa agatggaaaa tttataaaaa acgtggaaga cgctgtgttt tatactttta
   100381 atgcggtttt tacgaactca actttcaata agattccttt gacgacgata agtcggcttt
   100441 ttgttcagtt gattatagga ggacacgcta aaggaacgat ttatgacagc aatgtaattc
   100501 gcgtcagtcg tcggaaacga gaagacagtt tactaaaaaa gatgagattg gagtatggaa
   100561 acgcacttat actatgacac cctgtaccaa tatcaaggcg gagtgtatcc ggcccatatt
   100621 tgcctgccga cagatgcgta tcttccgatg agagtggatt gtatcgagtc tttatatttt
   100681 cggtgtgttt ttttcaagaa tgggatgcat tatactgaat ggagtaaatt aaagtttact
   100741 gtgatttcac gtgaaataaa gtttaaagat gtgttaaaga atgctgactt tgacgaactt
   100801 tttaccggtt tggtggtaat gactattcca attccaatag tagattttca ttttgatatc
   100861 gattctgtaa ttttgaaatt ggtttatccg cagttagtgc accgagaaat agtgctgagg
   100921 ctctacgatc tcatatgcat cagaccttcg tcagaccggc cgtcggaagt atcagctaaa
   100981 aatattggta ttgatttcta tcaactaact tcacagggaa ataaacaaac acccgatgag
   101041 gaaaaacgtt gtctattttt tcagcaggga cctttagagc caccctctac cgtcagaggc
   101101 ttaaaggcag ctggcaatgc aaagccgatg cagtttcccg cccatgtcaa cgaaaaaatg
   101161 accgaatctt ttttaagcga tagttggttc gaacaaaagg tcagatgcaa aaaaatattg
   101221 gattttacgc aaacgtatcg agtcgtggta tgttggtacg agctttcgtt ttcccgcgag
   101281 atgcagatcg agaataattt actgtccgct tcccagctaa agcgggttaa cgctgcggat
   101341 ttttgggata gaactgatcg gtatttgcga gatattggga gcagggtatt gacacacatc
   101401 gtgaaaacgc ttcagattca taataggcaa tttaaacaga aatttaattg caatttccca
   101461 gttaatttca gctttgaaca tctattatca tttatgcagc tcgggaaaga tttttggatt
   101521 ttaaacttaa ctttagacag ctgcattatt aaggcaatta tctgtttcct aggttttcga
   101581 aacgggagaa aatctttttt agctcaagat gaagtttggg gagatttaat agactgttct
   101641 aaaggatcgg tgatctacgg ggaaaagatc caatggattt tagattcgac taacaattta
   101701 tattcgacgc gtcgtgaaaa acagaataag tcgtgggaat tatatgttga ttgctgtgct
   101761 ttgtatgtat ctgaaaagtt agagttggat tttgtgctac ccggcggttt tgcgatcacc
   101821 ggtaaattcg ctcttactga tggcgatatc gactttttca attggcgatt tgggttatct
   101881 tagaaatttt ttgcagaatg aatgtaactg gttcaggatt tgtaaaaaaa cattctatcg
   101941 cgaatatcgc agcgttgcga catcgtctcc tatattttcg ttgaagaata agcctaagaa
   102001 atattgcatg cattgcgaga tggtagtgct caagcgaagt catgaattta tgttcagcct
   102061 tgcggtaaac ggcatacatt ttggacagtt tttgaccgga ataatgaaat ttaagaagaa
   102121 acaagttgcg gaagggctct gttactatgt attggaattg ggaagcataa gtcctgtcga
   102181 tttgagcttt atcccaaaat ataattctga ctgcgttaca agcatgcatt gtgttacacc
   102241 ggagcttatt tatgaaaatt gctctattgt gtgtcccgaa gaggcaagtc gcctcactgt
   102301 aaaagggctc ggggacaata aattgattcc cttaggtggg tgtggagtat ggtgtctgaa
   102361 aaatggtggc gatctgtata tctatgcttt tgtactcgct tacgatcttt acgtagcttg
   102421 ttatgacaaa accatctttc catctctggc gaaaattgtt tttgatatga tagcttgcga
   102481 ttccgaagat tgcgtctttt gtaaagatca caacaaacat gtatcgcaag ccggacatat
   102541 tgtagggtgc gtctctaatc aagaaacctg tttttgctac acaccgtgtc aaaaaaaaat
   102601 gactgatatt aacaatccgg agttaatctc tttgctctgt gatcaggaaa ttaataagat
   102661 agatattatg tatcccgaga aaaaagcatc gttatcactt gacattaatt cttacgttca
   102721 tgggtacctc ggcgacgagc cttgtgcgtt aaaatgtgtt aattggatgc caatcaggat
   102781 cagctcagct ctgagcaggc tgattatttt gtcgtgtcct gtgtgtaagc gtgtggtaat
   102841 ggactaagtg tgcgttattt tctgtattaa ttttttgttt ctgaaaataa agttgaattg
   102901 atagtactta cgtgtgtatt gtagcagctg gcgaaaagtg ctgtgctctt tatattttga
   102961 tggtcgattg taattacatt atccaggcat gtgattgtct tttctggaaa cattcggcgg
   103021 catttaaact cgacttcttt catcacaaag tgagatacat gtttttgatg tgctacgtaa
   103081 ccgatgctga ttccttcaat gtttttcaat aaaaaactta taattggaac tatgaaccac
   103141 gtttttccat gtcttctcgg gactaggaat acgttagttt tttgtttcag cgtattcaga
   103201 gtactttcgt ttacgaattc aatgtcgaac acgtgggtca gatagttgat aacacgattg
   103261 gctaaagccg gaagtttggt gacggcgatg aaaaagatta catgtatgag aatgttcttc
   103321 tgaaatggtt ccagttgtat tttgcgcgtg tctccaaagt cgttgaattc tcctttgatc
   103381 cattttctga aatctttgat aaaaccatct atttgcaaga atagcggttc acgatataga
   103441 atcttaaagg attcgagaaa ctctgtgtat tgtgattcaa aggatttgtc ggaagcgggt
   103501 aagaacttca tttcttgtag cttgcgcgta aggctcggta gtatagtaag aggcttacgg
   103561 tttttaagat gtcgctgttt ttcacagaat gtatatagag gttttacctg ttggttatat
   103621 gaatgggcaa acccgagttc tggcgtgagc attataaaac gcttcttata gaagatggca
   103681 ctgttggggt atttggtaga tatcgtagag cagtttcttt cgcctttcca tatgatcgct
   103741 tcatagttgt tttttatgtg ggttatgtcg caggtacgta gcatggagcc cgaccttacg
   103801 ttggcggcgg tctatcaggc ggcggcgaat ctcacagagc aggataagga gattttttcc
   103861 gaagcggtaa aaactgcgtt ttcagtgtgt agttcggcag ccccgagcgc taggttgaga
   103921 atgatcgaaa cgcctacaca gaattttatg tttgtgacga gcgttattcc ttcgggtgtg
   103981 ccgtctggtg aaaaaaaaac aaagttaaat atcgatgccg ctctggataa tttggctttg
   104041 tcgtttgcga acaaaaaatc aaagaagatg gctagaacgt atttgctaca gaacgtttcg
   104101 cggactcaag atcaacaagt tgccatttcg gggacgtaca ttttatatac aaaaaaacac
   104161 attgaaacgt ctttgatgct cgataagacg aagttagtta aacaaattct tgagtatgct
   104221 gagaccccta atttgttagg gtataccgat gtgcgtgatc ttgaatgttt actttggttg
   104281 gtgttctgtg gccctaaaag tttttgccag tcagacagtt gtttcggata cagtaagacg
   104341 ggatataatg ccgcatttcc gaatctattg cctccgtatc tgtacgaatg cggccagaat
   104401 aatggactgt tttttggcat tgtgcaagct tacgtgtttt cttggtactc agattttgat
   104461 ttttcagcgc tagagatttc agaacgcgct cgtcgtcgaa tcaggtcact cctgtacgac
   104521 ttaaaacaga agttttcgga gcaagaaatt tctgttttac cggtagcgtc acagatgtgt
   104581 atcttctgtg cattatataa acaaaacaaa cttagtctag aatacgtttc tggtgactta
   104641 aagacttctg tttttagtcc aattataata aaggattgtt tatgcgtgca gacgacaatt
   104701 tctacaactc agatgctgcc aggtacaaag agctcagcga tatttccggt atatgacctt
   104761 cgtaagctgc tcagtgcact tgtcatttcg gaaggtagcg tcagattcga tatataatgt
   104821 ctttgaagga ctatctgaga cagtcaattt ctaaagattt ggaggtgaga catcgagatt
   104881 ctttaaagat tagattaggg gagagacatc cgttgagtgt gcatcagcat atgatcgccg
   104941 ctaggcagat cattaaatcg gacaatgcgg aacaccagca tgtcatatct tctttgagtg
   105001 gttttttgga taagcagaag agttttttaa aagtgcaaca aagagcttta aagcagctag
   105061 agaaattgga cgttgatgaa ataattgata cggcggcgga agtgaaagca gtcagtaata
   105121 atataaaaga aactcttatg gcaagcactg aattagaata attatggaca acggtgtgga
   105181 gacacctcaa ggtcaaaaaa ctcagccgat aaatttgcca ccagatagga aaaggttgag
   105241 aaaacatgac ggacttggaa aaggtgttaa acgaaaactt tttgccgaag atagctctcc
   105301 gttaaagaaa cagatccccg cctgcagcga tatggaaaca ctttcttcgc ctgtaaagtt
   105361 tggatgcaag tcgcgaagtg cttctgctct cgatgaaagt tttggaaaat gtaaacacga
   105421 aactgcttgc gattgttctg cgatagagga attgctttgt cacgagtcgc ttttagactc
   105481 gccgatgaaa ctgtcgaatg cccacaccat cttcagctca gacaaatgga aactggagct
   105541 agagaaaatt atagcttcaa agcagatctt tctagacatg agcgagaatg ttgaacttgt
   105601 agcctacggc gagactttgt gtaacctgag aattttcgaa aagatcagct cgccgttttt
   105661 gtttgacgtg caaagcgagg agcgttcgta ttcagtggtt tacgtccctc acaacaaaga
   105721 actttgtgga cagttttgtc aacctgaaaa gactatggct cgagttctcg gagtgggtgc
   105781 ctacgggaag gtgtttgatc tagataaagt ggccataaag acggccaacg aagacgagag
   105841 tgtcatttcg gcttttatag ccggtgtcat ccgtgcaaaa tcgggagccg acttattatc
   105901 tcacgactgt gttattaata accttctgat ttcaaattcc gtttgtatgg atcataaagt
   105961 gtctttgtca cgtacttatg atgttgatct ctataagttc gaagattggg atgtcaggaa
   106021 tgtaatgaat tattacagtg tgttttgtaa gttagctgat gctgtaaggt ttctaaatct
   106081 gaaatgtaga attaatcatt tcgatatctc acctatgaat atctttataa atcataaaaa
   106141 agagataatc tttgatgccg tgttggcgga ttacagcttg tccgaaatac atcccgagta
   106201 taacggcacg tgtgctattg ctaaagagta tgacagaaat cttcaacttg tgccaatcag
   106261 tcgtaacaaa ttctgtgaca tgtttaatcc tggatttcga ccacttgtcg ccaatgcaat
   106321 gatattggtc aatgtatgcg aggcttttga tggtgaaaat aatcctctta gacactgtaa
   106381 tttggatctg tgcgcctttg ctcaggtcgt attattgtgt gtcctgagaa tgacagataa
   106441 acgcggatgt cgcgaagctc agctatacta cgagaaaagg ttgtttgcgt tggctaacga
   106501 ggcctgtcga ttgaatcctc ttagatatcc atttgcttac agggacgctt gctgtaaagt
   106561 attggctgag catgtagtgt tgctagggtt attgttttac cgagacgtgg ttgatatata
   106621 tgaaaaaata tacgattttc tagatgaaag aggggaattt gggttacgag acctgtttga
   106681 ggcaactttt ttaaataata gtaaacttac cagacgtcag ccaatcagag gaggtcttgc
   106741 gtctctacag tcgtccgagt atggagaaaa acttttacat gaccttagag cgttgttctt
   106801 gatcacttct tctgcagatc tggataaaga tacatcatct ctctttcaga tgtgatatag
   106861 taatggatct taatcagata tctgaaacac taagtgccgt ggcagaagaa gagcctttaa
   106921 ccatgttttt acttgataaa ctgtacgcca tacgggaaaa gatcaagcaa gttccatttt
   106981 cgattgttcg cttgtgtcat gtttactgca tgctaataaa atataacgct tctaacaata
   107041 attgcatttt gggccgtaaa cttattgagg aaatgcagca gtttttgtgc ggcgcgagag
   107101 tagatggatc ggaagacgtt tctatggata tgagtgaatt gtgcaagctg tacgattact
   107161 gtccgttatt gtgttctgct ctgtgtcgtg cgccttgtgt atttgtgaac aagttattta
   107221 aaatcgtaga gcgtgaaact cgggggcagt cggaaaatcc gctctggcat gcgttacgga
   107281 gatataccgt gacagcaact aagctgtatg acatctacac gacaagaaat tttttagaac
   107341 ataagggaca gcagtttttt ggggaagcgg tgatttacgg cgcgaaacat gagcgtgtta
   107401 ttagacacct cgtagcgatc ttttacgtta aaagggaagt caaggaaacg ttgggattgc
   107461 tgcttgatcc ttcatctgga gttttcggtg cgtctctaga cgcgtgtttt ggaatttcat
   107521 tcaatgagga tggattcctg atggttaagg aaaaagcctt gatttttgag attaaattca
   107581 gatataaata tttacgggat aaagaagatc actttgtttc tgaactatta aaaaacccca
   107641 cggagaaatc tttttcggat tttattttat ctcatccggt gcctgccata gagtttcgag
   107701 aaagagggaa gattccgtca tctagagaat atttaatgac gtatgatttt caatatcgtc
   107761 ctcagagaaa gttgcgcact tgccccactc cagctatttt gacacctcat atcaaacaac
   107821 tgttgtgttt gaacgagaca cagacgtcta cggtaatcgt ttttgattgt aagagccact
   107881 tgagtgagca gaagctgtct gtgtttcaga aggctgtgtt taccgtgaac gtattcgtaa
   107941 atccgaaaca caggtatttt tttcagagtc tgttacaaca atatgtaatg actcagtttt
   108001 atattaatga tcatagtaat ccagaatata tcgagagtac ggaagtgcct tctgttcaca
   108061 ttgtgacggc tctcttcagg agaagaacag aggaagaaag gagtttgcat ttggtgattg
   108121 atgagacgga atatatagaa gaagaaatac ctttggcctt gattgtgact ccggtggcac
   108181 cgaatccgga atttacttgt cgtgttataa cagacatatg caatctgtgg gaaaataata
   108241 tttgcaagca gaccagttta caagtatggg cacaaagtgc tgtaaaccag tatcttgcgg
   108301 catgtgtaag aaaaccgaaa acaccctgat ggattacaag ggaaatccta tattactaac
   108361 gacggaattt actgttttga ccgataccga atcggaagag gaagggatgg cagatcttga
   108421 aaagcccctg cttgaaagag tacaggccac attagctgct aaatgtgata cggaagttga
   108481 aaaaaaactg ccgcttaaat caaaaaaatg atagacgacg cagatttacg acacgctcgt
   108541 attttatttt gtggctattt gacaataaac atgattgtaa taaaaaaaag tgtcattcgt
   108601 tttcatccat taggctcgag ctttcagcgt taagtagttg cttgtaccga cgcttctttt
   108661 taactaggta gcgtacgagt cgacaaatta tgaaaccgat cgaaattatg gcgacgaccg
   108721 ataaattgat aataagtcct gtgctccact cggattcaaa gaaagtttcg tactggagaa
   108781 tagggaaaga taggcctacg gcgccacaaa acataccgac gtaatagccg aacaagggtt
   108841 taacgtagcg aaccaggacg gcttctatta ctatactata tatacaagcc atgacaagaa
   108901 aggtattgat ggaagagaaa gcgacggtga tggaacgtat gtagatacta tttccgacgc
   108961 ccaggcaagt agtaatgccg agaaacatcg tagagtaacc tagcatgagt tcgcttagat
   109021 tgatgacaac ggtcttgaat tgtacggtcc cctttaggtt aggatgaatt ttctgaaagg
   109081 cgaaaaacga cttgtccgct gactgaaatt gcgttatcag cgtaacgtta aaggtggtga
   109141 aacacacgaa gaagatggaa taggcaaatg cacctagggc gaccagtctg aaagacaggg
   109201 cggtgacgaa taactgaaat gtatccatga ttaagatgaa ttgaaagcag gatgaggtgt
   109261 cccccatcca ggtaatatcc ctcgttgttt ggttaacgtt agatgttttg ttagaggaga
   109321 acacttttgc acagcagaca atgtaataaa taataatcag gaggaataag atagccatta
   109381 tcagtacgta gcatataatc tgcacagggt ttatgtaaag ttgatgcgtc atctgatata
   109441 tttcattatt agcggagaga ttgaccgctt tgaggtcatt gatttcaaag taggcgcacg
   109501 gaaatcctaa atttggaaag tttatggcta tcagatggac cgtgacgttt ataaatgaca
   109561 aggctgcaca gattatagag accagccaga tccgtaaatt aatggtgtct acacgactgg
   109621 aggccatacc agctctgtga tggagaacag gtttcagaac gatactctgt tctcagagtg
   109681 gttcggccag agtttgtccg atgtaagatt tccggacaat gtcaccgttt attctcaagc
   109741 cgactcggcg gtgagttttg aaaacgtcag gcagccgata aaactggttc gcgcagcgat
   109801 gggttcaggg aaaacaacag ctttgattca ttttttgaaa caggtaccca aggaactatc
   109861 tgtccttttg atttcttgcc gtaaaacgtt cgctgcggaa attttgcacc gttttactct
   109921 caatgggttg gaggattttg aattatattg cgatattacg gagcggcaga taaacaacag
   109981 aaaagtcatt gtccagatag aaagcttgca tcgtcttaca gaaaattacg atgttttaat
   110041 attagatgaa attatgtcga ttataaagca gttttattcc aaaacgatga caaaaaccaa
   110101 agaagttgat tgcaagtttt tatcgctgat caaaaattcc agtcatgtaa tagctatgga
   110161 tgcgacgctg actcggcatg tggtggagtt ttttgccgcg ttcaagccag atactcaaat
   110221 cgccctcatc agaaatacat ttgtgtccgc gatgttttcc aatagggtcg cttacttttg
   110281 tgacacgttt tttggtaaag agttttcttt ttttgcgcgc ttggaagaca agctacgatg
   110341 ggataagaaa ttgtgtttgt tttgcagcac cgtgttggca gcggaataca tgcatgattt
   110401 gatacgttct cggttttcac tcaaaaaagt tctcttgttg acgtctaaac aagggaaatg
   110461 ctcttccata gaatcgtgga tacggtatga cgtagtgatt tatacgtccg tcgtgactgt
   110521 cggtctgagt ttcgaaccgg tttatttcag ctctttgttt gtttacattc agttggccaa
   110581 aggagggccg gacatggttt caatatttca atccattggt cgtgtgaggc gagttatcga
   110641 tgaagatata tacatttaca tgaatcccgt actaattaaa agctatgatc ctttggcgcc
   110701 tattgccatg cctccttgca gtgattggag tgtcgctgag cagtctatca tctcagagag
   110761 ttgcattgac ttccgcggaa agtgcagcgg agcgcataaa tataatttct gttccgtact
   110821 gaagtgtctt tttcgataca ggcattatat cgaaaagact actattacaa gtttatctga
   110881 tagtctcttt ctgctctgca gtctgttatg tgagaattct attaaggtgg acattgttgg
   110941 aaatggattc ccgatgcgca aagaggtttt tttgagtttc ttgcaaattc tagtcgagga
   111001 gtgtcatttt atcgaaaaga agattacttt gccgggtgac aacatgacgt tccaagagat
   111061 cataagtagc agagaaacta tcatgaacgg agatttttat gaaaacggta atcagctatt
   111121 acataaggac tatattaccg acatgggaaa gttcagagcg acttttttat ctccgggcgt
   111181 tgacattttc attgcatcgg acattgtatc tgatctgaaa aatgaaagca aacgctatgt
   111241 ttttgtgaac gtctggttac aaaaatgtgt gtctgctggt gtagaaagca cgcgaatcga
   111301 aagagttttt aatgagcgga ttaagtctta tgtgctgccg aagagttttt tgtgcgatga
   111361 gtactttgtt ctaggtgaca tctctggggt ttacgagtgg ggaatgttaa tagatctggc
   111421 cttcctggcg gaaatgatcc gaaaagattt gaaactgaaa tcgtgcacag atactactac
   111481 tgacatttct gaagatgatc tccttttgtg tgcggccagg aggtcgagtg acatcttaca
   111541 aataatgcaa ttagtgttta cggtgcatgt gcaatttttt caaagataca gtctgcagac
   111601 tctgcagctt tttaacaagt tgagaggcat gcggattgtg acgggtgtgt tttctataga
   111661 aaaattcagc atttccatcc tcaggctttt ctttaaatgt gcatttaata tgactttgtc
   111721 cgccagcaaa cctcggtaca tcccgggaaa ggcgtatcgc aatctaacaa aaaatgatct
   111781 ggagaacatg ctagacaatt gggagatttc gcgcaccaat cttaagactt gtaaagaact
   111841 acgtaaagcc ctcaccgagg cctcgagagc aaggcggaaa caaacaattt ataaactgca
   111901 aggctcggat ataagccttt ccgttagtga agttggagtt tttgggcaac atgcatctcc
   111961 gggggtgtgc gtgtcatctt agcctttatt gtgtgtacaa cgactgggag aataagatct
   112021 acagagtacc gatttttcag tgtttgtttt tagaagcgga gactcgttcg ttaaaaacgt
   112081 ttttgattag gggacagagc ctagaccaag aatcgttaaa tgagatagaa gttacaagaa
   112141 aagaaacaat gctttgggac cttcaggaac aaagtaatat gatggacaaa aaaatagcag
   112201 caatcagcag cctcattatg aataacggag agcttcttag gaaactttca aaatttttcg
   112261 tgcctctaac tgttgttctt ggagacgacg ggttagagat tttggaagca tacgtctgtg
   112321 gcgaggaacc catgctgcct ttggacacgg tacctgttat attacgatgt gtcggagact
   112381 acgcagcctt ggacaccaag catctcttga gtaacgaatg tacacaggcg tctaaaaaac
   112441 ttcgctttgg atacagtgta atggactttc acttttcgct aactgtgtct gatgtaaaaa
   112501 tttgcttttc acacacggac accggtgagg ctgtatgtga aaaaatgaaa caaatttttt
   112561 atttttctgt gtgtgctttt ggtggtgagc aagttctctt agtgacgcca aaaaatgctt
   112621 atgccttatt gttcgacgat gatttgtgtt tgcttttact gcagagcgtg tttgctttcc
   112681 tgcacgagaa gatattcgca gtttataaac aggtgttagt tcagctttgc gaatacatcg
   112741 gtcccgactt atggcccttt gggaatgaaa gatcggtttc ttttatagga tatccgaatc
   112801 tgtggctttt gtctgtatcg gacttagaaa ggcgggttcc ggatacaact tatatctgcc
   112861 gtgaaattct ctcattttgc ggtttggcgc ctatcctggg acctcgtggt agacacgcga
   112921 tccccgtaat tagggagcta agtgttgaaa tgcctggaag tgaaacctct ttgcaacgtt
   112981 tcaggttcaa tagtcagtat gtttcaagtg agtctctgtg ttttcagaca ggtcccgagg
   113041 acacacatct attctttagt gacagtgata tgtatgtagt gactttgcca gattgtctga
   113101 ggctattatt gaagtccacg gttcctaggg cctttctgcc atgttttgat gaaaacgcca
   113161 cggaaatcga actgctttta aaatttatgt cgaggctgca acacagatcg tacgctttat
   113221 tcgatgcggt gatctttatg ttagatgctt ttgtttccgc ttttcagcga gcatgtactc
   113281 taatggaaat gcgatggctg ttagtgaggg acttacacgt gttttattta acctgtgacg
   113341 gtaaagattc acatgttgtc atgcctttac tgcaaacggc cgttgaaaac tgttgggaaa
   113401 aaattacgga aatcaagcaa agacctgcat ttcagtgtat ggaaatttcg cgctgtggat
   113461 ttgtcttcta cgctagattt tttttaagca gtggattgtc acaatctaaa gaagcgcact
   113521 ggacagtaac ggcaagtaaa tatttatctg catgtattcg ggccaataag acaggtcttt
   113581 gctttgccag tataactgtt tattttcagg atatgatgtg tgtttttata gctaataggt
   113641 ataatgtttc ttattggatc gaagagttcg atcctaatga ttattgcctg gaatatcatg
   113701 aaggacttct ggactgcagt agatatacgg ccgtgatgtc tgaagatgga cagcttgtca
   113761 gacaagcacg tggaattgca ttgactgaca aaataaactt ttcttattac attctcgtta
   113821 cattgagagt gttgaggaga tgggtggaga gtaaatttga agacgttgaa caggcagagt
   113881 ttattaggtg ggaaaacagg atgctctatg aacacattca tttgctacat ttgaattaat
   113941 tttgtttctt tacataacat agaaaaataa gacttagcta gacgtgtctt cattcttcga
   114001 ataaaaaatt tgtgcgaatt gtgttgctag ttgtatgact tggagagaac tgtcttgcag
   114061 ctgtctagat tctaaggata aattgatgaa attgtgacta cgttttgtgt taaaataaag
   114121 ttccaaaact tctatatgcg tgtttttcat ttcattgtat agtctaatca tcggaggcac
   114181 cttgtggagg atttctgagg cgtgttcgtt aaaaaaaatg tgtcttagtg tacaaaccaa
   114241 tttgtcgcac gtgttgaata atattttcgt taccggagat aggacgggga aaagaacgag
   114301 cctagcgatt agtttgtgca gggtgctttg cttcagtgga agattctcta atgcgaacac
   114361 tagtccgcaa agcataaatt cttctggcgt atccactttc atatggatta gtctgcgttt
   114421 gaactgaaaa ggattgagtc gcagttcttg cagtgtatct tccgagtcta gtattatgat
   114481 gccaatgaag ccttggaatc ccaactcttt ttcgcagatg gtcttgtatt ccaggccgtt
   114541 gatcatggtt ccgtcttcca agtggaacca tattccgtcg tctcctactg ttatatttac
   114601 taacgaatgt cgtgcgaggg atacacactt atcaatcttg atcaccttta ggatagttcg
   114661 gacgtgtaag gtgttgaata cgtctgaggt ttctaattct tttaattttt tcaaggattt
   114721 cattctccgg gtttggggag aaaatgttcg aatcgaaaat cggctcgttg ttttcggggt
   114781 gcgtttgggt taaattatac acttctgaga tctgatttag ctctcggacg tatacgagtc
   114841 ttaaataatg cttgattttg ctgctttcgt agatggctaa taagatttca ccgagggata
   114901 gaaagagaaa ttcctcggga attgattcga ggttgtaaat atttaagagt cgccttagga
   114961 aaggcacgat gagcagctcg atgctatagt tagagtatgt gatactttct tcctgtcctt
   115021 gattattaac gttttttctt aaccgaaagg ttcgcatgta ttccatttcc catagttggt
   115081 ctattcgttt gtcggcatat tgtgtgtccg ggatatactg tgaaaaaaaa ctgtttgcga
   115141 ctgatctggt gtcatctatg gagacgctag tgaatgggag cctttgaact atgttcagcg
   115201 ctcgcgataa agagagattc tcgaggtcat ggtccagatc cgggttatag cgatcacaat
   115261 cgttattcgt ctcgagcaaa gagtgtagat ctttgatttt cctttcgaac atttggtttg
   115321 ttgttttcag tgtttcgatt tcatccatct gtgtttgtat ctgctcctcc atgcacttga
   115381 taatttgttt tttgaacagg tctcgaacgt ctctctctcc tgtgtcgatc gcagagcgtt
   115441 ttcggaactg tcctcggttc agcataagtt tattttggtc tattatagag ggggtgattt
   115501 cttgaataaa tccttcaacg ctgtccctaa tgcctatttt agatttgctg tccgacaagt
   115561 tcagtaaaaa tttgattaaa ctttttttcg cgtcgctgtt tttttcttct ttttctatca
   115621 tgtccattat ctttttgttg gttacatctg tctttgctgc ggttagcacc tttatgggaa
   115681 atgtattcaa taattggcac attttttgat gacgccgcag actattgtgt ttttttagtt
   115741 ctggagaaag gtgggcgagg ggtgtagtca gcattaggcg atttctaata acatatgggg
   115801 tgctgtacgt gaaaaacgct atagccttct tgtttttaaa gcaagaaatt tgctccgaat
   115861 tccgatctcg gaaaatctta atattatgaa aatccggaat gatcacggaa gatagaccca
   115921 gtaaaatggg agtgacaatg ttttgtttat gccgcactat gtcgtggatt agtttagatg
   115981 acacttgttg tagaagattg tataagttcg gggccgtagg ggtggttctc atgaacggaa
   116041 cgattcctac ggtacagatc cagtctacat atctgttata gtgactgttg tctatgctct
   116101 gaaggataaa attaattata ttagatatat ctcccaagat cacctgttta atcgcgtgag
   116161 cccagacact aaaataatct tgaaatgaca attttttgtt gtggaacgga aatgacctca
   116221 catgacgttt ccattcatcg tggatttgtt gaatagaaac gctgtttaaa agggcttgag
   116281 ctactccata ggctatttgt tttttcagta cggcagaatc tcggagagcg ttgtggattg
   116341 tttgaccttt gaaaaaattt ttgtgtccgt gtagcatttc aataaaagtc attatctgct
   116401 cagagggata aatcatgtct atctcttcgt tgttcggagg tagatacgat aataagtttt
   116461 tgcttaacat gtcttcggct cccaaaatag agttgattgt agataaggtg gcttcgttat
   116521 cagaaagacg cttggagggg cgtctgccag aagattggtt tcgccacatc atggatcctg
   116581 aaaccgagtt caacggcgaa tttgctgatg ctctgtgcat cggtattgat gaattcgctc
   116641 aacctctgcc ttttttgccg tttaaggcct tgttagtaac cggtacggcc ggggcaggga
   116701 aaacgaacag cattcagacc ttagcggcca acttagattg tatcgttact gcaacgacat
   116761 ctatcgccgc tcagaatttg agcgttgttt taaacagaag taaatccgcg caagttaaaa
   116821 caatttttaa gacttttggg tttaatagtt cacatgtatc tatgagcgaa cgtcaaagtt
   116881 atattgcaaa tgacgagagg tcgattcaaa ttcaacaaaa gcaagacctg tctatctatt
   116941 ggaatgttat ctccgacata gcggagaggg cgttgggtgc tgtcgcgtgc aaaactaaag
   117001 agttacctga tttgtgtgag agtagtgtta tagttatcga cgaggcaggc gtaatattac
   117061 gacatattct gcacactgtt gtttttttct attggtttta taacgcgttg tataaaaccc
   117121 ctttgtatga gaacggaatt gttccgtgca tcgtgtgtgt ggggtcgccc acgcagagta
   117181 acgctttggt gacttcattt aatccgctga ctcaaaacaa ggacgtgaag agaggaatag
   117241 atgtactttc agccttgatc tgcgacgacg tgctctctaa atattgcgaa gtcgataata
   117301 actggataat ctttgtaaac aacaaaagat gtgcggatca tgcgttcgga gactttttaa
   117361 agcacataga atttggcttg ccgttaaagc cggagcttat agagtatgtc gatcagtttg
   117421 tgaagcccgc ttcgtacata agaaatccca tgaacgaaat agaaacgacc cgcttgtttt
   117481 tatcgcataa cgaggtaaag aactatttcc gctcattgca tgagcaggtt gaagttacca
   117541 acagaaataa cttgtttgtg tttccggttt attttctaat aaaaaacaag actttcgaag
   117601 actacaaaag tgaaattggt aatttctcct tagaaattga accgtggttt aaatctaata
   117661 ttcatcggct gaatacttat tctcagttcg cggatcagga tttatcgaaa actgttcaat
   117721 tggaggagat tgttttggaa gatgggtcgg tggaagagac tttgataacc tgtcatctga
   117781 aacatatcag aaacagttca ataggtgtga cgtccaagat caaggcttcg accgtggggt
   117841 tttccggaac ttatgaaaaa tttgtagaac tgttacagag cgatttgttt atcgaaaaaa
   117901 cgtcatgtga gcagactatt cacgcatatt cttttttatc cggtcttatg ttcggaggga
   117961 tgtattcttt ctgctgttcg gaattcacca cccctgaagt gttaatggag atcaaaaaca
   118021 taaagatgcc cagtattgaa ttcttagaaa gtgaaatgtc gaggatgtct cgagacgtgc
   118081 aaaccgtaga gacagatgaa aggtatgatt tcggattagt cgatgatggg ttatcagata
   118141 tggacctatt agaaattgat ccttgcggag atccattttt tactaggtat agtaagttgc
   118201 ctttaactaa ttctctgtcg ttcgaggaaa ttagtttgct ttatacgacg tttaaggata
   118261 tctttatatc taggtttgcc attctgcaga agcatacaaa agggaagttc ggaaagactc
   118321 tcctagtgac ttataacaga aacaacgttt ctagaaaaca gtgcggtgag atatattccc
   118381 atttaaagag tttttatggt atgctcacct acgctatccc tgccaataat tatactctgg
   118441 agggttatac aaatgataat gtagttcatt taggaacgga taaacaatta ccgcagatct
   118501 tatataaaaa aggattacct agattagtta taaaagatga aatggggttc atttctgttt
   118561 tagataataa cgtgtcgaaa tttgtcgatg tcgtaaatgg tcagagtttt catctatgta
   118621 caacggtcga ttacgccact gtttctaaag tttctatgac catcacgaaa agtcaagggc
   118681 tttccataca aaaggtcgca atagatttcg ggagtgatcc aaaaaattta aaattgagtt
   118741 ctatttatgt tgggatgtca cgagtaaccg acccgaataa tttaataatg aatgttaatc
   118801 ccttgagact gaattatgag aatgataatt ttattgctcc gcatattgta aaagcgttaa
   118861 agaacgaaaa taccatgtta atattttagg gaggtttttt atgagaatat ataaaaaaaa
   118921 ctaaaacatc agatgaattg tgcgtgtaat tgttgaaatt ccatacggtc gaatgagctt
   118981 attcccgtcg gtccgttttt tctgcaaaac aaaagtagca cggggattta gtgcagtatg
   119041 tctcgaaaaa gacaagggtg tgaaactatg aggaactgat gagaaatgac ttacggccat
   119101 gattttgttt cgtcgctaaa ttgaatacag ctgcagggat gtggtatgag ctgacatctg
   119161 caaaaacaaa tgaaagtctc ccccggagta cacgtatgta ctccggggga aacctcaaaa
   119221 atgcacaatt tagcctatta agcagccgcg aactcgttaa tagttacttt gatgttaact
   119281 caggtggtgg cttggatggt gtcctaagta tcaatcgaag ctcctttatt ttttgcacta
   119341 ctgaagttat tctaggtatc ggggtaagaa taagatgacg aaaaaaatat gctagatccg
   119401 tccattaaat cctagagttg tttttagtaa taataggtta tttacaaaag cctgcatatg
   119461 atccaatgtt tctgtatgaa tccagataaa caaaaatcca ggagtaatga ttggaatcac
   119521 aaaatgatta gttagatgct taacttactt aataactaca cttatagact aaacttaact
   119581 tatcaactat acttaacttt taggtcctta taatgtgaac taaataatca actgttttgt
   119641 gcccaacccc ccactactaa agcaatcgtc tttgatttat gaaacaacga ggcccacttc
   119701 acgttattac atagatcaag gtctatctct tggcggtttt ttaattcttc cgagagcgta
   119761 gcggtttcta ggtttcagac acgtttatcc attcgccggg tattgatcgg gtcatatcat
   119821 tagccgtgaa taatctctgg cttcatttcg atacaacgtg tgaaaactag taaaaaggac
   119881 aaaagcagcc gcctttgccg tcttcatgag cgtcaaacac tcatgaggtc cgtatcttac
   119941 aacacaatat atgaaatact gtgagcgagg tttaccggtg tccgagtcgc aatccgaaaa
   120001 tcatatattg aaatttgtaa caatgttatg cagttgtact caaagtatat ggtgatgaat
   120061 tgaacatgtt tttgatgttt tcaatggtat tcgaaaaata ttttagatat cctgtagttt
   120121 ttttctgatg acttttctga tgacttttct gatgacaata tagaagatgg caaaacaaca
   120181 agttactggt agttcttgat gttagataaa atgaatcgga gatatgacaa gtagagagag
   120241 gtaggtgata cgagtaaaat tgaagggtgt ttccacacag acgggggaaa ttctatgaga
   120301 accacagcca gaagcaattg acgacaatag agaaaaataa gcaagcatac tcatctcgta
   120361 tagaaagaac cagtgaccta cgattttcca ttcaggctag catggtgtga acgagggttt
   120421 tttccgaaaa ctagatgact atttctttaa gcaagtgtaa tttttagcag tccaagtttt
   120481 tatgcaacgc agattttaat gatgtgtccc tcgataacta tacgctggaa actaaactaa
   120541 cttacatctt ggttgataaa cgattttcta ttaaaaagac taaaggggtt ttttggcata
   120601 tacaaaattg tattgagctc ttggaagtgc gtagatgcaa aataggttaa atcttacctt
   120661 gaagctacaa caggtcaacg ttcgagtaga cgtaaattcc atatgtcgaa tgcgctgtaa
   120721 actttttcac ggaacatcaa aaacaccgaa tttattcacg tttacataag catgaatctg
   120781 caattttaat agtcccataa agctttcatt tcgatctaac tacattttag tatttatgct
   120841 tcataatgta tcaaagtgta tacattcaat ctgtataaga gtctgcatca agcttcacgt
   120901 gatttgtagt tcgcggttta gcattcgctg ttttgccgtg tatgagactt acagtttgat
   120961 ccctaatact tctgacgggc gacaagcctt tttatatgca ttttacggca aagtccacgc
   121021 ccttgtcgct gacgcaatac gtaaaggttt tcggtttgga tgaggatgtg gttaaccgtt
   121081 agtaaaaagt cgttacagta aaaaagccga acggtatttt tagatgtcgg gccacatttc
   121141 ggtttaatag atttttatat cgtgttcgtt gtctgactta gatatgtcgt ttcatgggag
   121201 aaataaatcg ttttagttgt atgcagtagt ttttggatcg caaacgctcg agcccggaag
   121261 tgtgattcgt gcgcataaaa gggcgctggt gactgtgttc gctagctcat ttgtgctaga
   121321 tgagcggcaa agaactcatc tttctgagat ttttctggga ttattctggt aaaaatgtat
   121381 gtctcgtttg tagtcgtttt tggatttctg taatgttacg atttgctatg tgtattttga
   121441 tggtgtcgag catgtttatt ttgttcttat tttcacacag ataagatgta tgctgaagaa
   121501 cgtggatatg ggtcatttga caatgttata caggcttatg aacaaattat tagtcagtct
   121561 cttcatttga aaaggtttga attcgacaat ggctgtttca ttgagttctt agctgactct
   121621 ggaacgtgtg aaacgttttc taaaggatgg atatcaatga tttattggac atcggagaca
   121681 gattcaatgg gttctctaac ggtggatatt gggatggatg aaggaaaatg cagaacgtac
   121741 agagctcggg gccttttact gtgttcaaaa tcaatcacgt cgatttctca gaatactgag
   121801 ggcagagaga ggattttgac tgtttcccat gaaaacggaa aacttcaaat aacgtttgtt
   121861 actattgcta aagtttcctc ggagcccgag ctacgaaatc tgggcgattt gaaatttatg
   121921 gaaaagtttg aaaaagaatg tcgagctcta gacaggaaaa aacacgacga tgaacacaga
   121981 aaacgctcgg ggaagcagaa agaaaaaaga aaagtggagg acattgacaa aaaaaaagaa
   122041 gatgagaaac gaaaacaaga agaaaaaaaa cgaaacgacg aagacaagcg gccggacaaa
   122101 aaggatgaat ttgatggtaa atatgaatgt gtagctgttg taaatttttt tattattggt
   122161 gtgtcacggt cgtggacttt tttaaatagt atctgttttg ttgtgatttc agaaccccct
   122221 aaggagaaga gacagaaatc tcaccacgaa acgaaacgta atttggaaga acaaagtcac
   122281 gaagatggca tagcaccgac ttctacgaca ttcgtgaatg gagcggttga gggtgcgtta
   122341 tcgccctgtg tttctattga taatcacgaa gatcaacaac atgatgaatt agacaagcgc
   122401 gtttatgcgc aggtgggtgg agttttgggt tcaccaaaac ctaggtcttt ggagtctttg
   122461 ttgtgcgtat ctaaagctga tctttttctt ttaggggacg aaccgagaag gtctatccaa
   122521 tgaagataat tatggaaatt ttcagcttaa taagtcttta gaacagctta gggccagact
   122581 tgttgcaagc agcggcgagg ttgtagaaag atcgctttcg aaattgaaag agcgtttgga
   122641 ttatgtaaag gataatttaa taaaaaatgt acttgaatgt gctgatgtta ctgttccaag
   122701 taaatgttta agtaaaacaa aacatatcga gcaaaagaaa cagatagtgt tttctgattg
   122761 tgtcaggtcg gtacctgtgt gtgagattaa accgtttatc gacatgcgag tatttgaaac
   122821 tgaaacaacg cagaacgcaa gaagagttcg acaacggacc agaacaaccg tcggatcaac
   122881 agatggtgca atcgggcagc agcgtgttat ttcaggacaa aaccggggca gagcacgagg
   122941 acgtggccga gggagagttc ccaggagacg gaattccaat ctaaataatt taaggacaca
   123001 aaattctgca attgtcatag acgatagcag cgaaaccgaa aactttgaaa atgctgggag
   123061 ttttaatgaa gacttactgg caaccacaat attggaaaca ctgtgaattt tattgctgta
   123121 ttgtaattct tatgtaaact aaataggttc tattcgttca gaatgttcca attgattggg
   123181 tctttcccgt gctcagtaag aaataaattt gttcgcacaa aatgattgca accaataaat
   123241 ggcattcttg cagatttcac tttgggtgat ggatgtgcac tttctaagac gagatgtttc
   123301 tgtgcgtcta ttagataaga gagtttccgg gcatgttttc cccacaacaa gaaaacgaga
   123361 gagttcattt gttccgatag tctgctgata atcttgtagc tcagtgtttg ccaaccaaat
   123421 gcctcgtggg acattggtaa tccatgaact acagtgaata tcgagtttag cagtaggact
   123481 ccttctctac accaggagtt taaacagccg ttgtcagggg gggaaaaatt cgggatgctt
   123541 ctttccagtt ctttaaatat attctttaga gattctggaa tcgagcactc tttcactgta
   123601 ccgaaggcca aaccgcaacc tctgccgtcg ggatacggat cctgtcccag aatcacaact
   123661 ttaacatcgg tgggtttgca caaaaaactc caggcgtgga cgttatccga agaggggtgg
   123721 acggttagat gaactctatc gttgtccacc aatttataaa catgcttaag atgtgtaatt
   123781 tctaacttgg agagttgcag gaaactcaac cagtctctgt ttatgccgaa gagtgaatgc
   123841 tgatcatcta ttgaaaggtt ttcatagttt ttttcttcat cctgaacgtg atctaacatc
   123901 cactgtagta gggccatggt tgggaaatga aatgcagtgg attaaattcc ctaggagcat
   123961 tttatgtgaa tgggacgtga tgtcatagcc aattatgtgt ttctaatcag aatcgtaggg
   124021 cgggaacttc ggaaaggtag tttagaattg taggcttcca tctgttttag caggtcgaat
   124081 tctactccgg ttttcaagtg gaaatacttt aaacaattca aaatcgtatc aaagagagtc
   124141 aaagagttaa aagggaacct gataattttt gtgatgcctg tagcaggatt ctccaagtat
   124201 aataaaaaac caatgttgct gtaaaaactg tctgtgtttt ctgaaatgtt aaactcgaga
   124261 cctgcaatgt tatcaacaaa aaagttattg acgtacgtaa ttctttcagg caaatatttt
   124321 ctacagttat cgctgatgca ggttgttatt ccgacggaag gcgaacatgt ctggaagcca
   124381 ttgaaaaagt ttagccaatt gtcccgagat tctgggtccc ctatcagcgc aaacaatgtg
   124441 cgtagttgct ctgggttatc ctgcagaagt aagaagtcgc tgaggaattc attggttacc
   124501 attatacggc taaaaggctt tttttttgtt gggggtttta gcagtattga cataacgtct
   124561 tcattatata ccggaggctg gtagattggt tctagtaata gaggtacttc ggatctcgtg
   124621 caatttatta cagctgcgat acagtcgtca agtttttcaa aatagaaaga attgtggtcg
   124681 aaaagaggca tcgctttcga gaaggttagt aatatgagtg acattacaaa tagtaaaagt
   124741 tccatggtta ttttttattt ggagaagtta acacgacggg aacaacatct tatatacagt
   124801 agggaaaaag acttgtcgaa atgttcattt ggctttttat tgtttttttt tatgcggcat
   124861 atattggtat ggctatcgga tttatcggta gttcccccga tgcggagctg tcttcagaaa
   124921 attcacgtat ttcgtcttct gtcttattag gatgtttgtt gtgttgcaca gattggtccg
   124981 ctgtcgtacc tgggaagaca gagactttca gaaaaccttt tgttgcaatc atgattaaaa
   125041 agctaaaaag ttgttttgct gcttacctgt ctgatttaga gcagggctcg atgtgtgata
   125101 tggcaaacgc atcgccgaca agtcttgaat taggattgtc gaaattagac aaagaatcat
   125161 gaaactattc gaagacatta atactggttt tctttctcgt tatgacgatc aatatagagg
   125221 acgcaaagag agaccaattt agattcgagc caaaaaagtt tattttgtca gtttaatagt
   125281 ttgccataat catcccaata aatatatttg ttgaaagagt tgtatatggt gatgtgttct
   125341 cgaaggagca tcggttgtgt tagcttcgcg atattcagag taatctcgtt gggatggcag
   125401 attgcaaaat tgatacaaac gtgagcggcg cataataaat ctttttccgt cggcgcgttt
   125461 atcatgagag agcaaatgcc gacaagcttt ttttttgagg cgtttaccgg tataggagct
   125521 acagcgtttt ttcgaagtgc gtccgtatgt gggacggtcc ctctaaaaaa ctgattgatt
   125581 gcaatagcga ctaccggttc atggtgaacc gattcagaaa ttatttgctc gcccacgtta
   125641 ataaccatgt tgccaatgga catcaatttt tcttgcatgg cgtttattaa gattttattt
   125701 cgggaataaa cctgtatttg cacaattgaa gcgttgtaac agcggaataa tctgtaaatt
   125761 tctgacataa aatttttagg tgagcacggg gagtagggtg gagatgtttc gtaagattga
   125821 aaaattttga aagcgttaac tgcattcgga tcttgccttt ggcattccgt agacttgaca
   125881 atttcctttt tctgcgtcgt tgatgtcttt acaggcatgt tgaatgatag gtcggcgaga
   125941 ggtttgtccg taaatgcgga aaaacgatta atttctttat cttggtgaaa cacggcgttt
   126001 gagattttcc gtagtttgga atgggcgtag attgcgttat ttcgatattt ttccttatta
   126061 aattttatgt cgggcgaggt gtgctgggga aaggctcttg cagtggcaga atcgacgggt
   126121 ttatcggttt ggacggtttg cgaagataga ttgttttgta atcgattatt tcgtatagtc
   126181 gttttggtgg ttacattttt tttccgttct gtggacggtt tcgttgtttt tctagttcgg
   126241 cgagatttga cggtcggtct tgttttagag gtgtttttat tacctctgtc tttcatctct
   126301 tctgaactta agccatataa attttaactt ttaaatgcaa cgatgcacat cgaaatcagt
   126361 agcaccataa ctgatattat caatatcaga attaatggta cgatccaggt aaatacggtt
   126421 tcgtcagaat ttgagccttt taccgcttct ttactgtatt cgtcgtgatt ttgcacagtg
   126481 tgttcgccgg aagttacgag agcgctagcc ttttggttgg taaaccagct cgacgctaga
   126541 catgagatgg tttttccgac aaattccagc ttggttcgtc ttttgaaagt aaagctcaca
   126601 ctaacggttg acgatccgtt ttcattctgt ctaaccattg gtatgtctct cttatatact
   126661 tctccaagaa atttaataac cacatttggt tttggataag acgtcacggt acacgtaacg
   126721 tctaaaaaat tgtttaggta acgaaaatac aaaacgacga tgggtttcat aatgagtttt
   126781 aagcaactag tcgcagatgt tttctcgtta tccactgtga atgtacaggt taaacatgtc
   126841 gcgtcatatg ctgatctggc tttaattttc aacagagatg tagttctatc gtgttttatg
   126901 tggaaataca atttactgtc cacgtcaaga ttgttgatct tatttagttc gtgtataaaa
   126961 acgtagccat cgtcagtgaa cgataagttg tccatgtttt gtatctcatg attcgatata
   127021 agtcggcttt tattgtacca cgagacgctt tggatgtttg tcgttgtgtt gaggcgacaa
   127081 tggaaagtaa cagttgaccc tatttcgtat actaaagaag gactcgtctc cgggcggggt
   127141 acaaaatgtg cgcttatgat aatacataga agcggcaata atcgaagcat caagggactc
   127201 atagtgtaca cctgtgccaa atagcagttt ctgcgccaaa tagcggtttc ggatatatat
   127261 aagtcacacc caaaataaaa aaagtcaagg atttccgtta tactgtttta tttttttatt
   127321 taaaaaaaaa gttaggagtt aacattttga aagtgtaaga tatttcgatt taaaatctct
   127381 gctgacagaa ttatagatag agatagaatt gtcaccatca atgattgagc agacccgaag
   127441 gacaatttct ttaggtttat ctttggcata cttattgcat attttagaag ccattacaaa
   127501 gtcgatgggc gtagcggcgt aaaccataag agtttttacg tccgaatgtc tcgtaaatag
   127561 atcatgtgtg ttgttttcaa gtttatccca caattcttga ggtccttgtt tttgtagttc
   127621 tataaattga ttaattgcat ctttatcata atagttaggc ggtgcatgat tcatcttaaa
   127681 tggctctgaa acagtgatgt tgggtcgaat cattaattct ctttgcatcg tcttaatgat
   127741 ttctgctact tgttttgatc ttgtaaagta cataatgatg gctccggtgt tagagcatcc
   127801 attagaacag atgttgtata cagcttcttt tagcttgttt tcagggaaag gttttttggg
   127861 aatctgtttg tattcaaatg ctcgtatggt atttctaaag agttttctaa aatcttttgt
   127921 agacaccctg ccgcggtgaa ttttatattt tgccgattct tttttttctt ttcgtctaac
   127981 atattctcta taagacaact cttcttcaat ttcacttatt tcagaatctg ttttctgcgt
   128041 tccagatatt cttttcttga agaaattttg catactggaa tctgaatcat catcccgggt
   128101 gcgctttttt ttgcattttg ttgtgttgcg tgatatgtta ctttggttat cccgtgggcg
   128161 ataaattgtg ttagtggtgg tgttcgtggt cttaggtgtc tttttttgtt cttgatcaat
   128221 ggcgttttct aaatgattgg attgttcatg tgtgttagat ggactagaat tgtctagggg
   128281 aaatttttca cctgttttct gggagtttct aaacatatct gcatgtctat gttttgattc
   128341 gtgatttgga gatttgattt tggttttgtc tcttgaagct gatttaggtc ttgtttgttt
   128401 ttctagttgt tgtagtctag atctaggtga atatgtggca ggatcttcac tgtttttata
   128461 tcgacttttg cgccaggatt ttgatctgga actggaacat gatgaagaga ctgatgatga
   128521 tgatgatgat ctagttctgg agtgctgata gttaaatgtt ataagcttgt ctgttccggt
   128581 ttctgtacgt gaattagatc tggaattttc ttcaatactg gaagagatgc ttgatgatcc
   128641 agatttgtgt ttttttcttt ttggagtatt gagtgaatct ggtgaataac gagagtgaga
   128701 tctggatcta gatgtagaac tttctgaatc ggtgtaattg gtggattctg atttttttct
   128761 gttggttctt atatgaggtc tgaatcgggg gttgtaaaat tgatcattgt ggttaaagga
   128821 ctggagtcga gctgcagcat ttttgtagaa attgagttca ggcccgcacc gaaatttgat
   128881 ttctgatact tcagcttctg tactaattga ggtgtcatgt ggatatattt gtcttttatt
   128941 agaatcgcaa taaatctgcc tcggtttacg tttgtttgaa gttttttcat aagtttgagg
   129001 ggaaggtatg ttggacatta atttattgtt aggggtttta ccggaggctc tgctggaggc
   129061 cctgctggaa gctttgctgg aagccctgcc ggaggccctg ctggaggccc tgctggaggc
   129121 cctgctggag gccctgctgg aggccctgct ggaggccctg ctggaggccc tgctggaggc
   129181 tctgctggaa gctctgctgg aggctctgct ggaggctctg ctggaggctc tgctggaggc
   129241 cctgctggag gccctgctgg aggccctgct ggaggccctg ctggaggctc tgctggaggc
   129301 tctgctggaa gctttgctag agactctgct ggaagctctg ctggaggccc tgctggaggc
   129361 cctgctggag gccctgctgg aggccctgct ggaagctctg ctagagactc tgctggaagc
   129421 tctgctggag gccctgccgg aggccctgcc ggaggccctg ctggaggccc tgctggaggc
   129481 cctgctggag gccctgctgg aggctctgct ggaggctctg ctggagactc tgctggaggc
   129541 cctgctgaag gctctgctgg aggccctgct ggaggtcctg ctggaggctc tgctggaggc
   129601 tctgctggag gctctgctgg aggctctgct ggaggctctg ctggaggctc tgctggaggc
   129661 tctgctggag gctctgtcag agacctcggt gaaagtttta ctcagaggtt tatcagagtt
   129721 ttcgccatta gtttggttag aagtttcaga tttattttcg gtggaactgc agttaggttt
   129781 cttgtcagta cattcatcac cgttagaagt gctattcatg gtgctgttgc cactgttgga
   129841 tttgttaaaa gcagtaaatg agctaggatt ggaatgactc cgaataggtg aattgtctgt
   129901 taaatttttg ttggcgcctg cagagtgttt tttagacgca cagtttctgt tcatagttga
   129961 aggagtttct tgcgtggggc atgcagaagt tgatggaata atagtttcat tacaaaatag
   130021 ttgtgaaaat ggctgaataa tattagagtc ctctatttct gttttatttg tattttcatt
   130081 ggaaaaactg tttaagtccg tattttcggt actttcttct gttttatggt ttgttttgct
   130141 gttgggggtt gttttagtga aattatcata gaatttatct gataaacaat ttccataatt
   130201 gctttcactg ttgttggggg atttgtattg gccttcttca gagctactgg aatcatgtat
   130261 acaatggtgc gtttttgatt ttggtggtgt agatatcttt tcattgtcgg gtgaggtttt
   130321 atattgttca tcagatgttt tgccgtgtag gttatgtgag ggatcagact tttttgatgt
   130381 atttttggcg gctttccctg aaacattttt aacggctact tccctaacgt cttggtgtcc
   130441 gttggagttt gcagtatttt ttttagatgt cgtacgtccc cgagaatgtt tcattttagg
   130501 atcattagtg tcttttgggt catgatgttt tttgtaagag ttatctttgg tcggggctct
   130561 tggagcatgt tttgatatga gaactctgtc ttgtagagaa gtttttgatc ggtgtatatt
   130621 tttttttgtg tggtggagtt ccgagtcaga atgaatttta gttttatgaa ccgcaaagtt
   130681 taaggtgggc tcaggtgtca tcggaagagg agatagcagg ggatctaatt ttgaaaaatc
   130741 tctagcttca gtaacggctt catcttcatg ctgattagat tttctctgtt taagatcaga
   130801 acgcgatgga acatggtttt cattatgttt ttgtacttta tgtttgttta ttgtttgaga
   130861 actgtgtcct tttgtctttt ggattgatct acaacggata tgtgtttttt tgtacttctg
   130921 agtatccacg ccacaatatg agccattgtc tattagtgct tccttcggta acgggataac
   130981 ttcagtgtca tatatttttt taatgagatc cattttttgg gaactaggtc tgtatgataa
   131041 actgattgcg tcaggagacg ttgaaacttg ctgttttttg tgttctttgt tatccttagc
   131101 attctcatgt tctttagttt tcgtagtttc tggtgttgtc tgtgtttttg ttggataatt
   131161 gtgattgtca gattgtacgt atgtggggtc tgttgttatt gaagtctgtg aaaatgccat
   131221 gctatagtct tgggcttgaa aattgaagtt ggttgttagt tgtgtaacat ctttatagtt
   131281 attcatacgg agatctggat tatattgttc atagtttgga tgcatgtatt gttgatatga
   131341 taaatctgcg ggtctgtttg agaaatcgtg tagtctgtgg cctcttccgc gtctgttata
   131401 acttctggga aaaaatcttc catatggctg ttgatacttt gagtttggat tgaagtaatt
   131461 acgactatcg tatcttccct ttcctcctct gggcctatgg gaatgatgtc taaagttaga
   131521 gtcatatcct ctatcggtat ttctagattc tctgtaggaa ctctctatac tcctgtatgc
   131581 atcataatta ggttgatacg gcaacgaggt gaaattgcac tgtgaatttg tagtttggtt
   131641 ctgtgatgcg tacatgggct gtaggacttg atctggcagt tcggaagcaa agcgcatatg
   131701 gatcgaattg tttccgtttg atggtagatt ggaagcagag gatgtgcatt gtctgtggat
   131761 ctgagctgct ctccgtggat cctggggagt tcttgaattt tttctggaat cttgagaaga
   131821 tatgggatct tgatgcgtat tctcactcaa tggttgtcta tgtgtgacgt ccgcatcatg
   131881 gtatagtccg gataatttca tggcttggtg gacaacgtcg ttatgagcat ttgcttgttt
   131941 ggatttttgt tctggaaaac atgtttataa aattcaagct taatagatag tatttttccg
   132001 tcgattagtg atacgcttaa tgtatttaat aaattatgga taatcatttt gattatgata
   132061 catcccgtgc agagaatgat gtttatacag attgtgcgta gtatgcaaat gaaagttatt
   132121 ccatcgtttt gtaatatgaa aagtttcaaa tatagtaaag aaaagtacat atacgttttc
   132181 aaggtgtgtt ctaataaaat gatgaataaa atagtagttt tctatagaac gtattataga
   132241 cttttattgc ataataatca ttgagtaaat acgtggagac attaaattcg tattttgttt
   132301 tttagattgt tgagctatat agataaattt ggatgataaa gacgttataa tttgtagtga
   132361 aattcactaa atcgttttaa gcttttatat ttatcaatta agtagtaact ttccgtggaa
   132421 atgtcgcaga agcggaataa tgcatttact aattggaaaa gatgtaggag agtggtaaaa
   132481 gcctattggt ttcttaagta tgtatatcgt gcgatgtgtt attaactagt tagatgtgga
   132541 ttactaataa tggggggggg ggaaattatt cgcataacat gcaattaaaa ttcaattcaa
   132601 aatttatgaa attgacatta tttggagaaa ttttatggga cgcatgattt atataattga
   132661 tctattaaca ggccaagcga cgggatttag tgagcatgat attaaatctt ttcattcagt
   132721 agttgaagtt attttcgtgg ttgattacat ttttgaataa ttaatggtat ataattaata
   132781 ataagtaggg ctaatagtac aatttattat cactattctt atgcgatgag ttcaagttcg
   132841 ggcgctgaaa aaatacgtgt aatgaacact ttttttagag aacttatgtt attagagaat
   132901 ttatgttaat tagtagttca ataatagaat ttatgattta tcaatcacgt gatatgccat
   132961 atatttggaa atcgcgtgta atagtatatt aggtgtcata tattaatttc atttaaaact
   133021 aggatgaaca ttaacataaa ttatatataa tacctgatga agttaatggc aattgaattg
   133081 gatggtatat taatttatat ttacttattt gcattagatt atattataat aaaattgttt
   133141 taatgttaaa aatttaaatt attgatgcat tcattattgg cgtgcagtaa atccagtata
   133201 atgggtaaaa gtgagattta ttggaggggg gggggatgta taatatccat gtttttaaga
   133261 tatggtaata tttatcaatt atctaattgt ctaattctgt tggttgtcta cagggaacct
   133321 atagatatat tcaggaataa ttggagttga aattgctgaa gtttgtgact accaaagggt
   133381 taatatgcat aatcaaatag atactgatgc taccgtgggg atggatatga tttgataatt
   133441 aggatacaat tatatattat ttattatgta ttatggagat gacataattt aatataatac
   133501 attatatgat aatttaaagt ttatagtaga ctagttttat tatgtttcta atgtgatagc
   133561 gccctccgct gttcaggtaa attatatgat attgaatgtt ttgagtagac tagtttgatt
   133621 atgtttatga tgtgatagcg ccctccgctg ttcaggtaaa ttatatgata gtgaaagttt
   133681 tgagtagact agttcgatta tgtttctgtt gtgatagcgc ccttcgctgt tcaagtaaat
   133741 tatatgatat tgaaagtttt gagttgacta gtttgattat gtttctgatg tgatagcgcc
   133801 ctccgctgtt gaggtaaatt atatgatatt gaaagttttg agtagactag tttgattatg
   133861 tttctgatgt gatagcgccc tccgctgttc aggtcaaaat ttaagggttg taaatagaca
   133921 tttttaaaat attttaaacc taaataattt catttattgt gctttttgtt aagatgctga
   133981 gtttgtgtgt gtgttgtgtt tgtgtgttgt gtttgtgtgt tgtgtttgtg tgttgtgttt
   134041 gtgtgttgtg tttgtgtgtt gtgtttgtgt gttgtgtttg tgtatgtgag agagaaagag
   134101 atagagagag atagatatat gggggggggg gaatatataa atatagtaat tttgaatctg
   134161 tgtttccaaa attgggaatt atgcgtagca tcccactttc aaagtgattt cagttaataa
   134221 gatgttggat taaagatgga tttggtattt tagatttata ctttcaagtg tttggtggaa
   134281 aacagataga acaatggaac gttgtctctg aaaaaaaaaa actagtagtg tgacatttag
   134341 gaaatgtggt ttggatactt tcatcgtgta aaaagtcaaa aggttgaaaa tgtttttttt
   134401 ttcatgaata ggagctatta tgtgaatgtt gaacaaaaac agattaaata gacctgaaag
   134461 gataatattg tgtagagtgc tacggtctag ctacaactaa tgtaatacat tttttagcag
   134521 tactatgatt tataaaatta agatgtcccc ggggcattag tcttaataaa ctggtttagt
   134581 ttggaaaaga gaaagtgaaa atctgaatac ttggcatctg tataaggttt tccaagaata
   134641 caattgttta tagtatcaca tcttcaagaa agctggaatt aacttatgga aatattgtat
   134701 gatgacttat aagtcagttt atgtacgtga cttggaatta aaaagagaaa gcaatgtctg
   134761 tatgactttt tattatttgt aaggtgatat tgaaaataaa ttcctttgag aaatcacatg
   134821 tttgctgagg ttttacataa tagaaagagt tacatttgct tatgtaattt ctaatctata
   134881 gcaatataaa gagttacaca gtatggggaa agtatgtatt ttacaacaat ataagcatat
   134941 ttacataata cacatctgta tgttaatgat tgctaatcaa tttacatctc agtttcatct
   135001 agctaataaa tttgagcatt ttcttcgaat ggatcataat cagaggggta gccatctaat
   135061 ttaaagacct ccattttatc actgttgcaa tcacttctaa tggtacattt ttcattatca
   135121 ttacttgtac cttccgtaca tctgttctca tcattttgac atgttgtgtc attgataata
   135181 tttagtatgg gggagttatt tcctgttccc tgtgggtcaa atatttgagt ttcggctgtt
   135241 acaagatttt gggaatttgc cacatttaaa tttttctcac atgcggtatg ggtgataaca
   135301 gtatatttac tggaaagatc ttggcaatgt ttggctatgc cgtgtttaat gatatcagtt
   135361 agatccataa aattttccat gaccatttct gtgataagtt tcttggttgg tgttatgtct
   135421 tccaagtctg ttttgctatc ctgtatttta ctataagtat atgagacatt ttccttctca
   135481 tattcttcat catccgtttt aatgggaaca aagtgattga tgaagcagtg attagcttct
   135541 gtcacatcac tgtcattttt tacattcatt tttgcagaac tgtgtataac acaattgtct
   135601 actttgtgag ttttcctcat aaaccacaac caatgttttt tgggaacaaa tttgtttctg
   135661 atatcatggg tacccggcat tgaccttatt gggatggtaa acactgggga tggaaaacct
   135721 ttactttgac aatgaccatt attgatcact ttatcataat cactcaaatg taagtaatta
   135781 tcttcagatg tacagtcatc tgactcgcta ctcgattcag aattaggttc tgatttaata
   135841 gttttttcta acattgactt atcaataata ttgttaccat cctcttcatc ttcactctct
   135901 gaacttataa caattacgtt tgtggtttca ggtaacctat ctagcttaat ttttttagat
   135961 ttggatggtt taattggaac atttttcctt ttagctgttc tctttttaga tttgcatttt
   136021 tgagacacag ccacaatttt ctcagttttg tgatcttcct tagaaggagt gacctctggt
   136081 ggtgaatata gagacttgct aaatggtgta ttctcattag tgttattcat atgaatgtta
   136141 ttagttctga cagttgaatc acagtctgca atgtaatcag tttcatcatt gttatcgctt
   136201 tcactctcat aaggtgctga gtgatcagtt tcataaccaa atgttatcat ttctgatatt
   136261 aaagggttgt catggaaacc atcacataga ttcactagac tctctacagc ttccatttct
   136321 ttgtctaatt tgctttctgg atttagagta tcctgaattg caccatgact tttgacagga
   136381 gttgctgagt tggtaaaggt cataccagga agcgtttcgg tacacttgga gttagaacct
   136441 ttttcctgaa tccattcttt tgtctgtgac cttttatcgg ggctgtaagc caaaatgtct
   136501 tgttgtccag acccggtctc tacaactact gagtcgggtt gagtttcaag tagttttttt
   136561 atcaagaagt gtttaccact ttcaaggcca gtaatggatt taaagttatc agggccgccc
   136621 agatctgtca ctgaggctgt acatacacag ttagggcttg tttgttcttt ccctatctgt
   136681 ctgctatatt caatgaatgt ttttgcctct ttggatttcc ctggcacatc tggagaagga
   136741 gtgtctggat acatttttcc tacatctttt tcatgtatgt ttgtaagttt ttgtcttgtt
   136801 ggggattcat tgttctttga cggagtggga atattattat cagtaggaga ttgtacttcc
   136861 atgtatttta aatagtctac attgtcatca tcttcatgga tagattcgat agaagattcc
   136921 tctgaatatt ttccatgttc atcaaaatca gctaactcta ataatattga ttctgacggg
   136981 tctatgttta aatcacagat ggaagactct ctatttttat ttatagcaat gtagccttcc
   137041 attatatcag aggaagttaa aggtttaatc aaaccagtat catcataaat tgtttctatg
   137101 cattcacatg cgtgggtgat catattcatc atggtaattt taaactggtg tctgcgaggt
   137161 ttgaggtatt gccatgaaaa ttcattgctg catagaacaa tactttggag aacagcaatg
   137221 ccaatatttt tggcggcagt aattaaattt ttacaattta tatgaatttt gaggaatgtt
   137281 ttatcacagt tatccataaa gatttgattc atctgcttat tagcaaattc ctgaaacatt
   137341 ttcatatttt taacatggtt ttctattatc tcatttctac tttccagtag ttcctgttta
   137401 agtaaattta cttgcttaca aaattcctta ttggagattt caggattgga catctctttg
   137461 ttgtgtgcca tcaacaacaa tgaggtggcg accatgttca attttccact atctaatgcc
   137521 acataagctt tggaaaaaat gtttttgagg gctgtaataa attgattgtt catattagct
   137581 ttcaaatcca tgagcaaatc tctggattct gatgctatct ttttcactaa cccatcaaat
   137641 ttatcacatg caaaaacaat gaatcgcggt tcgcaccaat taaaaaaatc caagtttttt
   137701 ccagacaaca tttttgcata acatgaaaca aattgagatg aagcactact tagtaaatta
   137761 atatttatca actgtcctaa ttgttctaat accagcctct ccaacatgga tctgtgcagc
   137821 gttaataagc cagcggagtt aattaaattg tcttccatgt tagactgttc ctgtttcatg
   137881 gcagccttca ctgatgcacc aatactttgg atgcaattgc caacggactg agctaggatg
   137941 taaaagaaga tattctaagt atgctatatg ttacatgctt aaaactatgt ttttttcttg
   138001 ttttctatct tgggacatat aatatataat tcatgtactc accaaccaaa gttttgaatt
   138061 cgtcagatgc tccttcttcc acattactgg aataggacac attcttggaa gcgatgtcgt
   138121 tggaagactc tgggatgaaa agatcaaagg cttccagttc tggaaaaagc aggctttcaa
   138181 aggacacatc acacttgaga ctctcttcca atatttcttt gatggattct tccaccactg
   138241 gatcgggatg gtagctgtaa gtatgaatat ttcttagtac ttagaaaaac tcccatatag
   138301 ttttaaataa gatagatcta ataaggacta atcatactta cttttgcata cgttcctcat
   138361 tggattccat gttgtttcca gagggttttc cgagaatgaa catagaagta gaggttgtat
   138421 cttttgctga ctccattgta tattaagatg caaattcaga caccgcctac tgttctgtta
   138481 gccaatgaaa aaatatcttc tgtcagcaga tataatacta tataaggaga ttaccaccac
   138541 ctctttcttt gcagagatta ttctctgctt gaaaatctgt aacactgatc atgatgggat
   138601 atgaggaaaa agtgtcagct actggaaaga ctcgtttaaa gatactggca tgtctgatcg
   138661 ttttaatact agctgcggca ataactatgt taacgctgga aattatatcg aaccaaaaac
   138721 gtaccactac tgatctcgaa gctgtgactg tggcgctgaa gcatgtaagc acatctcttg
   138781 ccaactgcac tgaatccact acttctgtac ataccggtta gtgaaagata tgtctttttt
   138841 atgttaatgt attgattata tatttgcata cattccttaa gaatggaaaa atcacggatg
   138901 gtttgttttt agattctgtg acgagccaac ccacgaaaaa acaaagaatc gaggaaaaaa
   138961 attgaaggga aatctccaag ttgggttcag gctttaacta cagcatctgg aattatccta
   139021 ctgttttgta taatgatgat attcattaca tgttcctgga ccacagaaaa agatacagag
   139081 aagagtgaag tgcaatctta tgcttcttca gtagagactt tagactcttt aaatgaggct
   139141 attataccga aaactgaaat gaatgtgtaa tgtctgtatt tttctttaca gagatgtacg
   139201 gagagtttat atttggggaa aatacctgac tgttctgcct atatgcgaat gttaaagtat
   139261 gtataatata aattcttacc ttttaagagt gattcaaggt ggaggtttct ttggagattg
   139321 attccaggtg gtggtttcgg gtgcaatcaa tctttcttct gggcgggaag aaaatccagc
   139381 aatccaataa ttgatgggat gtaatcaatg tcacaaatct gtaagattaa atgtgaacag
   139441 tataaattct tttgtgctta tcaaattaca attatgcgca tgaaaatatc attaaattgt
   139501 tttaaacatt cttaaattca atttaaaata atttttgtag caattttaaa tattaatagt
   139561 taaaaaattg acttaccaga ctgcagcgat ataagaaaga atctctgtga tgagaatgtt
   139621 ctccggagcc acttcttgag aaaagtggca ctgaactggc tgtaacttct gcttatatac
   139681 aattctatag cgggtgtgat gtacaggaaa atgacgagga tgaaggagcc aatcgctgta
   139741 taatgttaaa ccgcaagtgt agaaatacac cccttttaga caaatatgga atggaaatta
   139801 gctgatgctt acaaaaattt agggttttgt catatcttac tcaaaaacag gaatttgtgg
   139861 tctggatttt ttgaggtttt cttcttatgg ctgacttgta tttttttatg agaaagacgg
   139921 agtttgcggt taaaggcggg ataataaaga acactttact gataaattgt catgtttttt
   139981 tttaaaaaaa aacatctgct acacatcatg aaacaggaat atggttttgg tgttagcgct
   140041 tctcacgaaa taaatgactc agtcagggga aaatgttgta accgcggtac acactgacct
   140101 ttaactttat gagaaaaaca ggaactgcgg ttgctctgtt agcagatttt agggttctcg
   140161 ttagcctggg taggaaagac cccaaccaca gtacccacta acctttaact ttatgagaaa
   140221 aacaggaact gcggttgctt cgttagcagt ttttagagtt ttaattcgca tgaacaggaa
   140281 agactccaac cgcaatatct gctaattttt aactttataa gaaaaacagg aactgcggtt
   140341 gccgcgttag cagcttttag agttctcatt cgcctgggca ggaaatactt caaccgcggt
   140401 acccgctgat ctttaaattt atgagaaaaa caggaactgc ggttgccgcg ttagcagctt
   140461 ttagagttct cattcgcctg ggcaggaaat acttcaaccg cggtacccgc tgatctttaa
   140521 ctttatgaga aaaacaggaa ctgcggttgc cgcgttagca gcttttagag ttctcgttcg
   140581 cctgggcagg aaatacttca accgcggtac ccgctgatct ttaactttat gagaaaaaca
   140641 ggaactgcgg ttgccgcgtt agcagctttt agagttctcg ttcgcctggg caggaaatac
   140701 ttcaatcgcg gtacccgctg atctttaact ttatgagaaa aacaggaact gcggttgccg
   140761 cgttagcaga ttttgaagtt ctcatcctta ttagcaggaa agatttcaac cgcggtaccc
   140821 actaaccttt aattttatga gaaaaactgg aactgcggtt gctccgttag cagattttag
   140881 ggttctcgtt agcctaggta ggaaagaccc caaccgcggt acccactgat ctttaacttt
   140941 atgagaaaaa caggaattgc ggtttccccc attagcagat tttgaagttc tcatccttat
   141001 tagcaggaaa gatttcaacc gcggtaccca ctaaccttta attttatgag aaaaactgga
   141061 actgcggttg ctccgttagc agattttagg gttctcgtta gcctaggtag gaaagacccc
   141121 aaccgcggta cccactgatc tttaacttta tgagaaaaac aggaattgcg gtttccccca
   141181 ttagcagatt ttgaagttct catccttatt agcaggaaag atttcaaccg cggtacccac
   141241 taacctttaa ctttatgaga aaaacaggaa ctgcggttgc tccgttagca gattttaggg
   141301 ttctcgttag cctgggtagg aaagacccaa ccgcgatacc cactgatctt taactttatg
   141361 agaaaaacag gaattgcggt ttcccccatt agcagatttt gaagttctca tccttattag
   141421 caggaaagat ttcaaccgcg gtacccacta acctttaact ttatgagaaa aacaggaact
   141481 gcggttgctc cgttagcaga ttttagggtt ctcgttagcc tgggtaggaa agaccccaac
   141541 cgcagtaccc attaaccctt taactttatg agaaaaacag gaactgcggt tgctccgtta
   141601 gcaggtttta gagttttaat tcgcataatc aggaaagact tcaaccgcgg tacccactaa
   141661 cctttaactt tatgagaaaa acaggaactg cggttgctcc gttagcagat tttagggttc
   141721 tcgttagcct gggtaggaaa gaccccaacc gcagtaccca ctaaccttta actttatgag
   141781 aaaaacagaa actgcggttg ctccgttagc agcttttaga gttttaattc gcatgaacag
   141841 gaaagacttc aaccgcggta cccgctgatc tttaacttta tgagaaaaac aggaactgcg
   141901 gttgccgcgt tagcagattt tgaagttctc atccttatta gcaggaaaga tttcaaccgc
   141961 agtacccact aacctttaag tttatgggga aaaacaggaa ctgcggttgc tttgttagca
   142021 tcttttagag ttctcattcg tattggcagg aaatacttca accgcggtac ccactgatct
   142081 ttaactttat gaagaaaaac aggaactgtt gttgctttgt tagcagattt taaagttctc
   142141 atcctcatta tcaggaaaga cttcaaccgc agttcccact gacctttaag tttatgagga
   142201 aaaacaggaa atgcggttgc tttgttaaca gcttttagag ttctcatccg tatgggcaaa
   142261 aaaaatttca accgcggtac ccactgatct ttagctttat cagaaaaaac agaaactgcg
   142321 gttgccccgt tagcgaattt tagggtcctc acccacttga gtaggaaaga ccctaaccgc
   142381 ggcacccact gacctttaac tgtatgaaga gaaacagaaa ctgcggttgc ccagttagca
   142441 atttttaagg ttctcacccg cttgggtagg aaagacccta accgcggcac ccactgacct
   142501 ttaactttat gaggaaaaac agaaactgcg gttgccccgt tagcaatttt taaggttctc
   142561 acccgcttgg gtaggaaaga ccctaaccgc ggcacccact gacctttaac tttttgatga
   142621 aaaacagaag ctgcggttgc cccgttagca atttttaagg ttctcacccg tttgggtagg
   142681 aaagacccta accgcggcac ccactgacat ttaaatttat ggaaaaacaa acttttttgt
   142741 tcatcatgca cttttttata tatcattata tctctatcca atcagcactc ttgagggtgc
   142801 atacattaag gcagtgttga ttttttttca ttgtacccac ttacgaataa cgaatcaaaa
   142861 gccatgaagt agaatatttt aatgatgtat taatcatcat ttcctaccac gcctattaac
   142921 ttcagtattt ataggatagg caatttgcgc tatacgccat tagctgttct tctgctagct
   142981 tggacacagc ggtacagggt gagttatcag cgtcttataa tgtgatgtct ttttttttat
   143041 tttcttgtcg gtattttaaa agtagtctgt taagatgttt ttaaatagat agttataaaa
   143101 tttttggaac cgtgtagtca ataaaacaat ttatagaacg gtttctggcc cagaacagaa
   143161 attgatttat gtcgtctttc tgaattacag gaaaattgcg agggataact ttatcaaatg
   143221 taaaattata taccctctgt gatagattta ttttgtggat atttgaatgt accatcgagc
   143281 gtatatcaac gcaagatgtg gctatgatgg gacacggtcc tatctgtacg tggtcgtttt
   143341 cattaattgg gaatattatt ttttgacccc caaggaggga ttttataata ttaaaatttt
   143401 caaagttgat acttatgtct ttccaccaca agactaaaac ctgtccgtaa gctcttaaat
   143461 ttttagtatt caaagatccg tgtaatattc catgtaacgg gatattttca agaatggctc
   143521 ccgttaacat cgattttcca catccgggtg gaccaataaa actaacggtg ttttttttcc
   143581 ctcttctgtg gcttagccac tgatataata tggttcctgc taatataggg tcaaaagact
   143641 gcagacagaa caactggtaa accgggtttt catagatttc aaagtcagtg tctatgtgcg
   143701 ctataaaatc gatagctttt ctagttgctc ttattctttt tttagatata gatagagccc
   143761 tatgaattag cacgtccccg tgtgttagtg tcaataattg catgtatgat ctaacgtctc
   143821 ttcgtatcca cgcgtcttcc gtgactattc caagatcaga cagccattcg atggttccca
   143881 gaaatttaga ttttaaagat attctgttgg tcccatcctt tggaaacagc ataagtttaa
   143941 cattaggttt tttattgaaa tgggatatga tgtgttttcg atgtatttca tcgcatacgt
   144001 ctcccagttc gttaatattt gtccatgccc attggaactg tggtctaata atttgaagaa
   144061 gggcaaaggg gatataactt agactgaaga cctgggttcc gccaccattt ttctttgttt
   144121 tggcatacgt gcaccaatca tctattttag gggcgttccc gtcgaagaaa tctttaatta
   144181 atacacccct gatttccgtt gtgtgttttc ctatcgttgc ggtgggaatt ccatctaaag
   144241 ctatcaataa tgttaaggag ggtctgccag ctttattctc cgcttgagcg taccactttg
   144301 caggggtggg gacggcagtt ttattattcc agtaattgag tatgacatcg atcattttgg
   144361 tacatgcagt tatccattta atatcgggcg ctcccggtga gtgcatatct ctaaaatgtg
   144421 gcacgggcac gttagagaat ttgcaaaaaa aatccgtaga tattccaggg atttctgcct
   144481 cccactccac ggggcctttg atagtcaaca tgatatattt gtccttagtc caaaaatcat
   144541 cacttggatt tattatggaa aacataccgt ttgtgccttc caagattttt atagttgtat
   144601 acggaaaata aggtaattcc cctggcttgt cacctctaga tgtcttcaaa tctggaagat
   144661 ttgttatggc aacaaattct cagtatggat ccggcggaac ttctgtcgga caatgcaatc
   144721 tcgtccacgt gtgacgaaaa catcgcagct ggacatcatt ttacgcaatc tccgcacgtt
   144781 gaaatgtcag tccaatcaac gacatcggcg ggtcatactg gagtgatgac gacacagtcg
   144841 cagttttcca atggcgtacg ggatcaaaac cgcgaatcac tgtcgactct gacgggcctc
   144901 tcgctggaaa gcatcaacaa tcaaatcaat gttcaaccca ctcagatgac ctttcaaccc
   144961 atttccccgc cgatgcaggg tcagaattat gtctatagca ataatatgat caatcccatc
   145021 aaacctagat caattatcaa atcacatggt cattcgatgg gggagatgtc atttgcagac
   145081 cattccttgt atgttaatgc tcaaccgcct gtccaacagc ctcaacttaa atcccttgta
   145141 ggtatgcatc catgcatgac cgctacctca cagggtaaat atcagacaaa taaaactgtg
   145201 gggccaccct ctatttcagc ttcccaaatt actacgggaa atgccggtat aagacccggg
   145261 gaatatcagt ctgtccataa tcaatcttct gtaaacgggt ctaagtctta tgagatcact
   145321 acggcatctg gcgatgaatg gatactgact acacccggcg ggcaatcctg gactctgaaa
   145381 cggaaccccc ctaatcctcc gaataacaga actaattcag ttgtcaacaa ggcacaacag
   145441 gtctcgcatg cccaacctta tgtctctggg tctagcgacg gtttctatca gggggctgct
   145501 ctccaatcat gtgcgtatgt aaatacgcca ggtttcactc ctgtgtgcga aacacagaat
   145561 atgaacaact cacaggcgac acaactaagc gcatccatga actgcataaa tgcgttacaa
   145621 actactatgg atgcgattgt cacttctact tccaagccgg tgggggcggt atcaaataat
   145681 cggggtgcta attttggaat gggaggcatg gagaattata tggataataa cagtccatgg
   145741 aaccaatact gtaaagttca agacattgta tctcaaaact gctcccaggg aaaagttgtt
   145801 tcttcgacac cgggaatcgc tcctaatctg atgaagggca acgggttgaa tgtttatggc
   145861 catgtggggt gtgtagatgc ggccatttcc gataaacaag gtggcaccgc taacgtcgca
   145921 tcttctctat tgaatccgga acatcaagat tggatgcggg tgaccgggac gagcacaaat
   145981 ctgttaaaca atataaatgc tgaaacaaaa atggagaact atggttttcc ggaaaatggg
   146041 aatgtccacg gagccgtcaa tacagcttta ccactaactc tatccagtgg tcagccctac
   146101 acatctgtgc cacaacatgg cgcatgtgaa ggaaatggaa caattcccgt ggtacagatc
   146161 tgcagtccca atacagcgtt caaagcgcac tacagtttgc tcggtacagt ggatgaaaac
   146221 aaccccttgt ccgtcagaga gagcatacag gacacaagtt ttagtaatgg atgtgctcct
   146281 cagttgtcct cgcctggagg aaacccgaca ataattgcac attcaatgat tggaaataac
   146341 ggaaccccga ataaagatgt atgcaagcct acccccagcc tacgtgcaat aaaaaaatta
   146401 aactttgact atgatgaccg aggggaaaat ataggatttc cttccaaatt ggcagccctt
   146461 ctgtctatgg gagaaaacat gtcaaagatg gacaatcctt gttatggaac ttctctagcg
   146521 cagttcgagg aatcacatca gcagaatgca tcggagggta aaatatccat tgcggattta
   146581 gagttttctg aagaagatga tgtgctttcc agtgcagcct ctgtcagctg taatgacaac
   146641 tgcgtcatga agatcggagc ttcgcagcaa ggtaccactg tggctgattt acaacaaggg
   146701 tttaagcaac aaatgaacgg agaattctcc atgtttgcag tggatgggaa cattaaaaca
   146761 caggagatgt cgaatgactg cgcgtcaaac gtcacggata atgcatgcgc cattcgacaa
   146821 aataaacgta tgcactgtga aattgggatt tcagaggatg gccgggtgcg ggaagaggag
   146881 aaatgctcag acgtcgcaat tcacgttccg cggaaaagtg cgcgtattca taacatgaag
   146941 tccgaaggcg tgacttgcgg tatgtgtgtg acggctgcgg attccacacg gcaggatgcg
   147001 tctggaggtt cgagcagcgg aaccaagaaa ggcgaaaagt tgcaaggact ttggaaggga
   147061 taccaggatg acgacgattc ggaattaacc gaactgtcgg atacagacag cgacaacgat
   147121 gtccaaaact gtcacggagt aagaaagacc ggttccaaga cgtactcctc agtatttttt
   147181 aatcctgact atcgccaagc caagagattg cttgccgaca ttccatacag aagatggatt
   147241 ccggacacat tcaacatgga agaacacgag ggtccattcc ttccaatagt gactagacca
   147301 cccactgtgt ttatgggcgg tagacgccgg aggacttacc tccggcgaag tgtcacctct
   147361 atcggtcctc tgagtaaatt aacttacttc aaggaattac tgcagagcta cgtgttgaga
   147421 aatagcaact gttatttaag tatcggttgg cctgccaaac acagggtgta tatcatgtca
   147481 gaagagaaat tggggtataa tcatatacct accttgaggg agatgtttcc actgccaccc
   147541 ggatggatga ttgtccttgg aattgtcggt tcagagacgc ccgcggctct gtataaacac
   147601 atggtggttc tcctgtgtga aaataaatgg gtgcttctgc ataattaccg ggactctaaa
   147661 cacgagctgt atttcgccgc ctcggatttg aaacagttta tggaggaggg tctgtctaga
   147721 tgtgactgca tatattatga aaagtcagtg ccgtacggcg tggccatgga agactctgtt
   147781 cgagagttct tgagaaacag taaaacgttt cagagtctta tggagtatag gaagaatatg
   147841 cacggatcta cctggacctt taacggaatg cctggtagac tgggcgacag agttatacat
   147901 atctgcaatc ctgaattggt taactcaatc ccggcagacg aggccatcag atatgaagga
   147961 aaacctttgt atttctttgc atttgtcacc actttcaaat cgcaccccgg tagcaaggcc
   148021 aacgtattga tcgctgcgga taagaactta gggatatacg gctatcataa aggtcgcccc
   148081 aggatacggt acttgtgcaa gaacgtacag gcttttttta gagccggagt tagaaagatg
   148141 tatttggatt atgagattcc atcgaaaacg ttgcttgccg tcagcgaaga tgactatctg
   148201 tgtattctac aaaaagctcc ttgtctgctc ttaaaaccag ctgtgtttag aaagactttc
   148261 tctcaggaag gtaaataaga attgctatgt caagagtttt ccttgacagt tcccaccctc
   148321 ttttttaatt aaaacagaaa ggccattgga ttccatccgc taagagattt actgtttctt
   148381 tgacatttac cagagatacg tgatactcgg tctactgtgt attgtgtacc ttgtaatctc
   148441 taggtaaact tctgctattt ttttaatgtt gagtaattgg acattgttga taggtaaact
   148501 gttctttcaa aatgaccaga gattctatgt actgatctct ttgttttttt ttttctgtgt
   148561 attgtgatag ggaaggtttg taaggacaaa ggacaaagtt cagtaagatt taataaaata
   148621 acatgtgaca caatttctga ctctctttca gtaatttttt tattttaata atgtccgttg
   148681 ccataaggtg agggcaacgt agggtctgag ggataaaaaa gtaattcgtt catatgagta
   148741 gtcggataaa acatttgtag ttttttctct aaaacataac gattatctcg atgacattca
   148801 taccggaata aatccgatat aaacgtttcc atctgtagat atcttggccc gtttttgtgt
   148861 gctgacatag cactttcggt taaattttct atcacagctc ttccgtagtc acttaaaaaa
   148921 aagcaaaaaa aaaagacata tgaaatttta tagtaggcct acctgcaatt tatataagta
   148981 cggatgaaaa caaagaaaca aacatagtgg aaataaaatg attcgcatat gaattaatac
   149041 ctaatgacta gattgaaatc catccatgtt acggaccagg gtctttgaac ttggtcttgc
   149101 atagtatata caattgttct attgtccgtg aaaggtcgac aaaatttctg gcctgcattt
   149161 tgaaacagac tgaacaaata tcaagttata gattaaccgg cgatgtcctg tgttattacg
   149221 catactatac gcgtatacat ccacatacac gcacacacga gaaaatggtg tattaatcat
   149281 tcaagtttac ccgtggtgac attttccccg agtagataga acgacactta catttcaccg
   149341 tctaggcagg tcggagtcga ggaagataca gaactcagtg aattaagaac gacatagtga
   149401 tcacaacacg aagtaatctt cggtaacgtg ctaaaaaacg gtagcgcagc cactccagga
   149461 tatgcatgga aatgtgttaa aatatacaca gccacgaaat gcataattat ctagcagcaa
   149521 tagtttgtta tttaaacaat gattttttta tgttcattta aatatagtat gaatatttac
   149581 aactaaatat acaatcgact atacacatgg tcgataacgc actattacat gcgttccaaa
   149641 aaacaggttt atcgggggtt atcgttatct acatccataa agtgtacaag tccacatgta
   149701 aacatcacag gaaaatatag aagtccgagg ccgtgtacat ccaaacgcgc gcaaataacg
   149761 gtcaggttct cacgacagta ggttctgtag ctgccatttt gatgttctga aagtatacat
   149821 ctctcgggtt gtaaaatacg tgcccaccct cgcataaagc ttgtccgagg tgttcatatc
   149881 catatatttt tttttcgaac atattttgtt tactatatct cgcttgcaca gtgaagatgt
   149941 tgttaaccat cagtagtccc gcatttctga aacgttgttt tgaagttccg gtctgtataa
   150001 agatggtgct gcggattaag aaaaactgca taaatataaa aaaaaactct ggaaaagtca
   150061 tttgtttaat tatggccttt cgtcttctaa tccaaagaaa gtgaaattaa acgtaaaaaa
   150121 aaactctaca tttagattca tagtttaaca gcgctcacca taatgcggga ctcatatgtg
   150181 tcggactggc tatatcgtat tttatattag tcgttgtcag tttttctggc aaagagtgcc
   150241 acaatgcgct tacgatggcc ggatctatgt tgctgtgcat aaccgaaaaa agcgaaaaaa
   150301 ataaattaat ataactggtt actaaaaaaa aaattcgctc ctaccaatcc cctattattt
   150361 aaactcaccg tatagatgtt cctcgctgtc cgaccagtga caatatttgt gaggcaagtc
   150421 gcattccgat ggtttccatc agttcctcag tttcgtacag tgcattttta aacgctctgt
   150481 gagaaacaca agttaagaaa tctcaaatat aaactctttc aaacgataca tcgcagatag
   150541 ataaactcca acttacgttc aaagaagaga aaataagttt acttacagta cagaagataa
   150601 ataattcttc gtgtcgttct tattcaaacg tgaacaccat tcgtgacctt gcagggtttg
   150661 aaatctgacg aaaaaaaaag cgaatttcga aattagaatt tcagaattgt gttccactgc
   150721 tatgtagcaa aaccaataaa aaacatagat ggagtttttt attaaaattg gcatgaatca
   150781 ctcacacgac gtagctatcg tttggacaat gattatcgtt tatagggacg tatgcgtcaa
   150841 cgacgtcctg ccacggttcg aaatactcag tccgagtcca tgagttagaa gattgtaacg
   150901 taggacgatc atggtgcacg tctcggggag gacaacatgt gccattggcg gcaggtttag
   150961 acctcaatat gtcctctatg ctaacggacg cgaagcgcgt gcaggtttcc caatcttgcc
   151021 cgtcgctgtc ttttcgaacg atcgcaaacg aggttaacgt tttgatagtc tgtccgccat
   151081 ggttttgtat cttcaagagt tcgatattga cgatcagttc gctggatttt gagtggatga
   151141 atacatgtgt gccgcacaaa gaggcaagat acaaggaacg agaaaaaatt ttcttgttac
   151201 gaaggcttcc agccccatag tttctgctct gaaaggatgt aggtatgcgt gtggggttga
   151261 cacgtatgcg cgtacatggg tgtggtctgt cttctaagag ggggtggagt ggagggtgga
   151321 ggagaagtgc tgcgacattt ttagagtgac aggtgcatcc gagggcgggg cggggtgtat
   151381 aaatgggact ctttttagcg aattcgggat atttatacgg cggggatctt acgcttttct
   151441 atgtgaataa atacacaatg catgcctttc cttgtcgata aaggagacgt ggcgggaagg
   151501 cacaaaaact tgtacaagta ctcaccatcg agccttttcc agtctgtagt tctggcgtag
   151561 ctccaattta ctagtcattg gacaaaaagc tatcgccgtc atcgcggtta gtggtttcag
   151621 gcgttccata taggccaaac tattatagtt gctcccgaaa gcgccatata gcagagagaa
   151681 gtgaaggccg aggccgctag agagaatctg tgatagaccc ataggcatta ttctgctttt
   151741 taaatttctc actcctctgc tttcggccga gaggggaacg cagattatga tatctccgaa
   151801 catgatgctg cggggaatta gatatgatta ttatatattc atttatttgt tatctcggcg
   151861 gattccgaca tcggtgtccg ggagaatgag cgcgtggtaa agaaacaaga tgaaataaaa
   151921 taaaacgcta gatccttacc gtgcctctgt ctctatgaga caaccgcagc tgttatcatc
   151981 gcaaatggcg tagttcagga ggtcttctat atcttctaag gtagtagttg gggtataatc
   152041 tacggggaca aaagctttaa ggcctcctag acgtgacatt tcggaggtag aaaatttaga
   152101 gatgatttcg ggtagcgttc gtcttctggg cgtaggattt gtaccgtcgt aaatgttaaa
   152161 ataaatgctg tcgtcatagt attttgcggt atagttgtct tcgtcgtccg gcggcggtgt
   152221 ggattccacg gttcccgcat ctcggtggac cgtagcattc gacagggctg tcgccatgga
   152281 aatcgcgcac acgagtatcg gcgcagaacg tctcggcggt ctcatagcgc ttagcgttgc
   152341 gttcgccgtt ctccgtctta gtcttgcgaa aatgcgtatg cgcgggagga agaggacaga
   152401 aaggaagatg gtgttagata agatctacag gaggagaaac gggagacaga tcctacgagg
   152461 acgggagagc ataatagagc ggtttgcatc cggaaacatt cgcgtgaatg taaagccaca
   152521 agaaattaat gcaactagag acttcccaaa gatgatatat ggctacgagc aacgtctggc
   152581 gcgttcacac tcgtttaccg tgtgtgactg agacacgtag tattgaatct ccgccttgta
   152641 aaatcacacg tgggtggaaa gatcgtgcgg cgtatcgtcg tcggggagcg tactcggaga
   152701 taagtctggg gcgatcattt ttatctgcga cgatataaaa cgggggaggg gggtggtata
   152761 aatcgataac gaggaagaaa tacatctgat cgtcatttgg cgatcagtag tttgtcggtg
   152821 atttcttccg taaccggcgt gtgtgtagac tctcgttttg gtggtcagat attaagtctt
   152881 gatcacgcgc gtacccgcgc gttgtagcgg cttctcgggt gtcttttatt ttcaccccgc
   152941 aggctgaacc gcactccggc cgggccactt cttttcatac aggcgttgtc tgtctgctcc
   153001 ggggagctgg gctgcactcg ggccgggaca tttattccca tacaggcgct gctttctctg
   153061 ttttgggagg tcggactgcg ctcgtgccgg gacacttatt cccatacagg cgctgctctt
   153121 ctgctttggg aggtcggact gcgctcgggc cggaacactt attcccatac aggcgctgct
   153181 tctctgcttt gggaggtcgg tctgcgctcg ggtcgggaca cttattccca tacaggcgct
   153241 gcttctctgc atcgggaagt cggactgcgc tcgggccggg acactttttt gtgcgatact
   153301 gttgctctgg aagacagata ttcctcgcgt ttcaaaaatt actttaaact ccccgggggg
   153361 gttaaaaaaa ggggggtatt aaccctaacc ctaaccctag gccctaaccc taaccctagg
   153421 tctaacccta accctaaccc taaccctagg tctaacccta accctaaccc taaccctaac
   153481 cctaacccta accctaaccc taaccctaac cctaacccta ggtctaaccc taaccctaac
   153541 cctaacccta ggtctaaccc taaccctaac cctaacccta ggtctaaccc taaccctaac
   153601 cctaggtcta accctaaccc taaccctaac cctaacccta accctaaccc taaccctaac
   153661 cctaacccta accctaactc tagccttagc cctagcccta gccctagccc taacactcat
   153721 cctcgcatct ggccctaccg ctacccctct ttcaacccct caccatcacc caacccgctg
   153781 ccccacccac atccccccca ccgccaccgc taccgtcacc tctgaacttc acctttttcc
   153841 tccatctcgc cccacttctc tctacatttc tccgcccctc tattcttact cctgttttct
   153901 aggatgccgc tgacggcgcg tgccggccac accctgcatc gtcttccgct ctcccactat
   153961 tggtggcttc tgttgggtcg acactccctt cgtcatgtcc attcctacct tcgcctgcgc
   154021 aaaggtctac gccttccttt accttggccc gaacaagaat gtctgcattt acatcctaag
   154081 ccttacaagt ttctcctgcg ttacccttgt ctaacaagac aaccgcatct tcttcagggc
   154141 tggcccgcgg attcttctct atgtgagtga catttacact tccacttgtt cacatgattt
   154201 attgtgtttt gtctggtaca ccaagcacat ttcggtttct cttttataca tttatctcta
   154261 ttctctcggt ctcagggttc gaccctaaac cctaccatcc ttcggccgac agcaagttgc
   154321 tacctctggg cctcatcacg ctgtccgcct tttccatgcg cgtttcggag ccgacacact
   154381 gcagcggctt ccacgcggca gatccgtctc tcagttggtt aacgggatcg tccccttggc
   154441 tcgtgctcct acaagcgcca ggagggtctc tgttctgcca cgacgtgttc caaggccggc
   154501 tctatctcct gtcgcactcc gtgtcgctct ttctaaagac gggccttcgc cagtgtgagg
   154561 ccatctatcg cgcaccgctg tggcgcgtac ggcccctgcc gagcctatgg acgtgtcgag
   154621 atcccgacac ggctttcttg ccgaaattgc tggcgagaac cgcccgacgc ggcctggccg
   154681 ctttctatgc cctgtggaga ctgcatctgg gatcccgctc ggagctctct caccccgtgt
   154741 tggagtggga gagaacagag ctggtcctga cggatcggag acgcgggtgg ccgtgtacgc
   154801 acctcctgtc cggctcggag tcccagcgcg tttcctcgag tgacgccgga gacacatgga
   154861 acgcagcgac agagaaggcg gcggggggaa aagaggaggc ggagagaggc gggcgacagc
   154921 aagccactga cagactcgca agtccgcacc tgacgcgggg ccgccgcgac tgcggtcggt
   154981 cccttcaggg tgaggagccc agcgccgcgg aagactttgc gaggtgcaga ccgctgctgg
   155041 acgaactgtg cggggagggc ggctggcttc cctttgcgtt tctcacggca tctccgcacg
   155101 tctgtctgat cctaacggag ggaggccccg tcctggcgct tgacctgaac gacacctccc
   155161 tgtggcgcat cgcggacgac ttggagctgc tgctgcgcct ggggagcctg ctcctgctct
   155221 cagggctccg gcttcctctc cgtcccccga gcgggagcgg cgaggcggcg agaaagccgg
   155281 ggtacgagaa ggaagaggga agagggagag cgacgacggc gagcgcgacg gccgcgacgt
   155341 cgccgcgcag accgacccgt ccgagggggg tgacggagaa gggacgtgtg acaaccgggg
   155401 acgtcccttt ctccgcacat cccgaatctg aggaacagac agacggccac cacgggcgcc
   155461 aagaaagcgg ccacggcgac cagcgcggcg gggacggacg aggacaccgc gatgacggcg
   155521 cgcgccgcca cgcgaatgac gaaacagagc cccagcagcg cggagagcac gaggacgggg
   155581 aacagaccga ctccgggcgc gaggaggacg cacaggagag cgaggtcgca agaagagacg
   155641 agaagggaac ggagcagggc ggtagcggaa ggagctgcgg gagggcaacg cagacgtacg
   155701 gcgggagagg cgaacatggt gcctggtcgt cgatccccct gtctgtcccc aggcccgatc
   155761 cccgcgtgtg ggtccctcct cctcatctgt tattcccttc cccgctgccg tcgataacgc
   155821 ccgtcgaaga cgagccgtcc gcccgccctc ggtgcccgcc aggtcccgcg gaggaaccct
   155881 ctaagtgttc tccgtgcccg ccctgcccgt cgcccgacgc cccgcagtcc gctgtcccgc
   155941 gcctctccgc tctgtccgtc ccctcgccgt ccaccgcgcg tgtccgtttc tccctctcct
   156001 ccctctcctc ctcctcctcc tcctcttcct cctcctcccc gtcctactct ccctccccgt
   156061 tgtctccgcc ctctcccgtc tctccctcgt ctcccagatc tccgttcatc tcccccatta
   156121 gatctccggg actccgagca aagccgtggg tgtcctccgg gcatcccgtg gcgttcccgc
   156181 cggcgccctc gtccgcgccg cccttttcca aaagagtccc gtccgttccc tcatcggcat
   156241 ctccgtccgc gccgtgcatc ggcaggtcgc ggccgccctc cgcacagacg gcgtgagacg
   156301 ccgcgtgagg tgacggaggc ggcgaaggga cacgagaaga acatgcagaa gaacatgaag
   156361 acgaagaaga cgaagaaacg aggacgaaag gaggggaata caccggagac cgagcggcgg
   156421 atggagcccg ctcggtctcg cacgtccgcg ataccgagcg ggctccgtcg ccgctccgga
   156481 ccctccacgc ccctccgtcc aggacccgag gtccgacacg cccccacctg gcgcaccgcc
   156541 tccgccacca ccgctgacag tcaccgcata tcacccccat acacacccag cagcagaggc
   156601 cggcacatac acacgcgcgg agcacgcacg agaacacgcg agacatcggc cgccgagatt
   156661 aacggagtct atgcgcgcgc cgtgacacgg aaaaccaagc ggagcgagac gatcgaccga
   156721 ctcctgctat ccgtcctccc tgggcacggt ccacacgcca gtctgcggag tcacctgagg
   156781 gccagatccg ctctgcgccc cccgcccgat ccgccccgat aaaaaaaaat catctgactc
   156841 gtgccagttc acacagatgc aaccgatgac aaaaaaaaaa cacaccaccg caagcaaacg
   156901 ctcgccggcc cgtccaccgt ccctctcacc cccactcgaa tcgcgcaggc gcgtcggcgg
   156961 gaagtccccc gaacgcctcc acggcaacgc tcctcccacg ccccctcggt cccccctccc
   157021 tccatccccc tccccggagc atacgcgccg actctctccg cagaggcggc gaccacagcg
   157081 gcagcggaaa ctgtaacggc cacgttcttt gaacagtgac agtaacggcg gcggcggctg
   157141 tcgccgtcac ggtagtcgtg gcggagcacc cggggaggcg acgacgggga ctaccgatgc
   157201 tctcagatca tcgccatagt gaaagagtac cgaataaaac aagttaaatt tcgttgtaaa
   157261 taaaaaaaaa tactatgtgg aaattaaaaa taaaaaaaat gaaaataaag gctaaacact
   157321 gactaaacgt acatccttct ccgtacgtcc cctttcaata aatggcggac ccgacctctc
   157381 cataaacgga gacacgccgg gagactccgg ccctcccgtt ccagaggtag cccgagacct
   157441 aatcacaaaa ctgtacctga aaccgaaagt atagagggcg gcctcgaatg ccccacctat
   157501 gaggcgggac ttcgcgacgc gccacccttc ctatacgccc ggccttccgc gtgcgcgcct
   157561 ataggacgca tcccctcgcc ccgaaaccgc aacgcggcag agtcggcgcc acacccccgt
   157621 cccccgagtt cgcgatgggc tggcgccgac cctgccgcgg caacgaaggc gaaacgagac
   157681 cccgacgcat gcgggcataa agagcgagaa gtaaacgcgg ggtcccgaat tatcgcgaga
   157741 ctatttgccc gggcccgccc tcgtcctcat gcccttcccc ccgccctcat cccctgacac
   157801 acccggtgga aaaaacgaaa gacacataaa taaaacgaat tttgttgtta aaaatgtttc
   157861 cacgtgacgt ccccggtgat tcccggagat gcggcacgcg gcggattcgc ccgtttacat
   157921 cggggtccgc agacgcggtt ctgccagggc gttgcgctgt cggttccgca caaaacaccg
   157981 cggtccgtcg tcacccttca gccacgcggt agttccgcga ttctatggtt catctccgct
   158041 cacatcgttc tttttttttt attctttcac tgagccgctc caccaccaag agtgttacta
   158101 tctacaccgt atacatgttt tttttttatc tctccgcccc tccccatcac agaccatcaa
   158161 acaccttttg ccgtatcgac actgactata ctcgaccgcg gatgacaacg gtcgttggtc
   158221 acaacagagc tacagcggac agcaaaaata acataaatac agtaagagag aggccccggt
   158281 ccacatagga agccaagggc ggacgaaaat aaaaacccgt ccgtaattca cacacgaatc
   158341 gggggttatg acaacgcgac acacgcagac gagggacgga cgcatcgcga tccggcgcga
   158401 cggggcgcga ttggcccacg cgcgagcccg tgcccgcttc gagtggctgc tcctggctcg
   158461 cggcaggccg tccaaactgt acggctatac gagtcggcac cggggagaac ggatccacct
   158521 accgtggccg cggtactggt gcctagaact ccatccggat ccgtacaggg acgccaggag
   158581 cgccaccgtg tggggtcacc gctggggttg gccgccaacg cacgtgagac ccagatccgt
   158641 tcaagactgc ggtgagtgag cgccgccgcg accggcgacg ctatgcgcac acgggcgagc
   158701 ggcggggagg gacgtcggcc gcagggcgag ccggtggagg gcgagccggt ggagggcgag
   158761 cgggtggagg gtgagcgggt ggagggtgag cgggtggagg gttcgtcgaa aaccaccgaa
   158821 gacattggct ggcggagagt ggggacaaaa caacgtcacg tcaggggcgg agaaatatag
   158881 ggtgcgcaga ccgtcaaagc gcgagtaacg gaaaacgagt gcggatacgg gggggggggg
   158941 aaggaaacat ggtgaagtct gtgacacgcg tgaccgtcag ccggaaacgc ctgccacggc
   159001 ctctggcctc acagacgact cacggagttt ccttcagaca ttgttttttt ttttgtattc
   159061 atcggtaatg cggtatacgt aaattccccg caaaggtact ttccgttaag gacggtacag
   159121 gcggtatgac ttccggaaca cgatgattac ggatatcctg catagtgtac aggagaccgc
   159181 ttttttttta ggttccgtat aagacgtacg tcggcgacgt acacacaaca gttaaaaaaa
   159241 taaaaaaaag aggaaacagt aaagctcctc ctttcctcta tgttatcgcg ttcagttagt
   159301 aggcgccatt gctgttgcgt atgcttttcg cgttaacggt acgcgacagg atacgaatgc
   159361 gttacacgcc gcaaaggctc cctacaatga ctctatgcgg catctcccgt tcgcgcagaa
   159421 acgcgagttc ccgggacgcc agtcttgacg tccggccgat gggatgcctt tgcgtgtgcg
   159481 gatgttttct gctgttttat aggaacagag acaagagacg aaaatagcgg aacgcccact
   159541 ataacgtgca tttttctctg tgttttgtgt tttcatgttt tatgattctt ctacggtatc
   159601 ggccggaacg gtcatcctcg atccttctcg tacgcgtgtc ccgccccagc cctggactcg
   159661 agtctgtacg tatgttgcgg atacggagaa aaacttcaac ccgtgggctt cgtaagctcg
   159721 tatctgaccc actccccgct cgacacgctt cgcgtgctcc tggtcggtag agacggagcc
   159781 gtgtacgtcc accacatgag ggcggccaga ctctgccgtc tggcgtcgaa cgtaacggag
   159841 tttgcaaggc gagggctgca gcgggacccc gtggcgtatg aggaagacct agagctgccg
   159901 gaccggcgta tgtgcggaac gaacgtcaga catctgttcg acgtgatcgc cgcggccgcc
   159961 gacgaacacg acctgctgac cgtcggcggc ctgtgtcaga cgcacgccgg agtgagctgt
   160021 gaattactag agaccgtgcg agatccgtgg acggcggttc cgggcgtacg catgactctg
   160081 accgtggcgc gggctcagta tcgcttgtgg cccgatgccc ggagacagct ccgcctgcac
   160141 ctgtacgcgg gacaccccct gggaccgtgg atagtgtgcg ccgttctgtc tcgagagagg
   160201 gagacgcaga cgccgtcgcc tccgataggc agcggaggcg tgattctggg aaacgtgccc
   160261 acgccggggc cacgcgaggt ggagacggct tgggtgatcg tcaccgtggc gggaccgttg
   160321 ttatcgttct ggcccgataa cggcaagatc tgccgtctgg cgaactcgtt cgccgccctg
   160381 tggaggatgg ggccgcgggc catgagagga cattggacgt attcggcccc gggtagacat
   160441 ctccccgggg acgcttggcc actctgtgaa cacgtgagac cgccagtcgg aaaacttccc
   160501 cggcaaagag cgtacctgga ttagacgcca cggcggcgac gtaaggatgc gacctacggc
   160561 cagagacatg accgtaggaa gatcatgaca aggatctcga aatataaaac caaaaaaaaa
   160621 gtgaggagtg cgtaatcgca agaaaagaaa aaacagagcc gcggtggaaa tgtctatccg
   160681 cctgcgtgta tgtgtggggt gtgtatatgt gcgcgtgacc gtatccctcc ctgcctttaa
   160741 cccgatgaga aataaaatcg gcgaatgtac acagtcacac acaatgtgct tacgtgccgt
   160801 gttactgaca ccacataaca aaaaaaaaaa acatacttcc tgtccgtgag acaccgccgc
   160861 cctctagcgg ggttgctata gcagcgcccg atgccaacgc gacacggtga gtcgcataga
   160921 tcgggactgc ttgaaagcgc gccacattcg tcttttatat agacaccccg gggagtggga
   160981 ggagccaaca tacacacgag gtcggtctga ggttggagac gaacgcggaa aatcaacggc
   161041 gtaaaaaaaa taagaaaggc ggagacacat agccttggcg ggaagacgat aacaggttca
   161101 aagatagaca gtgaaaaaaa aaagaggaga ccatgccatt gaatacacgt gtggcagcaa
   161161 tccaatcaac gtgacgtgcc ggcgcgcaaa aaaaaaagta tacggaagtg catgcgacag
   161221 acagtcacgc ggaccgacga caaaggccga cccctagcat ggcagctagg aaaaaaaata
   161281 aacaacgctg aaatatacta acaaaggaaa catcccttca tccctcccta ccccatctac
   161341 cacaacaccc ccctccgtaa tcccttttct ccgcgtttct cccacagacg cgtgcacacg
   161401 cagacacgca gacacgcaca caccacctct atggcagtcg cgggtgggca ggcggggagc
   161461 atacgggggg cagatgtgaa gacaatgagg aacggcatcg ggcgcgacgt gccgccgtct
   161521 cggacccatg ctatcctggc acgacgccaa gggaaaccgc tggcgcaatc taaccctaac
   161581 cctaacccta accctaaccc taaccctaac cctaacccta accctaaccc taaccctaac
   161641 cctaacccta accctaaccc taaccctaac cctaacccta accctaaccc taaccctaac
   161701 cctaacccta accctaaccc taaccctaac cctaacccta accctaaccc taaccctaac
   161761 cctaacccta accctaaccc taaccctaac cctaacccta accctaaccc taaccctaac
   161821 cctaacccta accctaaccc taaccctaac cctaacccta accctaaccc taaccctaac
   161881 cctaacccta accctaaccc taaccctaac cctaacccta accctaaccc taaccctaac
   161941 cctaacccta accctaaccc taaccctaac cctaacccta accctaaccc taaccctaac
   162001 cctaacccta accctaaccc taaccctaac ccatccccca acgcgcgcgc gcgcgcctct
   162061 atgggaggcg ccgtgttttt caccaaaaac gcgcgccact gcaagagggg ggtg
//