LOCUS       AF156884                1557 bp    mRNA    linear   HUM 15-JUN-1999
DEFINITION  Homo sapiens RIP-like kinase (RIP3) mRNA, complete cds.
ACCESSION   AF156884
VERSION     AF156884.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1557)
  AUTHORS   Yu,P.W., Huang,B.C., Shen,M., Quast,J., Chan,E., Xu,X., Nolan,G.P.,
            Payan,D.G. and Luo,Y.
  TITLE     Identification of RIP3, a RIP-like kinase that activates apoptosis
            and NFkappaB
  JOURNAL   Curr. Biol. 9 (10), 539-542 (1999)
   PUBMED   10339433
REFERENCE   2  (bases 1 to 1557)
  AUTHORS   Yu,P.W., Huang,B.C., Shen,M., Quast,J., Chan,E., Xu,X., Nolan,G.P.,
            Payan,D.G. and Luo,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JUN-1999) Rigel, Inc, 240E Grand Ave., San Francisco,
            CA 94080, USA
FEATURES             Location/Qualifiers
     source          1..1557
                     /db_xref="H-InvDB:HIT000071981"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     gene            1..1557
                     /gene="RIP3"
     CDS             1..1557
                     /gene="RIP3"
                     /codon_start=1
                     /product="RIP-like kinase"
                     /protein_id="AAD39005.1"
                     /db_xref="GI:5059425"
                     /translation="MSCVKLWPSGAPAPLVSIEELENQELVGKDGFGTVFRAQHRKWG
                     YDVAVKIVNSKAISREVKAMASLDNEFVLRLEGVIEKVNWDQDPKPALVTKFMENGSL
                     SGLLQSQCPRPWPLLCRLLKEVVLGMFYLHDQNPVLLHRDLKPSNVLPDPELHVKLAD
                     FGLSTFQGGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAGR
                     EVELPTEPSLVYEAVCNRQNRPSLAELPQAGPETPGLEGLKELMQLCWSSEPKDRPSF
                     QECLPKTDEVFQMVENNMNAAVSTVKDFLSQLKSSNRRFSIPESGQGGTEMDGFRRTI
                     ENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSM
                     AQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLV
                     NIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSR
                     PQGWYNHSGK"
BASE COUNT          397 a          424 c          446 g          290 t
ORIGIN      
        1 atgtcgtgcg tcaagttatg gcccagcggt gcccccgccc ccttggtgtc catcgaggaa
       61 ctggagaacc aggagctcgt cggcaaagac gggttcggca cagtgttccg ggcgcaacat
      121 aggaagtggg gctacgatgt ggcggtcaag atcgtaaact cgaaggcgat atccagggag
      181 gtcaaggcca tggcaagtct ggataacgaa ttcgtgttgc gcctagaagg ggttatcgag
      241 aaggtgaact gggaccaaga tcccaagccg gctctggtga ctaaattcat ggagaacggc
      301 tccctgtcgg ggctgctgca gtcccagtgc cctcggccct ggccgctcct ttgccgcctg
      361 ctgaaagaag tggtgcttgg gatgttttac ctgcacgacc agaacccggt gctcctgcac
      421 cgggacctca agccatccaa cgtcctgccg gacccagagc tgcacgtcaa gctggcagat
      481 tttggcctgt ccacatttca gggaggctca cagtcaggga cagggtccgg ggagccaggg
      541 ggcaccctgg gctacttggc cccagaactg tttgttaacg taaaccggaa ggcctccaca
      601 gccagtgacg tctacagctt cgggatccta atgtgggcag tgcttgctgg aagagaagtt
      661 gagttgccaa ccgaaccatc actcgtgtac gaagcagtgt gcaacaggca gaaccggcct
      721 tcattggctg agctgcccca agccgggcct gagactcccg gcttagaagg actgaaggag
      781 ctaatgcagc tctgctggag cagtgagccc aaggacagac cctccttcca ggaatgccta
      841 ccaaaaactg atgaagtctt ccagatggtg gagaacaata tgaatgctgc tgtctccacg
      901 gtaaaggatt tcctgtctca gctcaagagc agcaatagga gattttctat cccagagtca
      961 ggccaaggag ggacagaaat ggatggcttt aggagaacca tagaaaacca gcactctcgt
     1021 aatgatgtca tggtttctga gtggctaaac aaactgaatc tagaggagcc tcccagctct
     1081 gttcctaaaa aatgcccgag ccttaccaag aggagcaggg cacaagagga gcaggttcca
     1141 caagcctgga cagcaggcac atcttcagat tcgatggccc aacctcccca gactccagag
     1201 acctcaactt tcagaaacca gatgcccagc cctacctcaa ctggaacacc aagtcctgga
     1261 ccccgaggga atcagggggc tgagagacaa ggcatgaact ggtcctgcag gaccccggag
     1321 ccaaatccag taacagggcg accgctcgtt aacatataca actgctctgg ggtgcaagtt
     1381 ggagacaaca actacttgac tatgcaacag acaactgcct tgcccacatg gggcttggca
     1441 ccttcgggca aggggagggg cttgcagcac cccccaccag taggttcgca agaaggccct
     1501 aaagatcctg aagcctggag caggccacag ggttggtata atcatagcgg gaaataa
//