LOCUS       AF152481                2475 bp    mRNA    linear   HUM 14-JUL-1999
DEFINITION  Homo sapiens protocadherin alpha 3 short form protein (PCDH-alpha3)
            variable region sequence, complete cds.
ACCESSION   AF152481
VERSION     AF152481.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2475)
  AUTHORS   Wu,Q. and Maniatis,T.
  TITLE     A striking organization of a large family of human neural
            cadherin-like cell adhesion genes
  JOURNAL   Cell 97 (6), 779-790 (1999)
   PUBMED   10380929
REFERENCE   2  (bases 1 to 2475)
  AUTHORS   Wu,Q. and Maniatis,T.
  TITLE     Human protocadherin genes
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 2475)
  AUTHORS   Wu,Q. and Maniatis,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-MAY-1999) Department of Molecular and Cellular
            Biology, Harvard University, 7 Divinity Avenue, Cambridge, MA
            02138, USA
FEATURES             Location/Qualifiers
     source          1..2475
                     /db_xref="H-InvDB:HIT000071785"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="5"
                     /map="5q31"
     gene            1..2475
                     /gene="PCDH-alpha3"
     CDS             1..2475
                     /gene="PCDH-alpha3"
                     /function="cell-cell adhesion"
                     /note="member of the cadherin superfamily"
                     /codon_start=1
                     /product="protocadherin alpha 3 short form protein"
                     /protein_id="AAD43742.1"
                     /db_xref="GI:5457011"
                     /translation="MLFSWREDPGAQCLLLSLLLLAASEVGSGQLHYSVSEEAKHGTF
                     VGRIAQDLGLELAELVPRLFRVASKRHGDLLEVNLQNGILFVNSRIDREELCGRSAEC
                     SIHLEVIVDRPLQVFHVEVEVKDINDNAPVFPMAVKNLFISESRQPGSRFSLEGASDA
                     DIGTNSLLTYSLDSTEYFTLDVKRNDEEIKSLGLVLKKNLNREDTPKHYLLITAIDGG
                     KPELTGTTQLKITVLDVNDNAPAFERTIYKVRLLENAPNGTLVVTVNATDLDEGVNKD
                     IAYSFNTDMSADILSKFHLDPVNGQISVKGNIDFEESKSYEIQVEATDKGNPPMSDHC
                     TVLLEIVDINDNVPELVIQSLSLPVLEDSPLSTVIALISVSDRDSGVNGQVTCSLTPH
                     VPFKLVSTFKNYYSLVLDSPLDRESVSAYELVVTARDGGSPSLWATASVSVEVADVND
                     NAPAFSQSEYTVFVKENNPPGCHIFTVSARDADAQENALVSYSLVERRVGERALSSYV
                     SVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLGSNVTLQVFVLDENDNAPALL
                     MPRVGGIGGAVSELVPRSVGAGHVVAKVRAVDADSGYNAWLSYELQPGTGGARIPFRV
                     GLYTGEISTTRALDEVDAPRHRLLVLVKDHGEPSLTATATVLVSLVESGQAPKASSQA
                     SAGATGPEAALVDVNVYLIVAICAVSSLLVLTLLLYTALRCSAPPTEGDCGPGKPTLV
                     CSSAVGSWSYSQQRQQRVCSGEGLPKTDLMAFSPSLPPCPISRDREEKQDVDVDLSAK
                     VSNFYLFFPKCLCFSFLNVSTPLEIH"
BASE COUNT          539 a          639 c          745 g          552 t
ORIGIN      
        1 atgttgttct cctggcgaga agatcctgga gcccagtgcc tgctgctttc tcttctgctc
       61 ctcgcagcct cggaggtggg gagcggccag ctccactact ccgtctctga ggaggccaag
      121 catggcacct tcgtgggccg catcgcgcag gacctggggc tggagctggc ggagctggtg
      181 ccgcgcctgt tccgggtggc gtccaaaaga cacggggacc ttctggaggt aaatctgcag
      241 aatggcattt tgtttgtgaa ttctcggata gaccgcgagg aactgtgcgg gcggagcgcg
      301 gagtgcagca tccacctgga ggtgatcgtg gacaggccgc tgcaggtttt ccatgtggag
      361 gtggaagtga aggacattaa tgacaacgcg ccagtttttc caatggctgt aaagaatctg
      421 tttatttccg aatcccgaca gcctggctct cggttttcgc tagagggcgc atcagatgca
      481 gatatcggaa caaattcgtt gttgacttac agtcttgatt ccactgaata ttttaccttg
      541 gacgttaaaa gaaatgatga ggaaattaaa tcccttggac tcgtgttgaa aaaaaattta
      601 aatcgagagg acactcctaa gcattattta ctaataacag caattgatgg tgggaaacca
      661 gagctcactg gcacgactca actaaagatc actgttttag atgtaaacga caacgcccca
      721 gcgtttgaga ggacgatcta taaagtcaga ttactcgaaa atgcaccaaa tggtacccta
      781 gtggtgaccg ttaacgccac cgatttggat gaaggagtaa ataaggatat cgcgtattct
      841 ttcaatacgg acatgtcagc agatattctg tcaaaattcc atttagatcc agtcaatgga
      901 caaatcagtg taaagggtaa catagatttc gaggaaagta agtcatatga aatccaggta
      961 gaagccacgg ataaaggaaa tcccccaatg tcagatcact gcacagttct actcgaaatt
     1021 gtggacatca atgataatgt acctgagtta gttattcaat cactatcttt acctgtatta
     1081 gaagactctc cacttagcac agtcatcgct ctgatcagcg tgtccgaccg cgactcagga
     1141 gtcaatggac aggtcacctg ctcgctgacg ccccacgtcc ccttcaagct ggtgtccacc
     1201 ttcaagaatt actactcatt ggtgctggac agccctctgg accgcgagag cgtgtcggcc
     1261 tatgagctgg tggtgactgc tcgggacggg ggctcgcctt cactgtgggc cacggccagc
     1321 gtgtccgtgg aggtggccga cgtgaacgac aatgcgccgg cattctcgca gtccgagtac
     1381 acggtgttcg tgaaggagaa caacccgccg ggctgccaca tcttcacggt gtctgcgcgg
     1441 gacgcggacg cgcaggagaa cgccctggtg tcctactcgc tggtggaacg gcgggtgggg
     1501 gagcgcgcgc tgtcgagcta cgtgtcggta cacgcggaga gcggcaaggt gtacgcgctg
     1561 cagccgctgg accacgagga gctagagctg ctgcagttcc aggtgagtgc gcgcgatgcg
     1621 ggcgtgccgc ctctgggcag caacgtgacg ctgcaggtgt tcgtgctgga cgagaacgac
     1681 aacgcgccgg cactgctgat gcctcgggtg ggtggcatcg gtggcgcagt gagcgagctg
     1741 gtgccgcggt cagtgggtgc gggccacgtg gtagcgaagg tgcgcgcagt ggatgcagac
     1801 tcaggctaca acgcgtggct ttcgtatgag ctgcagcctg ggaccggcgg tgcgcgcatc
     1861 ccgtttcgcg tggggctgta cacgggagag atcagcacga cccgtgccct ggacgaggtg
     1921 gacgccccgc gccatcgcct actggtgctg gtgaaggacc acggtgaacc ctcattgacc
     1981 gccacggcca ctgtgctggt gtcgctggtg gagagtggcc aggcacccaa ggcctcgtcc
     2041 caggcgtccg ctggcgccac gggcccggaa gctgcactgg tggatgtcaa cgtgtacttg
     2101 atcgtcgcca tctgcgcggt gtccagtctg ttggtgctca cactgctgct atatactgct
     2161 ctgcggtgct ccgcgccgcc aaccgaaggc gactgtgggc cgggcaagcc cacgctggtg
     2221 tgctccagcg cggtggggag ctggtcatac tcgcagcaga ggcagcagag ggtgtgctct
     2281 ggagaggggt tgcccaagac cgacctcatg gcttttagcc ctagccttcc tccttgtcca
     2341 attagccggg atagagagga gaaacaggat gtggacgttg atctctcagc caaagtgagt
     2401 aatttttatt tattctttcc aaaatgtctt tgtttttcat tcctcaatgt ttccactcct
     2461 ctggaaatac attaa
//