LOCUS       AF113514                5661 bp    mRNA    linear   HUM 01-OCT-1999
DEFINITION  Homo sapiens histone acetyltransferase MORF mRNA, complete cds.
ACCESSION   AF113514
VERSION     AF113514.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 5661)
  AUTHORS   Champagne,N., Bertos,N.R., Pelletier,N., Wang,A.H., Vezmar,M.,
            Yang,Y., Heng,H.H. and Yang,X.J.
  TITLE     Identification of a human histone acetyltransferase related to
            monocytic leukemia zinc finger protein
  JOURNAL   J. Biol. Chem. 274 (40), 28528-28536 (1999)
   PUBMED   10497217
REFERENCE   2  (bases 1 to 5661)
  AUTHORS   Yang,X.-J.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-1998) Molecular Oncology Group, Department of
            Medicine, McGill University, 687 Pine Ave. W., Montreal, QC H3A
            1A1, Canada
FEATURES             Location/Qualifiers
     source          1..5661
                     /db_xref="H-InvDB:HIT000069785"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="10"
                     /map="10q22.2"
                     /tissue_type="bone marrow"
                     /dev_stage="fetal"
     CDS             316..5661
                     /note="similar to Homo sapiens MOZ"
                     /codon_start=1
                     /product="histone acetyltransferase MORF"
                     /protein_id="AAF00095.1"
                     /db_xref="GI:6002686"
                     /translation="MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDK
                     KTVSEQLELSVQDGSVLKVTNKGLASYKDPDNPGRFSSVKPGTFPKSAKGSRGSCNDL
                     RNVDWNKLLRRAIEGLEEPNGSSLKNIEKYLRSQSDLTSTTNNPAFQQRLRLGAKRAV
                     NNGRLLKDGPQYRVNYGSLDGKGAPQYPSAFPSSLPPVSLLPHEKDQPRADPIPICSF
                     CLGTKESNREKKPEELLSCADCGSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACR
                     VQGRNADNMLFCDSCDRGFHMECCDPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQI
                     KRRYAKPIGRPKNKLKQRLLSVTSDEGSMNAFTGRGSPDTEIKINIKQESADVNVIGN
                     KDVVTEEDLDVFKQAQELSWEKIECESGVEDCGRYPSVIEFGKYEIQTWYSSPYPQEY
                     ARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANEIYRRKDLSVFEVDGNMSKIY
                     CQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLVGYLSKEKLCQQKYNVSCI
                     MIMPQHQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRLSYLAYWKSVILEYLYH
                     HHERHISIKAISRATGMCPHDIATTLQHLHMIDKRDGRFVIIRREKLILSHMEKLKTC
                     SRANELDPDSLRWTPILISNAAVSEEEREAEKEAERLMEQASCWEKEEQEILSTRANS
                     RQSPAKVQSKNKYLHSPESRPVTGERGQLLELSKESSEEEEEEEDEEEEEEEEEEEED
                     EEEEEEEEEEEEEENIQSSPPRLTKPQSVAIKRKRPFVLKKKRGRKRRRINSSVTTET
                     ISETTEVLNEPFDNSDEERPMPQLEPTCEIEVEEDGRKPVLRKAFQHQPGKKRQTEEE
                     EGKDNHCFKNADPCRNNMNDDSSNLKEGSKDNPEPLKCKQVWPKGTKRGLSKWRQNKE
                     RKTGFKLNLYTPPETPMEPDEQVTVEEQKETSEGKTSPSPIRIEEEVKETGEALLPQE
                     ENRREETCAPVSPNTSPGEKPEDDLIKPEEEEEEEEEEEEEEEEEEGEEEEGGGNVEK
                     DPDGAKSQEKEEPEISTEKEDSARLDDHEEEEEEDEEPSHNEDHDADDEDDSHMESAE
                     VEKEELPRESFKEVLENQETFLDLNVQPGHSNPEVLMDCGVDLTASCNSEPKELAGDP
                     EAVPESDEEPPPGEQAQKQDQKNSKEVDTEFKEGNPATMEIDSETVQAVQSLTQESSE
                     QDDTFQDCAETQEACRSLQNYTRADQSPQIATTLDDCQQSDHSSPVSSVHSHPGQSVR
                     SVNSPSVPALENSYAQISPDQSAISVPSLQNMETSPMMDVPSVSDHSQQVVDSGFSDL
                     GSIESTTENYENPSSYDSTMGGSICGNGSSQNSCSYSNLTSSSLTQSSCAVTQQMSNI
                     SGSCSMLQQTSISSPPTCSVKSPQGCVVERPPSSSQQLAQCSMAANFTPPMQLAEIPE
                     TSNANIGLYERMGQSDFGAGHYPQPSATFSLAKLQQLTNTLIDHSLPYSHSAAVTSYA
                     NSASLSTPLSNTGLVQLSQSPHSVPGGPQAQATMTPPPNLTPPPMNLPPPLLQRNMAA
                     SNIGISHSQRLQTQIASKGHISMRTKSASLSPAAATHQSQIYGRSQTVAMQGPARTLT
                     MQRGMNMSVNLMPAPAYNVNSVNMNMNTLNAMNGYSMSQPMMNSGYHSNHGYMNQTPQ
                     YPMQMQMGMMGTQPYAQQPMQTPPHGNMMYTAPGHHGYMNTGMSKQSLNGSYMRR"
BASE COUNT         1800 a         1316 c         1380 g         1165 t
ORIGIN      
        1 gataatctcc atttttgtca tgggactgtt aaaaacgttt ggaagttcca attctggtct
       61 tgatttccca gttaaagatg ttctttcacc cgaatgcagt ctttcctgtt ggtaaaataa
      121 gacaaccatc aacattgcct gtttgtctgc ttttgaatct cttaaggatg gatgtttgta
      181 agatgttgct taatacagtc tggaatactc tgtccatttg ttgaattgta aatgactttc
      241 aaatgtgcaa gttctgttaa atacaaagag aacctctatg ggtaactttt gtgttgaaga
      301 agtcatttgt caaccatggt aaaacttgca aacccacttt atacagagtg gattcttgaa
      361 gctatacaga aaataaaaaa gcaaaagcaa aggccctctg aagagagaat ctgccatgcg
      421 gtcagtactt cccatgggtt ggataagaag acagtctctg aacagctgga actcagtgtt
      481 caggatggct cagttctcaa agtcaccaac aaaggccttg cctcctataa ggacccagac
      541 aaccctgggc gcttttcatc agttaaacca ggcacttttc ctaagtcagc caaggggtct
      601 agaggatcat gtaatgatct ccgcaatgtg gattggaata aacttttaag gagagcaatt
      661 gaaggacttg aggagccgaa tggctcctcc ctgaagaaca tagagaagta tctcagaagt
      721 caaagtgatc tcacaagcac caccaacaac ccagcctttc agcagcggct gcgactgggg
      781 gccaaacgcg ctgtgaataa tgggaggtta ctgaaagacg gaccgcagta cagggtcaat
      841 tatgggagct tagatggcaa aggggcacct cagtatccca gtgcattccc atcctcgctc
      901 ccacctgtca gccttctacc ccatgagaaa gaccagcccc gtgctgatcc cattccaata
      961 tgtagcttct gtttggggac taaagaatca aatcgtgaaa agaaaccaga agaactcctc
     1021 tcttgtgcag attgtggcag tagtggacac ccatcctgtt tgaaattttg tcctgaatta
     1081 acaacaaatg taaaggcctt aaggtggcag tgcatcgaat gcaagacatg cagtgcctgt
     1141 agagtccaag gcagaaatgc tgataatatg cttttttgtg attcctgtga tagaggattt
     1201 catatggaat gctgtgaccc accactttcc agaatgccaa aagggatgtg gatttgccaa
     1261 gtctgcagac caaagaaaaa gggaagaaaa ctacttcatg agaaagctgc acaaataaaa
     1321 cgacgatatg caaaacccat tggacgaccg aaaaataaat taaagcaacg attgttgtct
     1381 gtaaccagtg atgaaggatc catgaatgca ttcacaggaa gggggtcacc tgatactgaa
     1441 ataaaaataa acatcaaaca agaaagtgca gatgtaaatg tgattggaaa caaggatgtc
     1501 gttactgaag aggatttgga tgtttttaag caggcccagg aactttcttg ggagaaaata
     1561 gagtgtgaga gtggggtgga agactgtggc cggtaccctt ctgtgattga atttggtaaa
     1621 tatgaaatcc aaacctggta ctcctcgcct tacccacagg aatatgcaag attaccaaag
     1681 ctttacctgt gtgaattctg tcttaaatat atgaaaagta aaaatatttt gctaagacac
     1741 tccaagaagt gtggatggtt tcatcctcca gcaaatgaaa tttaccgaag gaaagacctt
     1801 tcagtatttg aggttgatgg gaatatgagc aaaatttatt gccaaaacct ttgcttgtta
     1861 gccaagctct tcctggacca caaaacgttg tattatgatg tcgagccatt ccttttttat
     1921 gtccttacaa aaaatgatga aaagggctgt catctggttg gatacctctc taaggaaaag
     1981 ctttgccagc agaagtataa tgtctcctgc ataatgatca tgccccagca ccaaaggcaa
     2041 ggatttggac ggtttctcat tgatttcagc tatttgcttt ctagaagaga aggccaagca
     2101 gggtctcctg aaaagcctct ctccgatctg ggccgtctct cctacctggc atattggaag
     2161 agcgtcatct tggagtatct ctaccaccac catgagaggc acatcagcat caaggcaatt
     2221 agcagagcga cgggcatgtg cccacatgac attgccacca ctctgcagca cctccacatg
     2281 atcgacaaga gagatggcag atttgtcatc attagacggg aaaagttgat attgagccac
     2341 atggaaaagc tgaaaacctg ttccagagcc aatgaacttg atccagacag tctgaggtgg
     2401 accccaattt taatttctaa tgctgcagtg tctgaagaag agcgagaagc tgagaaagag
     2461 gctgagcggc taatggaaca agctagctgc tgggagaagg aggaacaaga aatcctgtca
     2521 actagagcta acagtaggca atcacctgca aaagtacaat cgaaaaataa atatttgcat
     2581 tccccggaga gccggccagt cacaggggag cgagggcagc tgctggagct gtctaaagag
     2641 agcagtgaag aagaagagga ggaggaggac gaggaggagg aagaagagga ggaagaagag
     2701 gaagaggatg aagaggagga agaagaggaa gaagaagaag aagaagaaga aaatattcaa
     2761 agctctcccc caagattgac gaaaccacag tcagttgcca taaagagaaa gaggcctttt
     2821 gtactaaaga agaaaagggg tcgtaaacgc aggaggatca acagcagtgt aacaacagag
     2881 accatttcag agacgacaga agtactgaat gagccctttg acaactcaga tgaagagagg
     2941 ccaatgccac agctggagcc tacctgtgag attgaagtgg aggaagatgg caggaagcca
     3001 gtcctgagaa aagcattcca gcatcagcct gggaagaaaa gacaaacaga ggaagaggaa
     3061 ggaaaagaca atcattgctt caagaatgct gacccttgta gaaacaatat gaatgatgat
     3121 tcaagtaact tgaaagaagg cagtaaagac aatcccgaac ctctaaagtg caaacaagtg
     3181 tggccaaaag gaacaaagcg cggtctatct aagtggaggc aaaacaaaga gaggaagacc
     3241 ggatttaaac tgaatttgta caccccgcca gaaacaccca tggagcctga cgagcaggta
     3301 acagtggaag aacagaagga gacttcagaa ggaaaaacca gccccagtcc catcaggatt
     3361 gaggaggagg tcaaggaaac tggggaagcc ctgttgcctc aagaggaaaa cagaagggaa
     3421 gaaacatgtg cccctgtaag tccaaacaca tcaccaggtg aaaaaccaga agatgatctc
     3481 atcaaacctg aggaagagga agaggaggag gaggaggaag aggaagaaga ggaagaagag
     3541 gaaggggaag aagaagaagg aggaggaaat gtagaaaaag atccagatgg tgctaaaagc
     3601 caagaaaaag aggaaccaga aatctccacg gaaaaagaag actctgcacg tttggatgat
     3661 cacgaagagg aggaggaaga ggatgaagag ccatcccaca acgaggacca tgatgccgat
     3721 gacgaggatg acagccacat ggagtctgcc gaagtggaga aggaagagct gcccagagaa
     3781 agcttcaaag aagtactgga aaaccaggag acttttttag accttaatgt gcagcctggt
     3841 cactcgaacc cagaggtctt aatggactgt ggcgtcgacc tgacagcttc ttgtaacagt
     3901 gagcccaagg agcttgctgg ggaccctgaa gctgtacccg aatctgacga ggagccaccc
     3961 ccaggagaac aggcacagaa gcaggaccaa aagaacagca aggaagtcga tacagagttc
     4021 aaagagggaa acccagcaac catggaaatc gactctgaga ctgtccaggc cgttcagtct
     4081 ttgacccagg agagcagcga acaggacgac acctttcagg attgtgccga gactcaagag
     4141 gcctgtagaa gcctacagaa ctacacccgt gcagaccaaa gtccacagat tgccaccacg
     4201 ctcgacgatt gccaacagtc ggaccacagt agcccagttt catccgtcca ctcccatcct
     4261 ggccagtccg tacgttctgt caacagccca agtgtccctg ctctggaaaa cagctacgcc
     4321 caaatcagcc cagatcaaag tgccatctca gtgccatctc tgcagaacat ggaaaccagt
     4381 cccatgatgg atgtcccatc agtttcagat cattcacagc aagtcgtaga cagtggattt
     4441 agtgacctgg gcagtatcga gagcacaact gagaactacg aaaacccaag cagctacgat
     4501 tctactatgg gaggcagcat ctgtggaaac ggctcttcac agaacagctg ctcctatagc
     4561 aacctcacct ccagcagtct gacacagagc agctgtgctg tcacccagca gatgtccaac
     4621 atcagcggga gctgcagcat gctgcagcaa accagcatca gctcccctcc gacctgcagc
     4681 gtcaagtctc ctcaaggctg tgtggtggag aggcctccga gcagcagcca gcagctggct
     4741 cagtgcagca tggctgctaa cttcacccca cccatgcagc tggctgaaat ccccgagacg
     4801 agcaacgcca acattggctt atacgagcga atgggtcaga gtgattttgg ggctgggcat
     4861 tacccgcagc cgtcagccac cttcagcctt gccaaactgc agcagttaac taatacactt
     4921 attgatcatt cattgcctta cagccattcc gctgctgtga cttcctatgc aaacagtgcc
     4981 tctttgtcca caccattaag taacacaggg cttgttcaac tttctcagtc tccacactcc
     5041 gtccctgggg gaccccaagc acaagctacc atgaccccac cccccaacct gactcctcct
     5101 ccaatgaatc tgccgccgcc tcttttgcaa cggaacatgg ctgcatcaaa tattggcatc
     5161 tctcacagcc aaagactgca aacccagatt gccagcaagg gccacatctc catgagaacc
     5221 aagtcagcgt ctctgtcacc agccgctgcc acccatcagt cacaaatcta tgggcgctcc
     5281 cagactgtag ccatgcaggg tcctgcacgg actttaacga tgcaaagagg catgaacatg
     5341 agtgtgaacc tgatgccagc gccagcctac aatgtcaact ctgtgaacat gaacatgaac
     5401 actctcaacg ccatgaatgg gtacagcatg tcccagccaa tgatgaacag tggctaccac
     5461 agcaatcatg gctatatgaa tcaaacgccc caatacccta tgcagatgca gatgggcatg
     5521 atgggcaccc agccatatgc ccagcagcca atgcagaccc caccccacgg taacatgatg
     5581 tacacggccc ccggacatca cggctacatg aacacaggca tgtccaaaca gtctctcaat
     5641 ggctcctaca tgagaaggta g
//