LOCUS       AF092128                1172 bp    mRNA    linear   HTC 20-DEC-2016
DEFINITION  Homo sapiens putative transmembrane protein E3-16 mRNA, complete
            cds.
ACCESSION   AF092128
VERSION     AF092128.2
KEYWORDS    HTC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1172)
  AUTHORS   Song,H., Peng,J., Dai,M., Huang,Q., Mao,Y., Zhang,Q., Mao,M.,
            Fu,G., Luo,M., Chen,J. and Hu,R.
  TITLE     Human putative transmembrane protein E3-16 mRNA, complete cds
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1172)
  AUTHORS   Song,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-SEP-1998) Shanghai Institute of Endocrinology,
            Rui-Jin Hospital, Molecular Medicine Center, 197 Rui-Jin Road II,
            Shanghai 200025, P.R. China
REFERENCE   3  (bases 1 to 1172)
  AUTHORS   Song,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2016) Shanghai Institute of Endocrinology,
            Rui-Jin Hospital, Molecular Medicine Center, 197 Rui-Jin Road II,
            Shanghai 200025, P.R. China
  REMARK    Sequence update by database staff to remove vector contamination
COMMENT     On Dec 20, 2016 this sequence version replaced gi:5138905.
FEATURES             Location/Qualifiers
     source          1..1172
                     /db_xref="H-InvDB:HIT000001838"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /tissue_type="normal pituitary"
     CDS             187..987
                     /codon_start=1
                     /product="putative transmembrane protein E3-16"
                     /protein_id="AAD40370.1"
                     /db_xref="GI:5138906"
                     /translation="MVKVTFNSALAQKEAKKDEPKSGEEALIIPPDAVAVDCKDPDDV
                     VPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGIKYIKDDVILNE
                     PSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLN
                     LDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFF
                     IYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS"
BASE COUNT          336 a          284 c          257 g          295 t
ORIGIN      
        1 cgcgggagct gggaggctgc gagatcccta ccgcagtagc cgcctctgcc gccgcggact
       61 tcccgaacct cttcagccgc ccggagccgc tcccggagcc cggccgtaga ggctgcaatc
      121 gcagcgggag cccgcagccc gcgccccgag cccgccgccg cccttcgagg ggccccaggc
      181 cgcgccatgg tgaaggtgac gttcaactcc gctctggccc agaaggaggc caagaaggac
      241 gagcccaaga gcggcgagga ggcgctcatc atcccccccg acgccgtcgc ggtggactgc
      301 aaggacccag atgatgtggt accagttggc caaagaagag cctggtgttg gtgcatgtgc
      361 tttggactag catttatgct tgcaggtgtt attctaggag gagcatactt gtacaaatat
      421 tttgcacttc aaccagatga cgtgtactac tgtggaataa agtacatcaa agatgatgtc
      481 atcttaaatg agccctctgc agatgcccca gctgctctct accagacaat tgaagaaaat
      541 attaaaatct ttgaagaaga agaagttgaa tttatcagtg tgcctgtccc agagtttgca
      601 gatagtgatc ctgccaacat tgttcatgac tttaacaaga aacttacagc ctatttagat
      661 cttaacctgg ataagtgcta tgtgatccct ctgaacactt ccattgttat gccacccaga
      721 aacctactgg agttacttat taacatcaag gctggaacct atttgcctca gtcctatctg
      781 attcatgagc acatggttat tactgatcgc attgaaaaca ttgatcacct gggtttcttt
      841 atttatcgac tgtgtcatga caaggaaact tacaaactgc aacgcagaga aactattaaa
      901 ggtattcaga aacgtgaagc cagcaattgt ttcgcaattc ggcattttga aaacaaattt
      961 gccgtggaaa ctttaatttg ttcttgaaca gtcaagaaaa acattattga ggaaaattaa
     1021 tatcacagca taaccccacc ctttacattt tgtgcagtga ttatttttta aagtcttctt
     1081 tcatgtaagt agcaaacagg gctttactat cttttcatct cattaattca attaaaacca
     1141 ttaccttaaa aaaaaaaaaa aaaaaaaaaa aa
//