LOCUS       AF092128                1198 bp    mRNA    linear   HTC 22-MAY-2001
DEFINITION  Homo sapiens putative transmembrane protein E3-16 mRNA, complete
            cds.
ACCESSION   AF092128
VERSION     AF092128.1
KEYWORDS    HTC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1198)
  AUTHORS   Song,H., Peng,J., Dai,M., Huang,Q., Mao,Y., Zhang,Q., Mao,M.,
            Fu,G., Luo,M., Chen,J. and Hu,R.
  TITLE     Human putative transmembrane protein E3-16 mRNA, complete cds
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1198)
  AUTHORS   Song,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-SEP-1998) Shanghai Institute of Endocrinology,
            Rui-Jin Hospital, Molecular Medicine Center, 197 Rui-Jin Road II,
            Shanghai 200025, P.R. China
FEATURES             Location/Qualifiers
     source          1..1198
                     /db_xref="H-InvDB:HIT000001838"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /tissue_type="normal pituitary"
     CDS             213..1013
                     /codon_start=1
                     /product="putative transmembrane protein E3-16"
                     /protein_id="AAD40370.1"
                     /db_xref="GI:5138906"
                     /translation="MVKVTFNSALAQKEAKKDEPKSGEEALIIPPDAVAVDCKDPDDV
                     VPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGIKYIKDDVILNE
                     PSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLN
                     LDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFF
                     IYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS"
BASE COUNT          338 a          295 c          268 g          297 t
ORIGIN      
        1 cccacgcgtc cgcggacgcg tgggcgcgcg ggagctggga ggctgcgaga tccctaccgc
       61 agtagccgcc tctgccgccg cggacttccc gaacctcttc agccgcccgg agccgctccc
      121 ggagcccggc cgtagaggct gcaatcgcag cgggagcccg cagcccgcgc cccgagcccg
      181 ccgccgccct tcgaggggcc ccaggccgcg ccatggtgaa ggtgacgttc aactccgctc
      241 tggcccagaa ggaggccaag aaggacgagc ccaagagcgg cgaggaggcg ctcatcatcc
      301 cccccgacgc cgtcgcggtg gactgcaagg acccagatga tgtggtacca gttggccaaa
      361 gaagagcctg gtgttggtgc atgtgctttg gactagcatt tatgcttgca ggtgttattc
      421 taggaggagc atacttgtac aaatattttg cacttcaacc agatgacgtg tactactgtg
      481 gaataaagta catcaaagat gatgtcatct taaatgagcc ctctgcagat gccccagctg
      541 ctctctacca gacaattgaa gaaaatatta aaatctttga agaagaagaa gttgaattta
      601 tcagtgtgcc tgtcccagag tttgcagata gtgatcctgc caacattgtt catgacttta
      661 acaagaaact tacagcctat ttagatctta acctggataa gtgctatgtg atccctctga
      721 acacttccat tgttatgcca cccagaaacc tactggagtt acttattaac atcaaggctg
      781 gaacctattt gcctcagtcc tatctgattc atgagcacat ggttattact gatcgcattg
      841 aaaacattga tcacctgggt ttctttattt atcgactgtg tcatgacaag gaaacttaca
      901 aactgcaacg cagagaaact attaaaggta ttcagaaacg tgaagccagc aattgtttcg
      961 caattcggca ttttgaaaac aaatttgccg tggaaacttt aatttgttct tgaacagtca
     1021 agaaaaacat tattgaggaa aattaatatc acagcataac cccacccttt acattttgtg
     1081 cagtgattat tttttaaagt cttctttcat gtaagtagca aacagggctt tactatcttt
     1141 tcatctcatt aattcaatta aaaccattac cttaaaaaaa aaaaaaaaaa aaaaaaaa
//