LOCUS       AF081512                1518 bp    mRNA    linear   HUM 11-AUG-1999
DEFINITION  Homo sapiens TGF-beta type secreted signaling protein LEFTYB mRNA,
            complete cds.
ACCESSION   AF081512
VERSION     AF081512.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1518)
  AUTHORS   Kosaki,K., Kosaki,R., Bassi,M.T. and Casey,B.
  TITLE     Human homologues of murine lefty gene
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1518)
  AUTHORS   Kosaki,K., Kosaki,R., Bassi,M.T. and Casey,B.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-1998) Department of Pathology, Baylor College of
            Medicine, One Baylor Plaza S230, Houston, TX 77030, USA
FEATURES             Location/Qualifiers
     source          1..1518
                     /db_xref="H-InvDB:HIT000066480"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1q42"
                     /cell_type="teratocarcinoma"
                     /dev_stage="embryo"
     5'UTR           1..70
     CDS             71..1171
                     /codon_start=1
                     /product="TGF-beta type secreted signaling protein LEFTYB"
                     /protein_id="AAD48144.1"
                     /translation="MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLD
                     RADMEELVIPTHVRAQYVALLQRSHGDRSRGKRFSQSFREVAGRFLALEASTHLLVFG
                     MEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSARARVTVEWLRVRDDGSNRT
                     SLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKL
                     VRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMK
                     WAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGG
                     RTRPQVVSLPNMRVQKCSCASDGALVPRRLQP"
     3'UTR           1172..1518
BASE COUNT          259 a          480 c          489 g          290 t
ORIGIN      
        1 gcctgagacc ctcctgcagc cttctcaagg gacagcccca ctctgcctct tgctcctcca
       61 gggcagcacc atgcagcccc tgtggctctg ctgggcactc tgggtgttgc ccctggccag
      121 ccccggggcc gccctgaccg gggagcagct cctgggcagc ctgctgcggc agctgcagct
      181 caaagaggtg cccaccctgg acagggccga catggaggag ctggtcatcc ccacccacgt
      241 gagggcccag tacgtggccc tgctgcagcg cagccacggg gaccgctccc gcggaaagag
      301 gttcagccag agcttccgag aggtggccgg caggttcctg gcgttggagg ccagcacaca
      361 cctgctggtg ttcggcatgg agcagcggct gccgcccaac agcgagctgg tgcaggccgt
      421 gctgcggctc ttccaggagc cggtccccaa ggccgcgctg cacaggcacg ggcggctgtc
      481 cccgcgcagc gcccgggccc gggtgaccgt cgagtggctg cgcgtccgcg acgacggctc
      541 caaccgcacc tccctcatcg actccaggct ggtgtccgtc cacgagagcg gctggaaggc
      601 cttcgacgtg accgaggccg tgaacttctg gcagcagctg agccggcccc ggcagccgct
      661 gctgctacag gtgtcggtgc agagggagca tctgggcccg ctggcgtccg gcgcccacaa
      721 gctggtccgc tttgcctcgc agggggcgcc agccgggctt ggggagcccc agctggagct
      781 gcacaccctg gaccttgggg actatggagc tcagggcgac tgtgaccctg aagcaccaat
      841 gaccgagggc acccgctgct gccgccagga gatgtacatt gacctgcagg ggatgaagtg
      901 ggccgagaac tgggtgctgg agcccccggg cttcctggct tatgagtgtg tgggcacctg
      961 ccggcagccc ccggaggccc tggccttcaa gtggccgttt ctggggcctc gacagtgcat
     1021 cgcctcggag actgactcgc tgcccatgat cgtcagcatc aaggagggag gcaggaccag
     1081 gccccaggtg gtcagcctgc ccaacatgag ggtgcagaag tgcagctgtg cctcggatgg
     1141 tgcgctcgtg ccaaggaggc tccagccata ggcgcctagt gtagccatcg agggacttga
     1201 cttgtgtgtg tttctgaagt gttcgagggt accaggagag ctggcgatga ctgaactgct
     1261 gatggacaaa tgctctgtgc tctctagtga gccctgaatt tgcttcctct gacaagttac
     1321 ctcacctaat ttttgcttct caggaatgag aatctttggc cactggagag cccttgctca
     1381 gttttctcta ttcttattat tcactgcact atattctaag cacttacatg tggagatact
     1441 gtaacctgag ggcagaaagc ccaatgtgtc attgtttact tgtcctgtca ctggatctgg
     1501 gctaaagtcc tccaccac
//