LOCUS       AF074606                3504 bp    mRNA    linear   HUM 10-AUG-1999
DEFINITION  Homo sapiens histone acetyltransferase (HBO1) mRNA, complete cds.
ACCESSION   AF074606
VERSION     AF074606.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3504)
  AUTHORS   Iizuka,M. and Stillman,B.
  TITLE     Histone acetyltransferase HBO1 interacts with the ORC1 subunit of
            the human initiator protein
  JOURNAL   J. Biol. Chem. 274 (33), 23027-23034 (1999)
   PUBMED   10438470
REFERENCE   2  (bases 1 to 3504)
  AUTHORS   Iizuka,M. and Stillman,B.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-1998) Cold Spring Harbor Laboratory, 1 Bungtown
            Road, Cold Spring Harbor, NY 11724, USA
FEATURES             Location/Qualifiers
     source          1..3504
                     /db_xref="H-InvDB:HIT000065994"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="X"
                     /map="Xq21, between DXS9900 and DSX1231"
                     /note="corresponds to Sequence Tagged Site WI-6160 under
                     GenBank Accession Number G06149"
     gene            1..3504
                     /gene="HBO1"
     CDS             43..1878
                     /gene="HBO1"
                     /note="binds the large subunit (ORC1L) of the origin
                     recognition complex (ORC)"
                     /codon_start=1
                     /product="histone acetyltransferase"
                     /protein_id="AAC99368.1"
                     /db_xref="GI:4091980"
                     /translation="MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTR
                     SSARLSQSSQDSSPVRNLQSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGS
                     ETEQVVDFSDRETKNTADHDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLK
                     DSGSDLSHRPKRRRFHESYNFNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSAD
                     ECKVRAQSRDKQIEERMLSHRQDDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLS
                     KEQKEKYMEHRQTYGNTREPLLENLTSEYDLDLFRRAQARASEDLEKLRLQGQITEGS
                     NMIKTIAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKH
                     PPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEAD
                     NTGCHLIGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPE
                     RPLSDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLK
                     YWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWTPPKGT"
BASE COUNT          949 a          839 c          776 g          940 t
ORIGIN      
        1 gccgctgccc gaatcggaac cgtcgggccg cagccgccgg caatgccgcg aaggaagagg
       61 aatgcaggca gtagttcaga tggaaccgaa gattccgatt tttctacaga tctcgagcac
      121 acagacagtt cagaaagtga tggcacatcc cgacgatctg ctcgagtcac ccgctcctca
      181 gccaggctaa gccagagttc tcaagattcc agtcctgttc gaaatctgca gtcttttggc
      241 actgaggagc ctgcttactc taccagaaga gtgacccgta gtcagcagca gcctacccca
      301 gtgacaccga aaaaataccc tcttcggcag actcgttcat ctggttcaga aactgagcaa
      361 gtggttgatt tttcagatag agaaactaaa aatacagctg atcatgatga gtcaccgcct
      421 cgaactccaa ctggaaatgc gccttcttct gagtctgaca tagatatctc cagccccaat
      481 gtatctcacg atgagagcat tgccaaggac atgtccctga aggactcagg cagtgatctc
      541 tctcatcgcc ccaagcgccg tcgcttccat gaaagctaca acttcaatat gaagtgtcct
      601 acaccaggct gtaactctct aggacacctt acaggaaaac atgagagaca tttctccatc
      661 tcaggatgcc cactgtatca taacctctca gctgacgaat gcaaggtgag agcacagagc
      721 cgggataagc agatagaaga aaggatgctg tctcacaggc aagatgacaa caacaggcat
      781 gcaaccaggc accaggcacc aacggagagg cagcttcgat ataaggaaaa agtggctgaa
      841 ctcaggaaga aaagaaattc tggactgagc aaagaacaga aagagaaata tatggaacac
      901 agacagacct atgggaacac acgggaacct cttttagaaa acctgacaag cgagtatgac
      961 ttggatcttt tccgaagagc acaagcccgg gcttcagagg atttggagaa gttaaggctg
     1021 caaggccaaa tcacagaggg aagcaacatg attaaaacaa ttgcttttgg ccgctatgag
     1081 cttgatacct ggtatcattc tccatatcct gaagaatatg cacggctggg acgtctctat
     1141 atgtgtgaat tctgtttaaa atatatgaag agccaaacga tactccgccg gcacatggcc
     1201 aaatgtgtgt ggaaacaccc acctggtgat gagatatatc gcaaaggttc aatctctgtg
     1261 tttgaagtgg atggcaagaa aaacaagatc tactgccaaa acctgtgcct gttggccaaa
     1321 ctttttctgg accacaagac attatattat gatgtggagc ccttcctgtt ctatgttatg
     1381 acagaggcgg acaacactgg ctgtcacctg attggatatt tttctaagga aaagaattca
     1441 ttcctcaact acaacgtctc ctgtatcctt actatgcctc agtacatgag acagggctat
     1501 ggcaagatgc ttattgattt cagttatttg ctttccaaag tcgaagaaaa agttggctcc
     1561 ccagaacgtc cactctcaga tctggggctt ataagctatc gcagttactg gaaagaagta
     1621 cttctccgct acctgcataa ttttcaaggc aaagagattt ctatcaaaga aatcagtcag
     1681 gagacggctg tgaatcctgt ggacattgtc agcactctgc aagcccttca gatgctcaaa
     1741 tactggaagg gaaaacacct agttttaaag agacaggacc tgattgatga gtggatagcc
     1801 aaagaggcca aaaggtccaa ctccaataaa accatggatc ccagctgctt aaaatggacc
     1861 cctcccaagg gcacttaaag tgacctgtca ttccgagcca gcgaacccca gcagtaggaa
     1921 tccgtaccct agggatctgt ctgtcatttc tctgttgctc ttgtgattgg caagtacagt
     1981 atcctttggg aaggccatcc ccctcaggac tgtcctggct ccgacctttg tgtacactgc
     2041 agacgctggt tctgaggaac tgttgtttcg gcctcagtga ggttgcctgg atgggatctg
     2101 tattagactt gagtgcaggt ctctcagcac tgacccaagg agttctgtta tggtactgta
     2161 cctgtccagt cactggttct ctcctcatgt cctctcgccc catgaggttg tgttgtgtct
     2221 tctaagcgtg gtactagtgc ttgccacctg gtcaccagac ctccaaatat ggctgccacc
     2281 accaggacct ttccagttac tccttatatg tgtgttctat ggaggggcag ggaaaaggtg
     2341 gcacttgtga gtgtgtgtgg attggcaggg ggtccattca ctttgggttc catcttgctt
     2401 taaatttctt cattttgatt aagagacctc tttttgatct gtattgggct aaccagagcc
     2461 aaatactttt gaagagtttc ccagggacta gtcatggtaa tagcatataa ttgatctgaa
     2521 tgagatggag agaagaatga aggggtggtg gttctgggtt tgatttgagt tcacctgtgg
     2581 gcagtgggca gtgggcagtg tcttggtgaa agggaacgga tactactttt tgcctcaccg
     2641 taaagtactc actagtaaat atttccttct ctctttactc ccacttttta cgtttgcagg
     2701 tgccaaagta atgtccactt ttccctttca tgctgcatat taactggtta attatactgc
     2761 agaaaccttt tcacctccac tagtctgata cagtacatct gtacttccat ataccttgca
     2821 ctgattttgt ctgagtgccc tgggagaagt agaaaatgat tgaaagtgac ttccgtatct
     2881 cagcccatga ctcagcaagg cagaatggcc acccctgcca aagtttgctt ctcttttcaa
     2941 cagtgcctca ccctccctct aggattaaag tgcttctgcc cttccacgaa ctcctcctcc
     3001 atttcctttt tgggatttgt caccatcctt ctattctctg gtcttctatt tttggtgttg
     3061 ttcaagtgaa ggaagagatg ttccctctaa tttctctcta gcccattata acctgctatc
     3121 ttggggcaac ttttgatgta tgacatgtca cccttcccaa cttggtctcc tccaacatgc
     3181 tgtcttcatg tggagccctc accacaatcc ctgactccgg tcatttgtgc ctttctcttg
     3241 tcatctctgt acactactta tattcactgt gggttggggg agctaatttt aagcatgttc
     3301 agtggcagct cccctccagt ttcagtgtca ctgttaaaat ttatcaaaaa gcaacttcac
     3361 taggggtttt cttaagggat aaaggccttt tacagaagct aaacccttcc ccacatgtgg
     3421 tagaatgtgc tcttctatat ctactcctca ataaagcatg ttctctgctc aaaaaaaaaa
     3481 aaaaaaaaaa aaaaaaaaaa aaaa
//