LOCUS       AF074382                1994 bp    mRNA    linear   HUM 15-JUN-2001
DEFINITION  Homo sapiens IkB kinase gamma subunit (IKK-gamma) mRNA, complete
            cds.
ACCESSION   AF074382
VERSION     AF074382.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1994)
  AUTHORS   Rothwarf,D.M., Zandi,E., Natoli,G. and Karin,M.
  TITLE     IKK-gamma is an essential regulatory subunit of the IkappaB kinase
            complex
  JOURNAL   Nature 395 (6699), 297-300 (1998)
   PUBMED   9751060
REFERENCE   2  (bases 1 to 1994)
  AUTHORS   Rothwarf,D.M., Zandi,E., Natoli,G. and Karin,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-1998) Pharmacology, University of California, San
            Diego, 9500 Gilman Drive, La Jolla, CA 92093-0636, USA
FEATURES             Location/Qualifiers
     source          1..1994
                     /db_xref="H-InvDB:HIT000065987"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_line="HeLa; Jurkat"
     gene            1..1994
                     /gene="IKK-gamma"
     CDS             149..1408
                     /gene="IKK-gamma"
                     /codon_start=1
                     /product="IkB kinase gamma subunit"
                     /protein_id="AAC36330.1"
                     /db_xref="GI:3641280"
                     /translation="MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSE
                     QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARK
                     LVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRL
                     EAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQ
                     AASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVA
                     KQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLE
                     QLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEP
                     PDFCCPKCQYQAPDMDTLQIHVMECIE"
BASE COUNT          429 a          585 c          633 g          347 t
ORIGIN      
        1 ggcacgagca tggcccttgt gatccaggtg gggaaactaa ggcccagaga agtgaggacc
       61 ccgcagacta tcaatcccag tctcttcccc tcactccctg tgaagctctc cagcatcatc
      121 gaggtcccat cagcccttgc cctgttggat gaataggcac ctctggaaga gccaactgtg
      181 tgagatggtg cagcccagtg gtggcccggc agcagatcag gacgtactgg gcgaagagtc
      241 tcctctgggg aagccagcca tgctgcacct gccttcagaa cagggcgctc ctgagaccct
      301 ccagcgctgc ctggaggaga atcaagagct ccgagatgcc atccggcaga gcaaccagat
      361 tctgcgggag cgctgcgagg agcttctgca tttccaagcc agccagaggg aggagaagga
      421 gttcctcatg tgcaagttcc aggaggccag gaaactggtg gagagactcg gcctggagaa
      481 gctcgatctg aagaggcaga aggagcaggc tctgcgggag gtggagcacc tgaagagatg
      541 ccagcagcag atggctgagg acaaggcctc tgtgaaagcc caggtgacgt ccttgctcgg
      601 ggagctgcag gagagccaga gtcgcttgga ggctgccact aaggaatgcc aggctctgga
      661 gggtcgggcc cgggcggcca gcgagcaggc gcggcagctg gagagtgagc gcgaggcgct
      721 gcagcagcag cacagcgtgc aggtggacca gctgcgcatg cagggccaga gcgtggaggc
      781 cgcgctccgc atggagcgcc aggccgcctc ggaggagaag aggaagctgg cccagttgca
      841 ggtggcctat caccagctct tccaagaata cgacaaccac atcaagagca gcgtggtggg
      901 cagtgagcgg aagcgaggaa tgcagctgga agatctcaaa cagcagctcc agcaggccga
      961 ggaggccctg gtggccaaac aggaggtgat cgataagctg aaggaggagg ccgagcagca
     1021 caagattgtg atggagaccg ttccggtgct gaaggcccag gcggatatct acaaggcgga
     1081 cttccaggct gagaggcagg cccgggagaa gctggccgag aagaaggagc tcctgcagga
     1141 gcagctggag cagctgcaga gggagtacag caaactgaag gccagctgtc aggagtcggc
     1201 caggatcgag gacatgagga agcggcatgt cgaggtctcc caggccccct tgccccccgc
     1261 ccctgcctac ctctcctctc ccctggccct gcccagccag aggaggagcc cccccgagga
     1321 gccacctgac ttctgctgtc ccaagtgcca gtatcaggcc cctgatatgg acaccctgca
     1381 gatacatgtc atggagtgca ttgagtaggg ccggccagtg caaggccact gcctgcccga
     1441 ggacgtgccc gggaccgtgc agtctgcgct ttcctctccc gcctgcctag cccaggatga
     1501 agggctgggt ggccacaact gggatgccac ctggagcccc acccaggagc tggccgcggc
     1561 accttacgct tcagctgttg atccgctggt cccctctttt ggggtagatg cggccccgat
     1621 caggcctgac tcgctgctct ttttgttccc ttctgtctgc tcgaaccact tgcctcgggc
     1681 taatccctcc ctcttcctcc acccggcact ggggaagtca agaatggggc ctggggctct
     1741 cagggagaac tgcttcccct ggcagagctg ggtggcagct cttcctccca ccggacaccg
     1801 acccgcccgc cgctgtgccc tgggagtgct gccctcttac catgcacacg ggtgctctcc
     1861 ttttgggctg catgctattc cattttgcag ccagaccgat gtgtatttaa ccagtcacta
     1921 ttgatggaca tttgggttgt ttcccatctt tttgttacca taaataatgg catagtaaaa
     1981 aaaaaaaaaa aaaa
//