LOCUS       AF064548                5100 bp    mRNA    linear   HUM 22-SEP-1998
DEFINITION  Homo sapiens low-density lipoprotein receptor-related protein 5
            (LRP5) mRNA, complete cds.
ACCESSION   AF064548
VERSION     AF064548.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 5100)
  AUTHORS   Hey,P.J., Twells,R.C., Phillips,M.S., Yusuke,Nakagawa., Brown,S.D.,
            Kawaguchi,Y., Cox,R., Guochun,Xie., Dugan,V., Hammond,H.,
            Metzker,M.L., Todd,J.A. and Hess,J.F.
  TITLE     Cloning of a novel member of the low-density lipoprotein receptor
            family
  JOURNAL   Gene 216 (1), 103-111 (1998)
   PUBMED   9714764
REFERENCE   2  (bases 1 to 5100)
  AUTHORS   Hey,P.J., Twells,R.C.J., Phillips,M.S., Nakagawa,Y., Brown,S.D.,
            Kawaguchi,Y., Cox,R., Xie,G., Dugan,V., Hammond,H., Metzker,M.L.,
            Todd,J.A. and Hess,J.F.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-MAY-1998) Human Genetics, Merck Research Lab,
            Sumneytown Pike, West Point, PA 19486, USA
FEATURES             Location/Qualifiers
     source          1..5100
                     /db_xref="H-InvDB:HIT000065428"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="11"
                     /map="11q13"
     gene            1..5100
                     /gene="LRP5"
     CDS             49..4896
                     /gene="LRP5"
                     /codon_start=1
                     /product="low-density lipoprotein receptor-related protein
                     5"
                     /protein_id="AAC36467.1"
                     /db_xref="GI:3641527"
                     /translation="MEAAPPGPPWPLLLLLLLLLALCGCPAPAAASPLLLFANRRDVR
                     LVDAGGVKLESTIVVSGLEDAAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAVQNV
                     VISGLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDP
                     AHGYMYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSF
                     IHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGGKRKEILS
                     ALYSPMDIQVLSQERQPFFHTRCEEDNGGCSHLCLLSPSEPFYTCACPTGVQLQDNGR
                     TCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDD
                     EVRAIRRAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSR
                     KILVSEDLDEPRAIALHPVMGLMYWTDWGENPKIECANLDGQERRVLVNASLGWPNGL
                     ALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRR
                     SIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPCADRNGGCSHLCFFTPHATR
                     CGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDF
                     DVSNNHIYWTDVSLKTISRAFMNGSSVEHVVEFGLDYPEGMAVDWMGKNLYWADTGTN
                     RIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMT
                     LVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSD
                     YIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCMHNNGQCG
                     QLCLAIPGGHRCGCASHYTLDPSSRNCSPPTTFLLFSQKSAISRMIPDDQHSPDLILP
                     LHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSLSQGQNPDRQPHDLS
                     IDIYSRTLFWTCEATNTINVHRLSGEAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQD
                     RAAKIERAALDGTEREVLFTTGLIRPVALVVDNTLGKLFWVDADLKRIESCDLSGANR
                     LTLEDANIVQPLGLTILGKHLYWIDRQQQMIERVEKTTGDKRTRIQGRVAHLTGIHAV
                     EEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPD
                     QFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGE
                     ADCQDRSDEADCDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSD
                     DSPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLN
                     FIAPGGSQHGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLY
                     PPILNPPPSPATDPSLYNMDMFYSSNIPATVRPYRPYIIRGMAPPTTPCSTDVCDSDY
                     SASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSP
                     CTDSS"
BASE COUNT         1035 a         1646 c         1542 g          877 t
ORIGIN      
        1 atggagcccg agtgagcgcg gcgcgggccc gtccggccgc cggacaacat ggaggcagcg
       61 ccgcccgggc cgccgtggcc gctgctgctg ctgctgctgc tgctgctggc gctgtgcggc
      121 tgcccggccc ccgccgcggc ctcgccgctc ctgctatttg ccaaccgccg ggacgtacgg
      181 ctggtggacg ccggcggagt caagctggag tccaccatcg tggtcagcgg cctggaggat
      241 gcggccgcag tggacttcca gttttccaag ggagccgtgt actggacaga cgtgagcgag
      301 gaggccatca agcagaccta cctgaaccag acgggggccg ccgtgcagaa cgtggtcatc
      361 tccggcctgg tctctcccga cggcctcgcc tgcgactggg tgggcaagaa gctgtactgg
      421 acggactcag agaccaaccg catcgaggtg gccaacctca atggcacatc ccggaaggtg
      481 ctcttctggc aggaccttga ccagccgagg gccatcgcct tggaccccgc tcacgggtac
      541 atgtactgga cagactgggg tgagacgccc cggattgagc gggcagggat ggatggcagc
      601 acccggaaga tcattgtgga ctcggacatt tactggccca atggactgac catcgacctg
      661 gaggagcaga agctctactg ggctgacgcc aagctcagct tcatccaccg tgccaacctg
      721 gacggctcgt tccggcagaa ggtggtggag ggcagcctga cgcacccctt cgccctgacg
      781 ctctccgggg acactctgta ctggacagac tggcagaccc gctccatcca tgcctgcaac
      841 aagcgcactg gggggaagag gaaggagatc ctgagtgccc tctactcacc catggacatc
      901 caggtgctga gccaggagcg gcagcctttc ttccacactc gctgtgagga ggacaatggc
      961 ggctgctccc acctgtgcct gctgtcccca agcgagcctt tctacacatg cgcctgcccc
     1021 acgggtgtgc agctgcagga caacggcagg acgtgtaagg caggagccga ggaggtgctg
     1081 ctgctggccc ggcggacgga cctacggagg atctcgctgg acacgccgga ctttaccgac
     1141 atcgtgctgc aggtggacga catccggcac gccattgcca tcgactacga cccgctagag
     1201 ggctatgtct actggacaga tgacgaggtg cgggccatcc gcagggcgta cctggacggg
     1261 tctggggcgc agacgctggt caacaccgag atcaacgacc ccgatggcat cgcggtcgac
     1321 tgggtggccc gaaacctcta ctggaccgac acgggcacgg accgcatcga ggtgacgcgc
     1381 ctcaacggca cctcccgcaa gatcctggtg tcggaggacc tggacgagcc ccgagccatc
     1441 gcactgcacc ccgtgatggg cctcatgtac tggacagact ggggagagaa ccctaaaatc
     1501 gagtgtgcca acttggatgg gcaggagcgg cgtgtgctgg tcaatgcctc cctcgggtgg
     1561 cccaacggcc tggccctgga cctgcaggag gggaagctct actggggaga cgccaagaca
     1621 gacaagatcg aggtgatcaa tgttgatggg acgaagaggc ggaccctcct ggaggacaag
     1681 ctcccgcaca ttttcgggtt cacgctgctg ggggacttca tctactggac tgactggcag
     1741 cgccgcagca tcgagcgggt gcacaaggtc aaggccagcc gggacgtcat cattgaccag
     1801 ctgcccgacc tgatggggct caaagctgtg aatgtggcca aggtcgtcgg aaccaacccg
     1861 tgtgcggaca ggaacggggg gtgcagccac ctgtgcttct tcacacccca cgcaacccgg
     1921 tgtggctgcc ccatcggcct ggagctgctg agtgacatga agacctgcat cgtgcctgag
     1981 gccttcttgg tcttcaccag cagagccgcc atccacagga tctccctcga gaccaataac
     2041 aacgacgtgg ccatcccgct cacgggcgtc aaggaggcct cagccctgga ctttgatgtg
     2101 tccaacaacc acatctactg gacagacgtc agcctgaaga ccatcagccg cgccttcatg
     2161 aacgggagct cggtggagca cgtggtggag tttggccttg actaccccga gggcatggcc
     2221 gttgactgga tgggcaagaa cctctactgg gccgacactg ggaccaacag aatcgaagtg
     2281 gcgcggctgg acgggcagtt ccggcaagtc ctcgtgtgga gggacttgga caacccgagg
     2341 tcgctggccc tggatcccac caagggctac atctactgga ccgagtgggg cggcaagccg
     2401 aggatcgtgc gggccttcat ggacgggacc aactgcatga cgctggtgga caaggtgggc
     2461 cgggccaacg acctcaccat tgactacgct gaccagcgcc tctactggac cgacctggac
     2521 accaacatga tcgagtcgtc caacatgctg ggtcaggagc gggtcgtgat tgccgacgat
     2581 ctcccgcacc cgttcggtct gacgcagtac agcgattata tctactggac agactggaat
     2641 ctgcacagca ttgagcgggc cgacaagact agcggccgga accgcaccct catccagggc
     2701 cacctggact tcgtgatgga catcctggtg ttccactcct cccgccagga tggcctcaat
     2761 gactgtatgc acaacaacgg gcagtgtggg cagctgtgcc ttgccatccc cggcggccac
     2821 cgctgcggct gcgcctcaca ctacaccctg gaccccagca gccgcaactg cagcccgccc
     2881 accaccttct tgctgttcag ccagaaatct gccatcagtc ggatgatccc ggacgaccag
     2941 cacagcccgg atctcatcct gcccctgcat ggactgagga acgtcaaagc catcgactat
     3001 gacccactgg acaagttcat ctactgggtg gatgggcgcc agaacatcaa gcgagccaag
     3061 gacgacggga cccagccctt tgttttgacc tctctgagcc aaggccaaaa cccagacagg
     3121 cagccccacg acctcagcat cgacatctac agccggacac tgttctggac gtgcgaggcc
     3181 accaatacca tcaacgtcca caggctgagc ggggaagcca tgggggtggt gctgcgtggg
     3241 gaccgcgaca agcccagggc catcgtcgtc aacgcggagc gagggtacct gtacttcacc
     3301 aacatgcagg accgggcagc caagatcgaa cgcgcagccc tggacggcac cgagcgcgag
     3361 gtcctcttca ccaccggcct catccgccct gtggccctgg tggtagacaa cacactgggc
     3421 aagctgttct gggtggacgc ggacctgaag cgcattgaga gctgtgacct gtcaggggcc
     3481 aaccgcctga ccctggagga cgccaacatc gtgcagcctc tgggcctgac catccttggc
     3541 aagcatctct actggatcga ccgccagcag cagatgatcg agcgtgtgga gaagaccacc
     3601 ggggacaagc ggactcgcat ccagggccgt gtcgcccacc tcactggcat ccatgcagtg
     3661 gaggaagtca gcctggagga gttctcagcc cacccatgtg cccgtgacaa tggtggctgc
     3721 tcccacatct gtattgccaa gggtgatggg acaccacggt gctcatgccc agtccacctc
     3781 gtgctcctgc agaacctgct gacctgtgga gagccgccca cctgctcccc ggaccagttt
     3841 gcatgtgcca caggggagat cgactgtatc cccggggcct ggcgctgtga cggctttccc
     3901 gagtgcgatg accagagcga cgaggagggc tgccccgtgt gctccgccgc ccagttcccc
     3961 tgcgcgcggg gtcagtgtgt ggacctgcgc ctgcgctgcg acggcgaggc agactgtcag
     4021 gaccgctcag acgaggcgga ctgtgacgcc atctgcctgc ccaaccagtt ccggtgtgcg
     4081 agcggccagt gtgtcctcat caaacagcag tgcgactcct tccccgactg tatcgacggc
     4141 tccgacgagc tcatgtgtga aatcaccaag ccgccctcag acgacagccc ggcccacagc
     4201 agtgccatcg ggcccgtcat tggcatcatc ctctctctct tcgtcatggg tggtgtctat
     4261 tttgtgtgcc agcgcgtggt gtgccagcgc tatgcggggg ccaacgggcc cttcccgcac
     4321 gagtatgtca gcgggacccc gcacgtgccc ctcaatttca tagccccggg cggttcccag
     4381 catggcccct tcacaggcat cgcatgcgga aagtccatga tgagctccgt gagcctgatg
     4441 gggggccggg gcggggtgcc cctctacgac cggaaccacg tcacaggggc ctcgtccagc
     4501 agctcgtcca gcacgaaggc cacgctgtac ccgccgatcc tgaacccgcc gccctccccg
     4561 gccacggacc cctccctgta caacatggac atgttctact cttcaaacat tccggccact
     4621 gtgagaccgt acaggcccta catcattcga ggaatggcgc ccccgacgac gccctgcagc
     4681 accgacgtgt gtgacagcga ctacagcgcc agccgctgga aggccagcaa gtactacctg
     4741 gatttgaact cggactcaga cccctatcca cccccaccca cgccccacag ccagtacctg
     4801 tcggcggagg acagctgccc gccctcgccc gccaccgaga ggagctactt ccatctcttc
     4861 ccgccccctc cgtccccctg cacggactca tcctgacctc ggccgggcca ctctggcttc
     4921 tctgtgcccc tgtaaatagt tttaaatatg aacaaagaaa aaaatatatt ttatgattta
     4981 aaaaataaat ataattggga ttttaaaaac atgagaaatg tgaactgtga tggggtgggc
     5041 agggctggga gaactttgta cagtggaaca aatatttata aacttaattt tgtaaaacag
//