LOCUS       HSSUR2G35                440 bp    DNA     linear   HUM 12-MAY-1998
DEFINITION  Homo sapiens sulfonylurea receptor 2A (SUR2) gene, alternatively
            spliced product, exon 38a and complete cds.
ACCESSION   AF061323
VERSION     AF061323.1
KEYWORDS    .
SEGMENT     35 of 36
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 440)
  AUTHORS   Aguilar-Bryan,L., Clement,J.P. IV, Gonzalez,G., Kunjilwar,K.,
            Babenko,A. and Bryan,J.
  TITLE     Toward understanding the assembly and structure of KATP channels
  JOURNAL   Physiol. Rev. 78 (1), 227-245 (1998)
   PUBMED   9457174
REFERENCE   2  (bases 1 to 440)
  AUTHORS   Gonzalez,G., Sharma,N., Aguilar-Bryan,L. and Bryan,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-APR-1998) Cell Biology and Medicine, Baylor College
            of Medicine, One Baylor Plaza, Houston, TX 77030, USA
FEATURES             Location/Qualifiers
     source          1..440
                     /organism="Homo sapiens"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:9606"
     mRNA            join(AF061289.1:<264..405,AF061290.1:325..466,
                     AF061291.1:258..379,AF061292.1:271..437,
                     AF061293.1:278..520,AF061294.1:208..402,
                     AF061295.1:200..352,AF061295.1:862..1017,
                     AF061296.1:211..345,AF061297.1:276..438,
                     AF061298.1:327..367,AF061299.1:291..433,
                     AF061300.1:261..369,AF061301.1:263..370,
                     AF061302.1:327..399,AF061303.1:368..473,
                     AF061304.1:346..384,AF061305.1:135..236,
                     AF061306.1:153..237,AF061307.1:247..327,
                     AF061308.1:206..343,AF061308.1:489..614,
                     AF061309.1:241..337,AF061310.1:202..431,
                     AF061311.1:155..303,AF061311.1:516..585,
                     AF061312.1:290..447,AF061313.1:286..378,
                     AF061314.1:91..193,AF061315.1:323..424,
                     AF061316.1:251..371,AF061317.1:263..393,
                     AF061318.1:166..244,AF061319.1:270..378,
                     AF061320.1:227..330,AF061321.1:228..361,
                     AF061322.1:216..278,121..>258)
                     /gene="SUR2"
                     /product="sulfonylurea receptor 2A"
                     /note="alternatively spliced"
     CDS             join(AF061289.1:264..405,AF061290.1:325..466,
                     AF061291.1:258..379,AF061292.1:271..437,
                     AF061293.1:278..520,AF061294.1:208..402,
                     AF061295.1:200..352,AF061295.1:862..1017,
                     AF061296.1:211..345,AF061297.1:276..438,
                     AF061298.1:327..367,AF061299.1:291..433,
                     AF061300.1:261..369,AF061301.1:263..370,
                     AF061302.1:327..399,AF061303.1:368..473,
                     AF061304.1:346..384,AF061305.1:135..236,
                     AF061306.1:153..237,AF061307.1:247..327,
                     AF061308.1:206..343,AF061308.1:489..614,
                     AF061309.1:241..337,AF061310.1:202..431,
                     AF061311.1:155..303,AF061311.1:516..585,
                     AF061312.1:290..447,AF061313.1:286..378,
                     AF061314.1:91..193,AF061315.1:323..424,
                     AF061316.1:251..371,AF061317.1:263..393,
                     AF061318.1:166..244,AF061319.1:270..378,
                     AF061320.1:227..330,AF061321.1:228..361,
                     AF061322.1:216..278,121..258)
                     /gene="SUR2"
                     /note="alternatively spliced"
                     /codon_start=1
                     /product="sulfonylurea receptor 2A"
                     /protein_id="AAC16057.1"
                     /db_xref="GI:3127175"
                     /translation="MSLSFCGNNISSYNINDGVLQNSCFVDALNLVPHVFLLFITFPI
                     LFIGWGSQSSKVQIHHNTWLHFPGHNLRWILTFALLFVHVCEIAEGIVSDSRRESRHL
                     HLFMPAVMGFVATTTSIVYYHNIETSNFPKLLLALFLYWVMAFITKTIKLVKYCQSGL
                     DISNLRFCITGMMVILNGLLMAVEINVIRVRRYVFFMNPQKVKPPEDLQDLGVRFLQP
                     FVNLLSKATYWWMNTLIISAHKKPIDLKAIGKLPIAMRAVTNYVCLKDAYEEQKKKVA
                     DHPNRTPSIWLAMYRAFGRPILLSSTFRYLADLLGFAGPLCISGIVQRVNETQNGTNN
                     TTGISETLSSKEFLENAYVLAVLLFLALILQRTFLQASYYVTIETGINLRGALLAMIY
                     NKILRLSTSNLSMGEMTLGQINNLVAIETNQLMWFLFLCPNLWAMPVQIIMGVILLYN
                     LLGSSALVGAAVIVLLAPIQYFIATKLAEAQKSTLDYSTERLKKTNEILKGIKLLKLY
                     AWEHIFCKSVEETRMKELSSLKTFALYTSLSIFMNAAIPIAAVLATFVTHAYASGNNL
                     KPAEAFASLSLFHILVTPLSLLFTVVRFAVKAIISVQKLNEFLLSDEIGDDSWRTGES
                     SLPFESCKKHTGVQPKTINRKQPGRYHLDSYEQSTRRLRPAETEDIAIKVTNGYFSWG
                     SGLATLSNIDIRIPTGQLTMIVGQVGCGKSSLLLAILGEMQTLEGKVHWSNVNESEPS
                     FEATRSRNRYSVAYAAQKPWLLNATVEENITFGSPFNKQRYKAVTDACSLQPDIDLLP
                     FGDQTEIGERGINLSGGQRQRICVARALYQNTNIVFLDDPFSALDIHLSDHLMQEGIL
                     KFLQDDKRTLVLVTHKLQYLTHADWIIAMKDGSVLREGTLKDIQTKDVELYEHWKTLM
                     NRQDQELEKDMEADQTTLERKTLRRAMYSREAKAQMEDEDEEEEEEEDEDDNMSTVMR
                     LRTKMPWKTCWRYLTSGGFFLLILMIFSKLLKHSVIVAIDYWLATWTSEYSINNTGKA
                     DQTYYVAGFSILCGAGIFLCLVTSLTVEWMGLTAAKNLHHNLLNKIILGPIRFFDTTP
                     LGLILNRFSADTNIIDQHIPPTLESLTRSTLLCLSAIGMISYATPVFLVALLPLGVAF
                     YFIQKYFRVASKDLQELDDSTQLPLLCHFSETAEGLTTIRAFRHETRFKQRMLELTDT
                     NNIAYLFLSAANRWLEVRTDYLGACIVLTASIASISGSSNSGLVGLGLLYALTITNYL
                     NWVVRNLADLEVQMGAVKKVNSFLTMESENYEGTMDPSQVPEHWPQEGEIKIHDLCVR
                     YENNLKPVLKHVKAYIKPGQKVGICGRTGSGKSSLSLAFFRMVDIFDGKIVIDGIDIS
                     KLPLHTLRSRLSIILQDPILFSGSIRFNLDPECKCTDDRLWEALEIAQLKNMVKSLPG
                     GLDAVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQKVVMTA
                     FADRTVVTMAHRVSSIMDAGLVLVFSEGILVECDTVPNLFAHKNGPFSTLVMTNK"
     exon            121..>258
                     /gene="SUR2"
                     /note="38a"
BASE COUNT          102 a           93 c           89 g          156 t
ORIGIN      
        1 tctttgcaag tggattcttg ctcatattta ggcttactgc ttaataaaaa ctatttttta
       61 atgagtcact tggacatttt tccttctgct gattctcttc ttttctattt ttctctccag
      121 caccgtgtct cttctattat ggatgcaggc cttgttttag tcttttctga gggtatttta
      181 gtggagtgtg atactgtccc aaatttgttc gcccacaaga atggcccctt ttccactttg
      241 gtgatgacca acaagtagac catcatgatc tattgcacca agtctgtcat tctccggtag
      301 ttatcttagc agtatcctct cagtaaggca tggctaatgc tgtgaataaa gggaagggct
      361 gagatgaggg aactgcaggg tgttattaca aaatcagctc aaccaagtgc ttttgtcatg
      421 ctcactaccg aagtgagctc
//