LOCUS       AF059293                1716 bp    mRNA    linear   HUM 03-MAY-2001
DEFINITION  Homo sapiens cytokine-like factor-1 precursor (CLF-1) mRNA,
            complete cds.
ACCESSION   AF059293
VERSION     AF059293.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1716)
  AUTHORS   Elson,G.C., Graber,P., Losberger,C., Herren,S., Gretener,D.,
            Menoud,L.N., Wells,T.N., Kosco-Vilbois,M.H. and Gauchat,J.F.
  TITLE     Cytokine-like factor-1, a novel soluble protein, shares homology
            with members of the cytokine type I receptor family
  JOURNAL   J. Immunol. 161 (3), 1371-1379 (1998)
   PUBMED   9686600
REFERENCE   2  (bases 1 to 1716)
  AUTHORS   Elson,G.C.A., Graber,P., Losberger,P., Herren,S., Gretener,D.,
            Menoud,L.N., Wells,T.N.C., Kosco-Vilbois,M.H. and Gauchat,J.F.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-APR-1998) Dept. of Immunology, Serono Pharmaceutical
            Research Institute, 14, Chemin des Aulx, Plan-les-Ouates, GE 1228,
            Switzerland
FEATURES             Location/Qualifiers
     source          1..1716
                     /db_xref="H-InvDB:HIT000064833"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="19"
                     /map="19p12"
     gene            1..1716
                     /gene="CLF-1"
     CDS             119..1387
                     /gene="CLF-1"
                     /note="similar to cytokine type-1 receptor family members;
                     similar to the sequence presented in GenBank Accession
                     Number AC003112"
                     /codon_start=1
                     /product="cytokine-like factor-1 precursor"
                     /protein_id="AAC28335.1"
                     /db_xref="GI:3372627"
                     /translation="MPAGRRGPAAQSARRPPPLLPLLLLLCVLGAPRAGSGAHTAVIS
                     PQDPTLLIGSSLLATCSVHGDPPGATAEGLYWTLNGRRLPPELSRVLNASTLALALAN
                     LNGSRQRSGDNLVCHARDGSILAGSCLYVGLPPEKPVNISCWSKNMKDLTCRWTPGAH
                     GETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLG
                     SARSDVLTLDILDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRY
                     RVEDSVDWKVVDDVSNQTSCRLAGLKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPT
                     AASTPRSERPGPGGGACEPRGGEPSSGPVRRELKQFLGWLKKHAYCSNLSFRLYDQWR
                     AWMQKSHKTRNQDEGILPSGRRGTARGPAR"
     sig_peptide     119..229
                     /gene="CLF-1"
                     /note="putative"
     mat_peptide     230..1384
                     /gene="CLF-1"
                     /product="cytokine-like factor-1"
                     /note="putative"
BASE COUNT          295 a          623 c          525 g          273 t
ORIGIN      
        1 cgcccagcga cgtgcgggcg gcctggcccg cgccctcccg cgcccggcct gcgtcccgcg
       61 ccctgcgcca ccgccgccga gccgcagccc gccgcgcgcc cccggcagcg ccggccccat
      121 gcccgccggc cgccggggcc ccgccgccca atccgcgcgg cggccgccgc cgttgctgcc
      181 cctgctgctg ctgctctgcg tcctcggggc gccgcgagcc ggatcaggag cccacacagc
      241 tgtgatcagt ccccaggatc ccacgcttct catcggctcc tccctgctgg ccacctgctc
      301 agtgcacgga gacccaccag gagccaccgc cgagggcctc tactggaccc tcaacgggcg
      361 ccgcctgccc cctgagctct cccgtgtact caacgcctcc accttggctc tggccctggc
      421 caacctcaat gggtccaggc agcggtcggg ggacaacctc gtgtgccacg cccgtgacgg
      481 cagcatcctg gctggctcct gcctctatgt tggcctgccc ccagagaaac ccgtcaacat
      541 cagctgctgg tccaagaaca tgaaggactt gacctgccgc tggacgccag gggcccacgg
      601 ggagaccttc ctccacacca actactccct caagtacaag cttaggtggt atggccagga
      661 caacacatgt gaggagtacc acacagtggg gccccactcc tgccacatcc ccaaggacct
      721 ggctctcttt acgccctatg agatctgggt ggaggccacc aaccgcctgg gctctgcccg
      781 ctccgatgta ctcacgctgg atatcctgga tgtggtgacc acggaccccc cgcccgacgt
      841 gcacgtgagc cgcgtcgggg gcctggagga ccagctgagc gtgcgctggg tgtcgccacc
      901 cgccctcaag gatttcctct ttcaagccaa ataccagatc cgctaccgag tggaggacag
      961 tgtggactgg aaggtggtgg acgatgtgag caaccagacc tcctgccgcc tggccggcct
     1021 gaaacccggc accgtgtact tcgtgcaagt gcgctgcaac ccctttggca tctatggctc
     1081 caagaaagcc gggatctgga gtgagtggag ccaccccaca gccgcctcca ctccccgcag
     1141 tgagcgcccg ggcccgggcg gcggggcgtg cgaaccgcgg ggcggagagc cgagctcggg
     1201 gccggtgcgg cgcgagctca agcagttcct gggctggctc aagaagcacg cgtactgctc
     1261 caacctcagc ttccgcctct acgaccagtg gcgagcctgg atgcagaagt cgcacaagac
     1321 ccgcaaccag gacgagggga tcctgccctc gggcagacgg ggcacggcga gaggtcctgc
     1381 cagataagct gtaggggctc aggccaccct ccctgccacg tggagacgca gaggccgaac
     1441 ccaaactggg gccacctctg taccctcact tcagggcacc tgagccaccc tcagcaggag
     1501 ctggggtggc ccctgagctc caacggccat aacagctctg actcccacgt gaggccacct
     1561 ttgggtgcac cccagtgggt gtgtgtgtgt gtgtgagggt tggttgagtt gcctagaacc
     1621 cctgccaggg ctgggggtga gaaggggagt cattactccc cattacctag ggcccctcca
     1681 aaagagtcct tttaaataaa tgagctattt aggtgc
//