LOCUS       AH005712                1920 bp    DNA     linear   HUM 10-JUN-2016
DEFINITION  Homo sapiens chromosome 13 insulin promoter factor 1 (PDX1) gene,
            complete cds.
ACCESSION   AH005712 AF035259 AF035260
VERSION     AH005712.2
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1920)
  AUTHORS   Hara,M., Lindner,T.H., Paz,V.P., Wang,X., Iwasaki,N. and Bell,G.I.
  TITLE     Mutations in the pancreatic and duodenal homeobox gene (PDX1) are
            not a common cause of MODY/Early-onset Type 2 diabetes in Japanese
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1920)
  AUTHORS   Hara,M., Lindner,T.H., Paz,V.P., Wang,X., Iwasaki,N. and Bell,G.I.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-NOV-1997) Biochemistry, Molecular Biology, and
            Medicine, The University of Chicago, Howard Hughes Medical
            Institute, 5841 South Maryland Avenue, MC1028, Chicago, IL 60637,
            USA
COMMENT     On or before Jun 10, 2016 this sequence version replaced
            gi:2665698, gi:2665699, gi:2665700.
FEATURES             Location/Qualifiers
     source          1..1920
                     /organism="Homo sapiens"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:9606"
                     /chromosome="13"
                     /map="13q12.1"
                     /clone_lib="PAC library, Genome Systems Inc."
     gene            <283..1920
                     /gene="PDX1"
                     /note="pancreatic and duodenal homeobox gene"
     mRNA            join(<283..688,1326..1920)
                     /gene="PDX1"
                     /product="insulin promoter factor 1"
     CDS             join(283..688,1326..1771)
                     /gene="PDX1"
                     /note="IPF1; transcription factor"
                     /codon_start=1
                     /product="insulin promoter factor 1"
                     /protein_id="AAB88463.1"
                     /db_xref="GI:2665701"
                     /translation="MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPP
                     PPPHPFPGALGALEQGSPPDISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPE
                     GAEPGVLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLE
                     LEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRGGGTAVGGG
                     GVAEPEQDCAVTSGEELLALPPPPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAP
                     RRPQEPR"
     exon            <283..688
                     /gene="PDX1"
                     /number=1
     intron          689..>992
                     /gene="PDX1"
                     /number=1
     gap             993..1092
                     /estimated_length=unknown
     intron          <1093..1325
                     /gene="PDX1"
                     /note="size=3.8 kb"
                     /number=1
     exon            1326..1920
                     /gene="PDX1"
                     /number=2
BASE COUNT          293 a          649 c          593 g          285 t
ORIGIN      
        1 gcaggtgctc gcgggtacct gggcctagcc tcttagtgcg gccagccagg ccaatcacgg
       61 cccccggctg aaccacgtgg ggccccgcgg agcctatggt gcggcggccg gcccgccggt
      121 ccgcgctggc tgtgggttcc ctctgagatc agtgcggagc tgtcaaagcg agcagggtgg
      181 cgccgggagt gggaacgcca cacagtgcca aatccccggc tccagctccc gactcccggc
      241 tcccggctcc cggctcccgg tgcccaatcc cgggccgcag ccatgaacgg cgaggagcag
      301 tactacgcgg ccacgcagct ttacaaggac ccatgcgcgt tccagcgagg cccggcgccg
      361 gagttcagcg ccagcccccc tgcgtgcctg tacatgggcc gccagccccc gccgccgccg
      421 ccgcacccgt tccctggcgc cctgggcgcg ctggagcagg gcagcccccc ggacatctcc
      481 ccgtacgagg tgccccccct cgccgacgac cccgcggtgg cgcaccttca ccaccacctc
      541 ccggctcagc tcgcgctccc ccacccgccc gccgggccct tcccggaggg agccgagccg
      601 ggcgtcctgg aggagcccaa ccgcgtccag ctgcctttcc catggatgaa gtctaccaaa
      661 gctcacgcgt ggaaaggcca gtgggcaggt aagcctggct ccccacccct ttctcctttc
      721 cggttctcac ccggccgcct tacctccaag cgctcccagg agccttctct ctgttcccgg
      781 cgccttggat tatcccgggt cggactaaac tacatcaggg agctaccgag cccatccctc
      841 acagcagtgc ttctctagtc cagtttgaag catctttccc acccagctct cctgggagtg
      901 tacactcctt ccttccctgt tcgctgagcc catcttcgcc ccaggagccc gcgctgccag
      961 cgccatcctt agagagccga ggctgagtcc tgnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     1021 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
     1081 nnnnnnnnnn nntcgagttt ggtctccaat aaaaaggcta tctttattag gaagggcttg
     1141 agttactagg gaagagcttc gcgcgcctac actaggcgct gaaatgggat gctggggctt
     1201 ggtggctccg gcgggagcag ctggtagggc tagggctccc tggcccccct tgaaggggtt
     1261 gggctgcgtg ggtgggggct gtgcggggct ccgggggcca cactcacgcc ctgtgtcgcc
     1321 cgcaggcggc gcctacgctg cggagccgga ggagaacaag cggacgcgca cggcctacac
     1381 gcgcgcacag ctgctagagc tggagaagga gttcctattc aacaagtaca tctcacggcc
     1441 gcgccgggtg gagctggctg tcatgttgaa cttgaccgag agacacatca agatctggtt
     1501 ccaaaaccgc cgcatgaagt ggaaaaagga ggaggacaag aagcgcggcg gcgggacagc
     1561 tgtcgggggt ggcggggtcg cggagcctga gcaggactgc gccgtgacct ccggcgagga
     1621 gcttctggcg ctgccgccgc cgccgccccc cggaggtgct gtgccgcccg ctgcccccgt
     1681 tgccgcccga gagggccgcc tgccgcctgg ccttagcgcg tcgccacagc cctccagcgt
     1741 cgcgcctcgg cggccgcagg aaccacgatg agaggcagga gctgctcctg gctgaggggc
     1801 ttcaaccact cgccgaggag gagcagaggg cctaggagga ccccgggcgt ggaccacccg
     1861 ccctggcagt tgaatggggc ggcaattgcg gggcccacct tagaccgaag gggaaaaccc
//