LOCUS       AF030409                4452 bp    mRNA    linear   HUM 09-MAR-1998
DEFINITION  Homo sapiens sodium-hydrogen exchanger 6 (NHE-6) mRNA, nuclear gene
            encoding mitochondrial protein, complete cds.
ACCESSION   AF030409
VERSION     AF030409.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 4452)
  AUTHORS   Numata,M., Petrecca,K., Lake,N. and Orlowski,J.
  TITLE     Identification of a mitochondrial Na+/H+ exchanger
  JOURNAL   J. Biol. Chem. 273 (12), 6951-6959 (1998)
   PUBMED   9507001
REFERENCE   2  (bases 1 to 4452)
  AUTHORS   Numata,M. and Orlowski,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-OCT-1997) Physiology, McGill University, 3655
            Drummond St., Montreal, QC H3G 1Y6, Canada
COMMENT     This mRNA sequence extends the sequence in the file with GenBank
            Accession Number D87743.
FEATURES             Location/Qualifiers
     source          1..4452
                     /db_xref="H-InvDB:HIT000063030"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     gene            1..4452
                     /gene="NHE-6"
     CDS             36..2045
                     /gene="NHE-6"
                     /function="ion transporter"
                     /codon_start=1
                     /product="sodium-hydrogen exchanger 6"
                     /protein_id="AAC39643.1"
                     /db_xref="GI:2944233"
                     /translation="MARRGWRRAPLRRGVGSSPRARRLMRPLWLLLAVGVFDWAGASD
                     GGGGEARAMDEEIVSEKQAEESHRQDSANLLIFILLLTLTILTIWLFKHRRARFLHET
                     GLAMIYGLLVGLVLRYGIHVPSDVNNVTLSCEVQSSPTTLLVTFDPEVFFNILLPPII
                     FYAGYSLKRRHFFRNLGSILAYAFLGTAISCFVIGSIMYGCVTLMKVTGQLAGDFYFT
                     DCLLFGAIVSATDPVTVLAIFHELQVDVELYALLFGESVLNDAVAIVLSSSIVAYQPA
                     GDNSHTFDVTAMFKSIGIFLGIFSGSFAMGAATGVVTALVTKFTKLREFQLLETGLFF
                     LMSWSTFLLAEAWGFTGVVAVLFCGITQAHYTYNNLSTESQHRTKQLFELLNFLAENF
                     IFSYMGLTLFTFQNHVFNPTFVVGAFVAIFLGRAANIYPLSLLLNLGRRSKIGSNFQH
                     MMMFAGLRGAMAFALAIRDTATYARQMMFSTTLLIVFFTVWVFGGGTTAMLSCLHIRV
                     GVDSDQEHLGVPENERRTTKAESAWLFRMWYNFDHNYLKPLLTHSGPPLTTTLPACCG
                     PIARCLTSPQAYENQEQLKDDDSDLILNDGDISLTYGDSTVNTEPATSSAPRRFMGNS
                     SEDALDRELAFGDHELVIRGTRLVLPMDDSEPPLNLLDNTRHGPA"
BASE COUNT         1114 a          903 c         1008 g         1427 t
ORIGIN      
        1 cgccggtgag gtaggggcgg gaggcggggg gagacatggc tcggcgcggc tggcggcggg
       61 cacccctccg ccgtggcgtc ggcagcagtc cccgagcccg caggctcatg cggccccttt
      121 ggttgctcct cgcagtgggc gtctttgact gggcaggggc ttcggacggc ggcggcggag
      181 aggctagagc catggacgag gagatcgtgt ccgagaagca agccgaggag agccaccggc
      241 aggacagcgc caacctgctc atcttcatcc tgctgctcac cctcaccatt ctcacaatct
      301 ggctcttcaa gcaccgccgg gcccgcttcc tgcacgaaac cggcctggct atgatttatg
      361 gtcttttggt gggccttgtg cttcggtatg gcattcatgt tccgagtgat gtaaataatg
      421 tgaccctgag ctgtgaagtg cagtcaagtc caactacctt actggttact tttgatccag
      481 aagtattttt caacatatta cttcctccta tcatatttta tgcaggttat agcctgaaaa
      541 ggagacattt ttttcgaaat cttgggtcta tcctagcata cgcttttctt ggaacagcaa
      601 tttcttgttt cgttattggg tcaataatgt atggctgtgt aacgctgatg aaggtaacgg
      661 gacaacttgc aggagatttt tactttacag attgcctact gtttggtgcc attgtatcag
      721 caactgatcc agtgactgtt cttgctatat tccacgagct tcaagttgat gttgaactct
      781 atgcacttct ttttggtgaa agtgtcctca atgatgctgt tgccatagtg ctgtcctcct
      841 caatagtggc ataccagcca gctggagaca acagtcacac ctttgatgtc acagcgatgt
      901 tcaagtctat tgggatcttc cttggaatct tcagtggatc ttttgcaatg ggtgctgcta
      961 ctggagtggt gacagcttta gtgacaaagt tcaccaaatt acgggagttc cagttgttgg
     1021 agacaggcct gttcttcttg atgtcctgga gtaccttcct cttggctgaa gcatggggct
     1081 tcacaggtgt agttgcagta ttgttttgtg gcatcacaca agcacattat acgtataata
     1141 atttgtccac ggagtctcag catagaacta aacagttgtt tgagcttctc aatttcttgg
     1201 cagagaattt catcttctcc tacatggggc tgacactgtt caccttccag aaccatgtct
     1261 ttaacccaac atttgtagta ggagcatttg ttgctatttt cttgggaaga gctgccaata
     1321 tttacccctt gtccctctta cttaatttgg gtagaagaag taagattgga tcaaattttc
     1381 aacacatgat gatgtttgct ggccttcgtg gtgcaatggc atttgccttg gccattcgag
     1441 atactgccac ttatgcacgg caaatgatgt tcagcaccac gcttctgatt gtgtttttta
     1501 ccgtgtgggt atttggtggt ggcaccactg caatgctgtc atgcttgcat atcagggttg
     1561 gtgttgattc agaccaagaa cacttgggtg ttcctgaaaa tgaaaggaga actaccaaag
     1621 cagagagtgc ttggcttttc cggatgtggt acaactttga tcataactat ctgaagcctc
     1681 tgctgaccca cagcgggcct ccgctgacaa caacactccc tgcctgctgt ggacccatcg
     1741 ccaggtgcct caccagcccc caggcttacg aaaaccagga acagttgaaa gatgatgatt
     1801 ctgatcttat tctcaatgat ggtgacatca gtttgacata tggagattct actgtgaaca
     1861 ctgaaccggc cacatccagc gccccaagga gatttatggg aaacagttct gaagatgcct
     1921 tggatcggga gcttgcattt ggggaccatg aactggtcat tcgaggaaca cgcctggttc
     1981 ttccaatgga tgattctgaa cccccgctaa atttgttaga taatacgaga catggtccag
     2041 cctaagctta ctaatactca cttagtgatt tgtaaaattt gcacatgtga ttgtgaagaa
     2101 atttgtacta cctaaaagtc ccagtgcatg tctctgaatg tgtaagctat ataaatgcta
     2161 tttatatggc atagaaagaa tataaatatc ctgtacacgg cagattgtga acaaactata
     2221 ttcctttaag ttttcctggt tgcactctgt agactggatc tgttttagga agttactttc
     2281 acagtgatgt tgtgtgttct gttagtttta tgtctcagtt aaagtgtaaa aagtgacgga
     2341 ttttctcttt cttaaactta cctgacactt aaccagagta ccagttctcg tgatgtgaat
     2401 taattttttt gtgtgctagg ggagggagag tgaggaggga gtgttatttc cttgggaacc
     2461 tagggaggag aggttccttt gttgggaaac ttttgttgat agctgctgcc tttgtcctga
     2521 tcgttttctt tcccttttct ctggtggcct gttgtggtgc aacgagctga tggcatttga
     2581 tcttgcccca ttcaggttgg ggagtgaagt gtggggaccc ttttcccccg cttgctgtga
     2641 aagcacagat tcattgacta cagtacactg ttgttcagaa aagaaggctg caaatgactt
     2701 ctgagacttt atgtcttttc ttccagacca agaccgtaga aggagtcaca tctagccggc
     2761 ttagccaaag tacaggtgta tatagttcag ggcacttgat ttagatttgg aggggctggg
     2821 gtgggcagag agcaagaggc gagtaaagag aatggtggtt tcagagatct ctcttcccaa
     2881 atgtgtaaat attctatacc agataagttt aaataagaaa tttaattgct gcttaatttt
     2941 tgattatgta ctttatctgt atagcaggct ttgtcgtcag aagtttttat atcgatttaa
     3001 attgctgctc tttagcagcc aaacaggagc aaaatgtaaa atttttgaac ttactgtgtc
     3061 taatcatcat ttgttagtct gtagttaatg tcaacagtta atttatgaac ccacgatcgt
     3121 tccacactgc accaaagtca gtcataagag aaatcgaata ttctggagca ctgattgcag
     3181 cagggtggct cctttgtgtg cagcaggtgt agtagtcttc attttcatgg tacgttttaa
     3241 tattaattac ctaagctgcc atgcattttt tttttacagt tctcaaggaa gagcacagaa
     3301 caatttctca tttcatattt ggagtatgaa agtagattct attttgtaat gctgataata
     3361 cctaaagatg cattgaatgc ttggaagaat gctttttgat gttgattttg acctgttcat
     3421 gattcagaag aaaaacaaac ttttttggat tttttttccc tcaggtctga gtagcattgc
     3481 cttaaatctt atccagttag aacattgatt tatttacatg atgttcagat tttccagtga
     3541 aaaataccct tctgaacaaa acatgtactt actctccgaa aggcatctat ctgtgctatt
     3601 gcaaacactc cttgagattt taggggaatt ctaatgttgt accctttcgt ggcagctttg
     3661 actgttggca tagccatttg ttatgtagtg gtagcgactt tcctgctatg caggaatccc
     3721 tcccatgacg tgtatgtttt acatgatgtg tgcctcttca cgcagtaaat agtttcttgt
     3781 taatgtatgt ttgaggagtt tgaacgtcag tgtcacttac ccacaaagtt attcaagttg
     3841 taaaaggtta taaataattt aacaactacc ttttttattc tgtcgggtta ctgacctcac
     3901 tttatgtaaa tacttcgcat gacaaattca gtaactcgtc tatttcagca tgcataagac
     3961 ttttcactag ggaaactgat aaagcttgag tcaactaaat ctgccttcat actttatcaa
     4021 ggggaaccaa gcctgctgtg cttacatcag catctggaag actttcctct cctctaatct
     4081 gtgtacacat ctccaagcaa ggaagaaaaa acaaactctg ctcagacgcc tatgaaacac
     4141 ctgaatgaac tttgatgaag tacagtctga gttaccatca tgcacaagta gaactgctct
     4201 tggacttgtt ttcctgttgt ttgtggaacc tacgcgtttg aatggcttga acgttgcatc
     4261 ttttaaagtt attttttaag gtttcttggc atttatccta gttgtccgtg tttggcaatg
     4321 tgctgttaaa gtaatagact tttaatcttt atgtattttt tgttttctct ggagtacttg
     4381 gacagatgtt atagtggttt cttttaggaa aatctgtcat taaaaaagtt atagccttgc
     4441 aaataaccac tc
//