LOCUS       SEG_HSOPLAH             1399 bp    DNA     linear   HUM 28-JUL-2011
DEFINITION  Homo sapiens 5-oxo-L-prolinase (OPLAH) gene, partial cds.
ACCESSION   AH005594 AF024672 AF024673
VERSION     AH005594.2
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1399)
  AUTHORS   DeBella,L.R. and Wood,S.
  TITLE     Human 5-oxo-L-prolinase partial sequence
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1399)
  AUTHORS   DeBella,L.R. and Wood,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-SEP-1997) Medical Genetics, University of British
            Columbia, 6174 University Blvd., Vancouver, BC V6T 1Z3, Canada
COMMENT     On or before Jul 28, 2011 this sequence version replaced
            gi:2555154, gi:2555155, gi:2555156.
FEATURES             Location/Qualifiers
     source          1..1399
                     /organism="Homo sapiens"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:9606"
                     /chromosome="8"
                     /clone="cosmid 46F4"
                     /clone_lib="LA08NC01 flow sorted chromosome 8-specific
                     cosmid library"
     gene            <1..>1399
                     /gene="OPLAH"
     mRNA            join(<221..342,422..568,768..902,1072..>1207)
                     /gene="OPLAH"
                     /product="5-oxo-L-prolinase"
     CDS             join(<221..342,422..568,768..902,1072..>1207)
                     /gene="OPLAH"
                     /codon_start=3
                     /product="5-oxo-L-prolinase"
                     /protein_id="AAB81519.1"
                     /db_xref="GI:2555157"
                     /translation="TTCRTSVPRWQPTRRASSWWGSFIGQYGLDVVQAYMGHIQANAE
                     LAVRDMLRAFGTSRQARGLPLEVSSEDHMDDGSPIRLRVQISLSQGSAVFDFSGTGPE
                     VFGNLNAPRAVTLSALIYCLRCLVGRXIPLNQGCLAPVRVVIPRGSILXPSPEAAVVG
                     GNXLTSNAWWMFILGAFGA"
     exon            221..342
                     /gene="OPLAH"
     exon            422..568
                     /gene="OPLAH"
     gap             650..749
                     /estimated_length=unknown
     exon            768..902
                     /gene="OPLAH"
     exon            1072..1207
                     /gene="OPLAH"
BASE COUNT          220 a          403 c          428 g          231 t
ORIGIN      
        1 aggaggaggg gtttcctgag gtgttgagca attcccaggc cgggcttggg tgttttttta
       61 ggggccaaga gaccttgttt tgaatntggg aaaacttggt ttggggggtg cagacaggtt
      121 ggccaagggg ttcagtgang aacactgtcc atccagcggt gacggagccn tgcgggcgcc
      181 aggcaagttc cccaactgca gcggaaccag aaacctgcan ggacaacctg tcggacttcc
      241 gtgcccaggt ggcagccaac cagaagggca tccagctggt gggggagctt cattgggcag
      301 tacggcctgg acgtggtgca ggcctacatg ggccatattc aggtgggcct gggcacagga
      361 gtgtgggcgg cagggccatc ctgcaggtga cctggccacc actgatcctg ntccctgcca
      421 ggcaaacgct gagctggccg tgcgagacat gttgcgtgcc tttggaacct cccggcaggc
      481 ccggggcctg cccctggagg tgtcctcgga agaccacatg gacgacggtt cccccatccg
      541 cctccgtgtg cagatcagcc tgagtcaggt gggccgtggg gagagtgcct ttaggcggca
      601 ggggcacggt gcggccgctg acagcctctc ccttnccctc ggggcgcgcn nnnnnnnnnn
      661 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
      721 nnnnnnnnnn nnnnnnnnnn nnnnnnnnng cgcgcctagg cgcgcagggc agcgctgtgt
      781 ttgacttcag cggcactggg ccggaggtgt ttggtaatct caacgcaccg cgggccgtaa
      841 ccctgtccgc cctcatctac tgcctgcgct gtctggtggg ccgcnacatc ccactcaacc
      901 aggttcgcag gggtgtgtgc gcgagggggg gccccanccc gaggtcaccc tgagtgcgcc
      961 tcctgggccc agccacggtc tgaccccacg ggtgctgggg cggggggtgg ggtgctgttt
     1021 ctcccggaag cccaccccaa aanctcctga aaagccgccc gccccgcaca gggctgcctg
     1081 gcgccagtgc gcgtggtcat tccccgaggc tccatcctgn acccgtcccc cgaagcggcg
     1141 gtggtgggcg gcaacnttct cacntccaac gcgtggtgga tgttcatcct gggggccttt
     1201 ggggcctgnc cccctcccaa antttccggg gccgggtttg gcccaactcc ggggccgaat
     1261 gggttgggca ggctggaatt agaaaccgga aggcaaagtt ggggaacccc ttgcccaacc
     1321 ccaacccaac gaacaattcc cctcaaccan ggctgcatna acaacttaac cctggcaacc
     1381 cccaacatng gctactaac
//
	

LOCUS       AB122018                3944 bp    mRNA    linear   HUM 15-AUG-2009
DEFINITION  Homo sapiens 5-OPase mRNA for 5-oxo-L-prolinase, complete cds.
ACCESSION   AB122018
VERSION     AB122018.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3944)
  AUTHORS   Watanabe,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-OCT-2003) to the DDBJ/EMBL/GenBank databases.
            Contact:Tohru Watanabe
            Sankyo Co., Ltd., Intellectual Property Department; 2-58,
            Hiromachi 1-chome, Shinagawa-ku, Tokyo 140-8710, Japan
REFERENCE   2
  AUTHORS   Watanabe,T., Abe,K., Ishikawa,H. and Iijima,Y.
  TITLE     Bovine 5-Oxo-L-Prolinase: Simple Assay Method, Purification, cDNA
            Cloning, and Detection of mRNA in the Coronary Artery
  JOURNAL   Biol. Pharm. Bull. 27, 288-294 (2004)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..3944
                     /db_xref="H-InvDB:HIT000242410"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /organism="Homo sapiens"
     CDS             1..3867
                     /codon_start=1
                     /gene="5-OPase"
                     /product="5-oxo-L-prolinase"
                     /protein_id="BAD13434.1"
                     /transl_table=1
                     /translation="MGSPEGRFHFAIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYA
                     DAPTEGIRRILEQEAGMLLPRDQPLDSSHIASIRMGTTVATNALLERKGERVALLVTR
                     GFRDLLHIGTQARGDLFDLAVPMPEVLYEEVLEVDERVVLHRGEAGTGTPVKGRTGDL
                     LEVQQPVDLGALRGKLEGLLSRGIRSLAVVLMHSYTWAQHEQQVGVLARELGFTHVSL
                     SSEAMPMVRIVPRGHTACADAYLTPAIQRYVQGFCRGFQGQLKDVQVLFMRSDGGLAP
                     MDTFSGSSAVLSGPAGGVVGYSATTYQQEGGQPVIGFDMGGTSTDVSRYAGEFEHVFE
                     ASTAGVTLQAPQLDINTVAAGGGSRLFFRSGLFVVGPESAGAHPGPACYRKGGPVTVT
                     DANLVLGRLLPASFPCIFGPGENQPLSPEASRKALEAVATEVNSFLTNGPCPASPLSL
                     EEVAMGFVRVANEAMCRPIRALTQARGHDPSAHVLACFGGAGGQHACAIARALGMDTV
                     HIHRHSGLLSALGLALADVVHEAQEPCSLLYAPETFVQLDQRLSRLEEQCVDALQAQG
                     FPRSQISTESFLHLRYQGTDCALMVSAHQHPATARSPRAGDFGAAFVERYMREFGFVI
                     PERPVVVDDVRVRGTGRSGLRLEDAPKAQTGPPRVDKMTQCYFEGGYQETPVYLLAEL
                     GYGHKLHGPCLIIDSNSTILVEPGCQAEVTKTGDICISVGAEVPGTVGPQLDPIQLSI
                     FSHRFMSIAEQMGRILQRTAISTNIKERLDFSCALFGPDGGLVSNAPHIPVHLGAMQE
                     TVQFQIQHLGADLHPGDVLLSNHPSAGGSHLPDLTVITPVFWPGQTRPVFYVASRGHH
                     ADIGGITPGSMPPHSTMLQQEGAVFLSFKLVQGGVFQEEAVTEALRAPGKVPNCSGTR
                     NLHDNLSDLRAQVAANQKGIQLVGELIGQYGLDVVQAYMGHIQANAELAVRDMLRAFG
                     TSRQARGLPLEVSSEDHMDDGSPIRLRVQISLSQGSAVFDFSGTGPEVFGNLNAPRAV
                     TLSALIYCLRCLVGRDIPLNQGCLAPVRVVIPRGSILDPSPEAAVVGGNVLTSQRVVD
                     VILGAFGACAASQGCMNNVTLGNAHMGYYETVAGGAGAGPSWHGRSGVHSHMTNTRIT
                     DPEILESRYPVILRRFELRRGSGGRGRFRGGDGVTRELLFREEALLSVLTERRAFRPY
                     GLHGGEPGARGLNLLIRKNGRTVNLGGKTSVTVYPGDVFCLHTPGGGGYGDPEDPAPP
                     PGSPPQALAFPEHGSVYEYRRAQEAV"
BASE COUNT          662 a         1294 c         1311 g          677 t
ORIGIN      
        1 atgggcagcc ccgagggccg cttccacttt gccatcgacc gtgggggtac cttcacagac
       61 gtctttgccc agtgcccagg ggggcacgtg cgggtcttaa aactgctctc agaggaccct
      121 gccaactatg cggacgcgcc aaccgaaggc atccgccgca tcctggagca ggaggccggc
      181 atgctcctgc cccgggacca gccgctggac tccagtcata tcgccagcat ccgcatgggc
      241 accacagtgg ccaccaacgc actgctggag cggaaggggg agcgggtggc gctgctggtg
      301 acacgtggct tccgagacct gctgcacatt ggcacccaag cccgtgggga cctctttgac
      361 ctggccgtgc ccatgcctga ggtgctgtat gaagaggtgc tggaggtgga cgaacgcgtg
      421 gtgctgcacc gtggagaggc gggcaccggg acgcctgtga aaggccgcac gggggacctg
      481 ctggaagtgc agcagcctgt ggacctgggg gccctgcgtg ggaagctgga ggggctgcta
      541 tctcgaggca tccgcagcct ggctgtggtg ctcatgcact cgtacacgtg ggcccagcat
      601 gagcagcagg tgggtgtgct ggcccgggag ctgggcttca cgcacgtgtc actgtcctcg
      661 gaggccatgc ccatggtgcg catcgtccct cgggggcaca cggcctgtgc cgacgcctac
      721 ctcacgcccg ccatccagcg ctacgtgcag ggcttctgcc gtggcttcca gggccaactc
      781 aaggatgtgc aggtgttgtt catgcgctcc gatggcggcc tggcgcccat ggacaccttc
      841 agcggctcca gtgctgtgct ctcgggcccg gccggcggcg tggtgggcta ctcagccacc
      901 acctaccagc aggagggtgg ccagcctgtc atcggctttg acatgggagg cacgtccacg
      961 gatgtgagcc gctatgctgg ggaattcgag cacgtcttcg aggccagcac agctggcgtc
     1021 accctccagg ccccgcagct ggacatcaac accgtggcag cgggaggggg ttcccgcctc
     1081 ttcttcaggt ctggcctctt tgtggttggg cccgagtcag caggagccca cccaggaccc
     1141 gcctgctacc gcaaaggggg ccctgtgaca gtgacggatg ctaatctggt cctgggtcgc
     1201 ctgctgcctg cctccttccc ctgcattttt gggccgggag agaaccaacc actttcccct
     1261 gaggcctccc gcaaagccct ggaggctgtg gccactgagg tcaacagctt cctgaccaac
     1321 gggccctgcc cggcctcccc gctgagcctg gaggaggtgg ccatggggtt cgtgcgcgtg
     1381 gccaacgagg ccatgtgccg gcccatccgt gcactcacgc aggcaagagg ccatgacccc
     1441 tcagcccatg tgctggcctg ctttggggga gctggtgggc agcatgcatg tgccatcgcc
     1501 cgggccctgg gcatggacac ggtgcacatc cacaggcaca gtgggctgct gtcggccctg
     1561 gggctggccc tggctgacgt ggtgcatgag gcacaggaac cctgctccct gctctacgcg
     1621 cctgagacct tcgtgcagct ggaccagagg ctgagccgcc tggaggagca gtgtgtggat
     1681 gctctgcagg cccagggctt ccccaggtcc cagatcagca ctgagagctt cctgcacctg
     1741 cgctaccagg gcacggactg tgctctgatg gtgtctgccc accagcaccc agccacagcc
     1801 cgctcgcccc gtgcggggga cttcggggca gcctttgtgg agcggtacat gagggagttt
     1861 ggctttgtca tacctgagcg gccggtggtc gtggacgatg tgcgagtgcg gggcaccggc
     1921 cgcagtggtc ttcgcctcga ggatgccccc aaagcccaga ccgggcctcc ccgggtggac
     1981 aagatgaccc agtgctactt tgaggggggc taccaggaga cccctgtgta cctgctggca
     2041 gagctgggct atgggcacaa gctccatggg ccctgcctca tcatcgacag taacagcacc
     2101 atcctggtgg agccaggttg ccaggcagag gtgaccaaga caggggacat ctgcatctcc
     2161 gtgggggccg aagtccccgg cacagtgggc ccccagctgg accctatcca gctgtccatc
     2221 ttctcacacc gcttcatgag cattgctgag cagatgggcc gcatcctgca gcgcacagcc
     2281 atctccacca acatcaagga gcgtctggac ttctcctgtg ccctctttgg gcccgatggg
     2341 gggctggtgt ccaatgcccc ccacatccct gtgcacctgg gtgccatgca ggagacggtg
     2401 cagttccaga ttcagcacct gggggccgat ctccaccctg gcgacgtgct actgagcaac
     2461 catcccagtg ccgggggcag ccacctgcca gacctgactg ttatcacacc ggtgttttgg
     2521 ccgggtcaga cgcggcctgt gttctatgtg gccagccgag ggcaccacgc agacatcggg
     2581 ggcatcacac caggctccat gcccccccac tccaccatgc tgcaacagga gggtgccgtc
     2641 tttctgtcct tcaaacttgt ccaggggggc gtcttccagg aggaggcggt gacggaggcc
     2701 ctgcgggcgc caggcaaggt ccccaactgc agcggaacca gaaacctgca cgacaacctg
     2761 tcggacctcc gtgcccaggt ggcagccaac cagaagggca tccagctggt gggggagctc
     2821 attgggcagt acggcctgga cgtggtgcag gcctacatgg gccatattca ggcaaacgct
     2881 gagctggccg tgcgagacat gttgcgtgcc tttggaacct cccggcaggc ccggggcctg
     2941 cccctggagg tgtcctcgga agaccacatg gacgacggtt cccccatccg cctccgtgtg
     3001 cagatcagcc tgagtcaggg cagcgctgtg tttgacttca gcggcactgg gccggaggtg
     3061 tttggtaatc tcaacgcacc gcgggccgta accctgtccg ccctcatcta ctgcctgcgc
     3121 tgtctggtgg gccgcgacat cccactcaac cagggctgcc tggcgccagt gcgcgtggtc
     3181 attccccgag gctccatcct ggacccgtcg cccgaggcgg cggtggtggg cggcaacgtg
     3241 ctcacgtcgc agcgcgtggt ggatgtcatc ctgggggcct ttggggcctg cgccgcctcc
     3301 cagggctgca tgaacaacgt gaccctgggc aacgcccaca tgggctacta cgagacggtg
     3361 gcgggcggcg cgggcgcggg tcccagctgg cacgggcgca gcggtgtgca cagccacatg
     3421 accaacacac gcatcaccga ccctgagatc ctggagagcc ggtacccggt catcctgcgc
     3481 cgcttcgagc tgcggcgggg ctcggggggc agaggccgct tccgaggcgg cgacggcgtc
     3541 acccgcgagc tgctctttcg tgaggaggcg ctgctgtcag tgctgaccga gcgccgcgcc
     3601 ttccggccat acgggctcca cgggggcgag cctggcgccc gcggcctaaa cctgctgatc
     3661 cgcaaaaacg gccggacggt gaatctgggc ggcaagacgt cggtgaccgt gtaccccggg
     3721 gatgtgttct gtctccacac gcccggcggc ggtggctatg gggacccgga ggaccccgcc
     3781 ccaccgccgg ggtcgccccc gcaagcactg gcctttcccg agcacggcag cgtctatgag
     3841 tatcgccggg cccaggaggc cgtgtgagga tcccgcaata aagatgcctt aagtctcccg
     3901 gttctgggga cgcagctaaa aaaaaaaaaa aaaaaaaaaa aaaa
//