LOCUS AF020352 488 bp mRNA linear HUM 16-NOV-2016 DEFINITION Homo sapiens NADH:ubiquinone oxidoreductase 15 kDa IP subunit mRNA, nuclear gene encoding mitochondrial protein, complete cds. ACCESSION AF020352 VERSION AF020352.2 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 488) AUTHORS Loeffen,J., Smeets,R., Smeitink,J., Triepels,R., Sengers,R., Trijbels,F. and van den Heuvel,L. TITLE The human NADH: ubiquinone oxidoreductase NDUFS5 (15 kDa) subunit: cDNA cloning, chromosomal localization, tissue distribution and the absence of mutations in isolated complex I-deficient patients JOURNAL J. Inherit. Metab. Dis. 22 (1), 19-28 (1999) PUBMED 10070614 REFERENCE 2 (bases 1 to 488) AUTHORS Van Den Heuvel,L., Ruitenbeek,W., Smeets,R., Gelman-Kohan,Z., Elpeleg,O., Loeffen,J., Trijbels,F., Mariman,E., De Bruijn,D. and Smeitink,J. TITLE Direct Submission JOURNAL Submitted (21-AUG-1997) Department of Pediatrics and Human Genetics, University Hospital Nijmegen, P.O. Box 9101, Nijmegen, Gelderland 6500 HB, The Netherlands REFERENCE 3 (bases 1 to 488) AUTHORS Van Den Heuvel,L., Ruitenbeek,W., Smeets,R., Gelman-Kohan,Z., Elpeleg,O., Loeffen,J., Trijbels,F., Mariman,E., De Bruijn,D. and Smeitink,J. TITLE Direct Submission JOURNAL Submitted (16-NOV-2016) Department of Pediatrics and Human Genetics, University Hospital Nijmegen, P.O. Box 9101, Nijmegen, Gelderland 6500 HB, The Netherlands REMARK Sequence update by database staff to remove vector contamination COMMENT On Nov 16, 2016 this sequence version replaced AF020352.1. FEATURES Location/Qualifiers source 1..488 /db_xref="H-InvDB:HIT000062513" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" CDS 39..359 /note="subunit of Mitochondrial Complex I" /codon_start=1 /product="NADH:ubiquinone oxidoreductase 15 kDa IP subunit" /protein_id="AAB87866.1" /translation="MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECA HGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKG EPRP" regulatory 457..462 /regulatory_class="polyA_signal_sequence" polyA_site 477 BASE COUNT 150 a 99 c 131 g 108 t ORIGIN 1 ggccagagaa gagtcaaggg cacgagcatc gggtagccat gcctttcttg gacatccaga 61 aaaggttcgg ccttaacata gatcgatggt tgacaatcca gagtggtgaa cagccctaca 121 agatggctgg tcgatgccat gcttttgaaa aagaatggat agaatgtgca catggaatcg 181 gttatactcg ggcagagaaa gagtgcaaga tagaatatga tgatttcgta gagtgtttgc 241 ttcggcagaa aacgatgaga cgtgcaggta ccatcaggaa gcagcgggat aagctgataa 301 aggaaggaaa gtacacccct ccacctcacc acattggcaa gggggagcct cggccctgaa 361 cagagcagct gctgatgtct ggaggctgat tttcctgttc tctgttctcc actggaaagg 421 ttgtttacga caaacctcct tgtcaaagtg tgtaaaaata aaggattgct ccatcctaaa 481 aaaaaaaa //