LOCUS       AF020352                 488 bp    mRNA    linear   HUM 16-NOV-2016
DEFINITION  Homo sapiens NADH:ubiquinone oxidoreductase 15 kDa IP subunit mRNA,
            nuclear gene encoding mitochondrial protein, complete cds.
ACCESSION   AF020352
VERSION     AF020352.2
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 488)
  AUTHORS   Loeffen,J., Smeets,R., Smeitink,J., Triepels,R., Sengers,R.,
            Trijbels,F. and van den Heuvel,L.
  TITLE     The human NADH: ubiquinone oxidoreductase NDUFS5 (15 kDa) subunit:
            cDNA cloning, chromosomal localization, tissue distribution and the
            absence of mutations in isolated complex I-deficient patients
  JOURNAL   J. Inherit. Metab. Dis. 22 (1), 19-28 (1999)
   PUBMED   10070614
REFERENCE   2  (bases 1 to 488)
  AUTHORS   Van Den Heuvel,L., Ruitenbeek,W., Smeets,R., Gelman-Kohan,Z.,
            Elpeleg,O., Loeffen,J., Trijbels,F., Mariman,E., De Bruijn,D. and
            Smeitink,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-AUG-1997) Department of Pediatrics and Human
            Genetics, University Hospital Nijmegen, P.O. Box 9101, Nijmegen,
            Gelderland 6500 HB, The Netherlands
REFERENCE   3  (bases 1 to 488)
  AUTHORS   Van Den Heuvel,L., Ruitenbeek,W., Smeets,R., Gelman-Kohan,Z.,
            Elpeleg,O., Loeffen,J., Trijbels,F., Mariman,E., De Bruijn,D. and
            Smeitink,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-NOV-2016) Department of Pediatrics and Human
            Genetics, University Hospital Nijmegen, P.O. Box 9101, Nijmegen,
            Gelderland 6500 HB, The Netherlands
  REMARK    Sequence update by database staff to remove vector contamination
COMMENT     On Nov 16, 2016 this sequence version replaced AF020352.1.
FEATURES             Location/Qualifiers
     source          1..488
                     /db_xref="H-InvDB:HIT000062513"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             39..359
                     /note="subunit of Mitochondrial Complex I"
                     /codon_start=1
                     /product="NADH:ubiquinone oxidoreductase 15 kDa IP
                     subunit"
                     /protein_id="AAB87866.1"
                     /translation="MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECA
                     HGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKG
                     EPRP"
     regulatory      457..462
                     /regulatory_class="polyA_signal_sequence"
     polyA_site      477
BASE COUNT          150 a           99 c          131 g          108 t
ORIGIN      
        1 ggccagagaa gagtcaaggg cacgagcatc gggtagccat gcctttcttg gacatccaga
       61 aaaggttcgg ccttaacata gatcgatggt tgacaatcca gagtggtgaa cagccctaca
      121 agatggctgg tcgatgccat gcttttgaaa aagaatggat agaatgtgca catggaatcg
      181 gttatactcg ggcagagaaa gagtgcaaga tagaatatga tgatttcgta gagtgtttgc
      241 ttcggcagaa aacgatgaga cgtgcaggta ccatcaggaa gcagcgggat aagctgataa
      301 aggaaggaaa gtacacccct ccacctcacc acattggcaa gggggagcct cggccctgaa
      361 cagagcagct gctgatgtct ggaggctgat tttcctgttc tctgttctcc actggaaagg
      421 ttgtttacga caaacctcct tgtcaaagtg tgtaaaaata aaggattgct ccatcctaaa
      481 aaaaaaaa
//