LOCUS       AF008442                1277 bp    mRNA    linear   HUM 21-APR-1998
DEFINITION  Homo sapiens RNA polymerase I subunit hRPA39 mRNA, complete cds.
ACCESSION   AF008442
VERSION     AF008442.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1277)
  AUTHORS   Dammann,R. and Pfeifer,G.P.
  TITLE     Cloning and characterization of the human RNA polymerase I subunit
            hRPA40
  JOURNAL   Biochim. Biophys. Acta 1396 (2), 153-157 (1998)
   PUBMED   9540830
REFERENCE   2  (bases 1 to 1277)
  AUTHORS   Dammann,R. and Pfeifer,G.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-JUN-1997) Biology, Beckman Research Institute of the
            City of Hope Medical Center, 1450 East Duarte Rd, Duarte, CA 91010,
            CA
FEATURES             Location/Qualifiers
     source          1..1277
                     /db_xref="H-InvDB:HIT000061928"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_type="keratinocyte"
     CDS             13..1053
                     /codon_start=1
                     /product="RNA polymerase I subunit hRPA39"
                     /protein_id="AAC14354.1"
                     /db_xref="GI:2266929"
                     /translation="MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDR
                     FEKNFRVDVVHMDENSLEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQ
                     DEILAHRLGLIPIHADPRLFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPN
                     ELYVNHKVYTRHMTWIPLGNQADLFPEGTIRPVHDDILIAQLRPGQEIDLLMHCVKGI
                     GKDHAKFSPVATASYRLLPDITLLEPVEGEAAEELSRCFSPGVIEVQEVQGKKVARVA
                     NPRLDTFSREIFRNEKLKKVVRLARVRDHYIFSVESTGVLPPDVLVSEAIKVLMGKCR
                     RFLDELDAVQMD"
BASE COUNT          333 a          288 c          345 g          311 t
ORIGIN      
        1 gagagagaga agatggcggc ttctcaggcg gtggaggaaa tgcggagccg cgtggttctg
       61 ggggagtttg gggttcgcaa tgtccatact actgactttc ccggtaacta ttccggttat
      121 gatgatgcct gggaccagga ccgcttcgag aagaatttcc gtgtggatgt agtacacatg
      181 gatgaaaact cactggagtt tgacatggtg ggaattgacg cagccattgc caatgctttt
      241 cgacgaattc tgctagctga ggtgccaact atggctgtgg agaaggtcct ggtgtacaat
      301 aatacatcca ttgttcagga tgagattctt gctcaccgtc tggggctcat tcccattcat
      361 gctgatcccc gtctttttga gtatcggaac caaggagatg aagaaggcac agagatagat
      421 actctacagt ttcgtctcca ggtcagatgc actcggaacc cccatgctgc taaagattcc
      481 tctgacccca acgaactgta cgtgaaccac aaagtgtata ccaggcatat gacatggatc
      541 cccctgggga accaggctga tctctttcca gagggcacta tccgaccagt gcatgatgat
      601 atcctcatcg ctcagctgcg gcctggccaa gaaattgacc tgctcatgca ctgtgtcaag
      661 ggcattggca aagatcatgc caagttttca ccagtggcaa cagccagtta caggctcctg
      721 ccagacatca ccctgcttga gcccgtggaa ggggaggcag ctgaggagtt gagcaggtgc
      781 ttctcacctg gtgttattga ggtgcaggaa gtccaaggta aaaaggtggc cagagttgcc
      841 aacccccggc tggatacctt cagcagagaa atcttccgga atgagaagct aaagaaggtt
      901 gtgaggcttg cccgggttcg agatcattat atcttctctg ttgagtcaac gggggtgttg
      961 ccaccagatg tgctggtgag tgaagccatc aaagtactga tggggaagtg ccggcgcttc
     1021 ttggatgaac tagatgcggt tcagatggac tgagcttgga tgcttctgag gcaagctgaa
     1081 gctttgggtt ctgactgacc caccctacag gactgctgaa cagagagccc agtgtgacta
     1141 gggatcctga gttttctggg acaattccag ctttaatcaa tacattttgt taaatgtgcc
     1201 ataaaatgag actttttacg cctttataag gccttagatg taaataaact cacccaaaca
     1261 aaaaaaaaaa aaaaaaa
//