LOCUS       AF006464                2666 bp    mRNA    linear   HUM 15-JUL-1997
DEFINITION  Homo sapiens muscle specific tyrosine kinase receptor (MUSK) mRNA,
            complete cds.
ACCESSION   AF006464
VERSION     AF006464.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2666)
  AUTHORS   Valenzuela,D.M., Stitt,T.N., DiStefano,P.S., Rojas,E., Mattsson,K.,
            Compton,D.L., Nunez,L., Park,J.S., Stark,J.L., Gies,D.R.,
            Thomas,S., LeBeau,M.M., Fernald,A.A., Copeland,N.G., Jenkins,N.A.,
            Burden,S.J., Glass,D.J. and Yancopoulos,G.D.
  TITLE     Receptor tyrosine kinase specific for the skeletal muscle lineage:
            expression in embryonic muscle, at the neuromuscular junction, and
            after injury
  JOURNAL   Neuron 15 (3), 573-584 (1995)
   PUBMED   7546737
REFERENCE   2  (bases 1 to 2666)
  AUTHORS   Valenzuela,D.M., Rojas,E. and Yancopoulos,G.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAY-1997) Discovery Group, Regeneron Pharmaceuticals,
            Inc., 777 Old Saw Mill River Rd., Tarrytown, NY 10591, USA
FEATURES             Location/Qualifiers
     source          1..2666
                     /db_xref="H-InvDB:HIT000061830"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="9"
                     /map="9q31.3-32"
     gene            1..2666
                     /gene="MUSK"
     CDS             47..2656
                     /gene="MUSK"
                     /codon_start=1
                     /product="muscle specific tyrosine kinase receptor"
                     /protein_id="AAB63044.1"
                     /db_xref="GI:2253312"
                     /translation="MRELVNIPLVHILTLVAFSGTEKLPKAPVITTPLETVDALVEEV
                     ATFMCAVESYPQPEISWTRNKILIKLFDTRYSIRENGQLLTILSVEDSDDGIYCCTAN
                     NGVGGAVESCGALQVKMKPKITRPPINVKIIEGLKAVLPCTTMGNPKPSVSWIKGDSP
                     LRENSRIAVLESGSLRIHNVQKEDAGQYRCVAKNSLGTAYSKVVKLEVEVFARILRAP
                     ESHNVTFGSFVTLHCTATGIPVPTITWIENGNAVSSGSIQESVKDRVIDSRLQLFITK
                     PGLYTCIATNKHGEKFSTAKAAATISIAEWSKPQKDNKGYCAQYRGEVCNAVLAKDAL
                     VFLNTSYADPEEAQELLVHTAWNELKVVSPVCRPAAEALLCNHIFQECSPGVVPTPIP
                     ICREYCLAVKELFCAKEWLVMEEKTHRGLYRSEMHLLSVPECSKLPSMHWDPTACARL
                     PHLDYNKENLKTFPPMTSSKPSVDIPNLPSSSSSSFSVSPTYSMTVIISIMSSFAIFV
                     LLTITTLYCCRRRKQWKNKKRESAAVTLTTLPSELLLDRLHPNPMYQRMPLLLNPKLL
                     SLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPYEPFTMVAVKMLKEEASADMQADFQ
                     REAALMAEFDNPNIVKLLGVCAVGKPMCLLFEYMAYGDLNEFLRSMSPHTVCSLSHSD
                     LSMRAQVSSPGPPPLSCAEQLCIARQVAAGMAYLSERKFVHRDLATRNCLVGENMVVK
                     IADFGLSRNIYSADYYKANENDAIPIRWMPPESIFYNRYTTESDVWAYGVVLWEIFSY
                     GLQPYYGMAHEEVIYYVRDGNILSCPENCPVELYNLMRLCWSKLPADRPSFTSIHRIL
                     ERMCERAEGTVSV"
BASE COUNT          713 a          678 c          642 g          633 t
ORIGIN      
        1 tgcgttgtcc agaaggaact tcgtcctgcg tgagcctgga ttaatcatga gagagctcgt
       61 caacattcca ctggtacata ttcttactct ggttgccttc agcggaactg agaaacttcc
      121 aaaagctcct gtcatcacca ctcctcttga aacagtggat gccttagttg aagaagtggc
      181 tactttcatg tgtgcagtgg aatcctaccc ccagcctgag atttcctgga ctagaaataa
      241 aattctcatt aaactctttg acacccggta cagcatccgg gagaatgggc agctcctcac
      301 catcctgagt gtggaagaca gtgatgatgg catttactgc tgcacggcca acaatggtgt
      361 gggaggagct gtggagagtt gtggagccct gcaagtgaag atgaaaccta aaataactcg
      421 ccctcccata aatgtgaaaa taatagaggg attaaaagca gtcctaccat gtactacaat
      481 gggtaatccc aaaccatcag tgtcttggat aaagggagac agccctctca gggaaaattc
      541 ccgaattgca gttcttgaat ctgggagctt gaggattcat aacgtacaaa aggaagatgc
      601 aggacagtat cgatgtgtgg caaaaaacag cctcgggaca gcatattcca aagtggtgaa
      661 gctggaagtt gaggtttttg ccaggatcct gcgggctcct gaatcccaca atgtcacctt
      721 tggctccttt gtgaccctgc actgtacagc aacaggcatt cctgtcccca ccatcacctg
      781 gattgaaaac ggaaatgctg tttcttctgg gtccattcaa gagagtgtga aagaccgagt
      841 gattgactca agactgcagc tgtttatcac caagccagga ctctacacat gcatagctac
      901 caataagcat ggggagaagt tcagtactgc caaggctgca gccaccatca gcatagcaga
      961 atggagtaaa ccacagaaag ataacaaagg ctactgcgcc cagtacagag gggaggtgtg
     1021 taatgcagtc ctggcaaaag atgctcttgt ttttctcaac acctcctatg cggaccctga
     1081 ggaggcccaa gagctactgg tccacacggc ctggaatgaa ctgaaagtag tgagcccagt
     1141 ctgccggcca gctgctgagg ctttgttgtg taaccacatc ttccaggagt gcagtcctgg
     1201 agtagtgcct actcctattc ccatttgcag agagtactgc ttggcagtaa aggagctctt
     1261 ctgcgcaaaa gaatggctgg taatggaaga gaagacccac agaggactct acagatccga
     1321 gatgcatttg ctgtccgtgc cagaatgcag caagcttccc agcatgcatt gggaccccac
     1381 ggcctgtgcc agactgccac atctagatta taacaaagaa aacctaaaaa cattcccacc
     1441 aatgacgtcc tcaaagccaa gtgtggacat tccaaatctg ccttcctcct cctcttcttc
     1501 cttctctgtc tcacctacat actccatgac tgtaataatc tccatcatgt ccagctttgc
     1561 aatatttgtg cttcttacca taactactct ctattgctgc cgaagaagaa aacaatggaa
     1621 aaataagaaa agagaatcag cagcagtaac cctcaccaca ctgccttctg agctcttact
     1681 agatagactt catcccaacc ccatgtacca gaggatgccg ctccttctga accccaaatt
     1741 gctcagcctg gagtatccaa ggaataacat tgaatatgtg agagacatcg gagagggagc
     1801 gtttggaagg gtgtttcaag caagggcacc aggcttactt ccctatgaac ctttcactat
     1861 ggtggcagta aagatgctca aagaagaagc ctcggcagat atgcaagcgg actttcagag
     1921 ggaggcagcc ctcatggcag aatttgacaa ccctaacatt gtgaagctat taggagtgtg
     1981 tgctgtcggg aagccaatgt gcctgctctt tgaatacatg gcctatggtg acctcaatga
     2041 gttcctccgc agcatgtccc ctcacaccgt gtgcagcctc agtcacagtg acttgtctat
     2101 gagggctcag gtctccagcc ctgggccccc acccctctcc tgtgctgagc agctttgcat
     2161 tgccaggcag gtggcagctg gcatggctta cctctcagaa cgtaagtttg ttcaccgaga
     2221 tttagccacc aggaactgcc tggtgggcga gaacatggtg gtgaaaattg ccgactttgg
     2281 cctctccagg aacatctact cagcagacta ctacaaagct aatgaaaacg acgctatccc
     2341 tatccgttgg atgccaccag agtccatttt ttataaccgc tacactacag agtctgatgt
     2401 gtgggcctat ggcgtggtcc tctgggagat cttctcctat ggcctgcagc cctactatgg
     2461 gatggcccat gaggaggtca tttactacgt gcgagatggc aacatcctct cctgccctga
     2521 gaactgcccc gtggagctgt acaatctcat gcgtctatgt tggagcaagc tgcctgcaga
     2581 cagacccagt ttcaccagta ttcaccgaat tctggaacgc atgtgtgaga gggcagaggg
     2641 aactgtgagt gtctaaggtt gaagac
//