LOCUS       AF001846                3058 bp    mRNA    linear   HUM 01-OCT-2001
DEFINITION  Homo sapiens lymphoid phosphatase LyP1 mRNA, complete cds.
ACCESSION   AF001846
VERSION     AF001846.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3058)
  AUTHORS   Cohen,S., Dadi,H., Shaoul,E., Sharfe,N. and Roifman,C.M.
  TITLE     Cloning and characterization of a lymphoid-specific, inducible
            human protein tyrosine phosphatase, Lyp
  JOURNAL   Blood 93 (6), 2013-2024 (1999)
   PUBMED   10068674
REFERENCE   2  (bases 1 to 3058)
  AUTHORS   Roifman,C.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-APR-1997) Immunology and Allergy, The Hospital For
            Sick Children, 555 University Avenue, Toronto, Ontario M5G 1X8,
            Canada
FEATURES             Location/Qualifiers
     source          1..3058
                     /db_xref="H-InvDB:HIT000061661"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_type="thymocytes"
     CDS             42..2468
                     /codon_start=1
                     /product="lymphoid phosphatase LyP1"
                     /protein_id="AAD00904.1"
                     /db_xref="GI:4100632"
                     /translation="MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTY
                     PTTVAENAKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIAT
                     QGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKKKCERYWAEPGEMQLEFGPFSVSC
                     EAEKRKSDYIIRTLKVKFNSETRTIYQFHYKNWPDHDVPSSIDPILELIWDVRCYQED
                     DSVPICIHCSAGCGRTGVICAIVDYTWMLLKDGIIPENFSVFSLIREMRTQRPSLVQT
                     QEQYELVYNAVLELFKRQMDVIRDKHSGTESQAKHCIPEKNHTLQADSYSPNLPKSTT
                     KAAKMMNQQRTKMEIKESSSFDFRTSEISAKEELVLHPAKSSTSFDFLELNYSFDKNA
                     DTTMKWQTKAFPIVGEPLQKHQSLDLGSLLFEGCSNSKPVNAAGRYFNSKVPITRTKS
                     TPFELIQQRETKEVDSKENFSYLESQPHDSCFVEMQAQKVMHVSSAELNYSLPYDSKH
                     QIRNASNVKHHDSSALGVYSYIPLVENPYFSSWPPSGTSSKMSLDLPEKQDGTVFPSS
                     LLPTSSTSLFSYYNSHDSLSLNSPTNISSLLNQESAVLATAPRIDDEIPPPLPVRTPE
                     SFIVVEEAGEFSPNVPKSLSSAVKVKIGTSLEWGGTSEPKKFDDSVILRPSKSVKLRS
                     PKSELHQDRSSPPPPLPERTLESFFLADEDCMQAQSIETYSTSYPDTMENSTSSKQTL
                     KTPGKSFTRSKSLKILRNMKKSICNSCPPNKPAESVQSNNSSSFLNFGFANRFSKPKG
                     PRNPPPTWNI"
BASE COUNT         1015 a          592 c          553 g          898 t
ORIGIN      
        1 tccctcaacc tacttataga ctatttttct tgctctgcag catggaccaa agagaaattc
       61 tgcagaagtt cctggatgag gcccaaagca agaaaattac taaagaggag tttgccaatg
      121 aatttctgaa gctgaaaagg caatctacca agtacaaggc agacaaaacc tatcctacaa
      181 ctgtggctga gaatgccaag aatatcaaga aaaacagata taaggatatt ttgccctatg
      241 attatagccg ggtagaacta tccctgataa cctctgatga ggattccagc tacatcaatg
      301 ccaacttcat taagggagtt tatggaccca aggcttatat tgccacccag ggtcctttat
      361 ctacaaccct cctggacttc tggaggatga tttgggaata tagtgtcctt atcattgtta
      421 tggcatgcat ggagtatgaa atgggaaaga aaaagtgtga gcgctactgg gctgagccag
      481 gagagatgca gctggaattt ggccctttct ctgtatcctg tgaagctgaa aaaaggaaat
      541 ctgattatat aatcaggact ctaaaagtta agttcaatag tgaaactcga actatctacc
      601 agtttcatta caagaattgg ccagaccatg atgtaccttc atctatagac cctattcttg
      661 agctcatctg ggatgtacgt tgttaccaag aggatgacag tgttcccata tgcattcact
      721 gcagtgctgg ctgtggaagg actggtgtta tttgtgctat tgttgattat acatggatgt
      781 tgctaaaaga tgggataatt cctgagaact tcagtgtttt cagtttgatc cgggaaatgc
      841 ggacacagag gccttcatta gttcaaacgc aggaacaata tgaactggtc tacaatgctg
      901 tattagaact atttaagaga cagatggatg ttatcagaga taaacattct ggaacagaga
      961 gtcaagcaaa gcattgtatt cctgagaaaa atcacactct ccaagcagac tcttattctc
     1021 ctaatttacc aaaaagtacc acaaaagcag caaaaatgat gaaccaacaa aggacaaaaa
     1081 tggaaatcaa agaatcttct tcctttgact ttaggacttc tgaaataagt gcaaaagaag
     1141 agctagtttt gcaccctgct aaatcaagca cttcttttga ctttctggag ctaaattaca
     1201 gttttgacaa aaatgctgac acaaccatga aatggcagac aaaggcattt ccaatagttg
     1261 gggagcctct tcagaagcat caaagtttgg atttgggctc tcttttgttt gagggatgtt
     1321 ctaattctaa acctgtaaat gcagcaggaa gatattttaa ttcaaaggtg ccaataacac
     1381 ggaccaaatc aactcctttt gaattgatac agcagagaga aaccaaggag gtggacagca
     1441 aggaaaactt ttcttatttg gaatctcaac cacatgattc ttgttttgta gagatgcagg
     1501 ctcaaaaagt aatgcatgtt tcttcagcag aactgaatta ttcactgcca tatgactcta
     1561 aacaccaaat acgtaatgcc tctaatgtaa agcaccatga ctctagtgct cttggtgtat
     1621 attcttacat acctttagtg gaaaatcctt atttttcatc atggcctcca agtggtacca
     1681 gttctaagat gtctcttgat ttacctgaga agcaagatgg aactgttttt ccttcttctc
     1741 tgttgccaac atcctctaca tccctcttct cttattacaa ttcacatgat tctttatcac
     1801 tgaattctcc aaccaatatt tcctcactat tgaaccagga gtcagctgta ctagcaactg
     1861 ctccaaggat agatgatgaa atcccccctc cacttcctgt acggacacct gaatcattta
     1921 ttgtggttga ggaagctgga gaattctcac caaatgttcc caaatcctta tcctcagctg
     1981 tgaaggtaaa aattggaaca tcactggaat ggggtggaac atctgaacca aagaaatttg
     2041 atgactctgt gatacttaga ccaagcaaga gtgtaaaact ccgaagtcct aaatcagaac
     2101 tacatcaaga tcgttcttct cccccacctc ctctcccaga aagaactcta gagtccttct
     2161 ttcttgccga tgaagattgt atgcaggccc aatctataga aacatattct actagctatc
     2221 ctgacaccat ggaaaattca acatcttcaa aacagacact gaagactcct ggaaaaagtt
     2281 tcacaaggag taagagtttg aaaattttgc gaaacatgaa aaagagtatc tgtaattctt
     2341 gcccaccaaa caagcctgca gaatctgttc agtcaaataa ctccagctca tttctgaatt
     2401 ttggttttgc aaaccgtttt tcaaaaccca aaggaccaag gaatccacca ccaacttgga
     2461 atatttaata aaactcagat ttataataat atgggctgca agtacacctg caaataaaac
     2521 tactagaata ctgctagtta aaataagtgc tctatatgca taatatgaag atatgctaat
     2581 gtgttaatag cttttaaaag aaaagcaaaa tgccaataag tgccagtttt gcattttcat
     2641 atcatttgca ttgagttgaa aactgcaaat aaaagtttgt cacttgagct tatgtacaga
     2701 atgctatatg agaaacactt ttagaatgga tttatttttc atttttgcca gttattttta
     2761 ttttctttta cttttctaca taaacataaa cttcaaaagg tttgtaagat ttggatctca
     2821 actaatttct acattgccag aatatactat aaaaagttaa aaaaaaaaac ttactttgtg
     2881 ggttgcaata caaactgctc ttgacaatga ctattccctg acagttattt ttgcctaaat
     2941 ggagtatacc ttgtaaatct tcccaaatgt tgtggaaaac tggaatatta agaaaatgag
     3001 aaattatatt tattagaata aaatgtgcaa ataatgacaa ttatttgaat gtaacaag
//