LOCUS       HSAF000546              1118 bp    mRNA    linear   HUM 02-JUL-1997
DEFINITION  Homo sapiens purinergic receptor P2Y5 mRNA, complete cds.
ACCESSION   AF000546
VERSION     AF000546.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1118)
  AUTHORS   Bohm,S.K., Trumpp,A., Khitin,L.M., Kong,W., Payan,D.G. and
            Bunnett,N.W.
  TITLE     The human purinergic receptor P2Y5 is encoded in intron 17 of the
            retinoblastoma gene
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1118)
  AUTHORS   Bohm,S.K.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-APR-1997) Dept. of Surgery, University of California,
            San Francisco, 521 Parnassus Ave., San Francisco, CA 94143-0660,
            USA
FEATURES             Location/Qualifiers
     source          1..1118
                     /db_xref="H-InvDB:HIT000061582"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="13"
                     /map="13q14"
                     /cell_type="white blood cell"
     CDS             45..1079
                     /note="G-protein coupled receptor"
                     /codon_start=1
                     /product="purinergic receptor P2Y5"
                     /protein_id="AAB62190.1"
                     /db_xref="GI:2232069"
                     /translation="MVSVNSSHCFYNDSFKYTLYGCMFSMVFVLGLVSNCVAIYIFIC
                     VLKVRNETTTYMINLAMSDLLFVFTLPFRIFYFTTRNWPFGDLLCKISVMLFYTNMYG
                     SILFLTCISVDRFLAIVYPFKSKTLRTKRNAKIVCTGVWLTVIGGSAPAVFVQSTHSQ
                     GNNASEACFENFPEATWKTYLSRIVIFIEIVGFFIPLILNVTCSSMVLKTLTKPVTLS
                     RSKINKTKVLKMIFVHLIIFCFCFVPYNINLILYSLVRTQTFVNCSVVAAVRTMYPIT
                     LCIAVSNCCFDPIVYYFTSDTIQNSIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLK
                     SKIFDNESAA"
BASE COUNT          333 a          208 c          198 g          379 t
ORIGIN      
        1 ctgatgaaag tgcttccaaa ctgaaaattg gacgtgcctt tacgatggta agcgttaaca
       61 gctcccactg cttctataat gactccttta agtacacttt gtatgggtgc atgttcagca
      121 tggtgtttgt gcttgggtta gtatccaatt gtgttgccat atacattttc atctgcgtcc
      181 tcaaagtccg aaatgaaact acaacttaca tgattaactt ggcaatgtca gacttgcttt
      241 ttgtttttac tttacccttc aggatttttt acttcacaac acggaattgg ccatttggag
      301 atttactttg taagatttct gtgatgctgt tttataccaa catgtacgga agcattctgt
      361 tcttaacctg tattagtgta gatcgatttc tggcaattgt ctacccattt aagtcaaaga
      421 ctctaagaac caaaagaaat gcaaagattg tttgcactgg cgtgtggtta actgtgatcg
      481 gaggaagtgc acccgccgtt tttgttcagt ctacccactc tcagggtaac aatgcctcag
      541 aagcctgctt tgaaaatttt ccagaagcca catggaaaac atatctctca aggattgtaa
      601 ttttcatcga aatagtggga ttttttattc ctctaatttt aaatgtaact tgttctagta
      661 tggtgctaaa aactttaacc aaaccagtta cattaagtag aagcaaaata aacaaaacta
      721 aggttttaaa aatgattttt gtacatttga tcatattctg tttctgtttt gttccttaca
      781 atatcaatct tattttatat tctcttgtga gaacacaaac atttgttaat tgctcagtag
      841 tggcagcagt aaggacaatg tacccaatca ctctctgtat tgctgtttcc aactgttgtt
      901 ttgaccctat agtttactac tttacatcgg acacaattca gaattcaata aaaatgaaaa
      961 actggtctgt caggagaagt gacttcagat tctctgaagt tcatggtgca gagaatttta
     1021 ttcagcataa cctacagacc ttaaaaagta agatatttga caatgaatct gctgcctgaa
     1081 ataaaaccat taggactcac tgggacagaa ctttcaag
//