LOCUS       AE007869             2841580 bp    DNA     circular BCT 30-JAN-2014
DEFINITION  Agrobacterium tumefaciens str. C58 circular chromosome, complete
            sequence.
ACCESSION   AE007869 AE007943-AE008196 AE008688 AE008975-AE009230
VERSION     AE007869.2
DBLINK      BioProject: PRJNA283
            BioSample: SAMN02603108
KEYWORDS    .
SOURCE      Agrobacterium fabrum str. C58
  ORGANISM  Agrobacterium fabrum str. C58
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
            Rhizobiaceae; Rhizobium/Agrobacterium group; Agrobacterium;
            Agrobacterium tumefaciens complex.
REFERENCE   1  (bases 1 to 2841580)
  AUTHORS   Wood,D.W., Setubal,J.C., Kaul,R., Monks,D.E., Kitajima,J.P.,
            Okura,V.K., Zhou,Y., Chen,L., Wood,G.E., Almeida,N.F. Jr., Woo,L.,
            Chen,Y., Paulsen,I.T., Eisen,J.A., Karp,P.D., Bovee,D. Sr.,
            Chapman,P., Clendenning,J., Deatherage,G., Gillet,W., Grant,C.,
            Kutyavin,T., Levy,R., Li,M.J., McClelland,E., Palmieri,A.,
            Raymond,C., Rouse,G., Saenphimmachak,C., Wu,Z., Romero,P.,
            Gordon,D., Zhang,S., Yoo,H., Tao,Y., Biddle,P., Jung,M.,
            Krespan,W., Perry,M., Gordon-Kamm,B., Liao,L., Kim,S., Hendrick,C.,
            Zhao,Z.Y., Dolan,M., Chumley,F., Tingey,S.V., Tomb,J.F.,
            Gordon,M.P., Olson,M.V. and Nester,E.W.
  TITLE     The genome of the natural genetic engineer Agrobacterium
            tumefaciens C58
  JOURNAL   Science 294 (5550), 2317-2323 (2001)
   PUBMED   11743193
REFERENCE   2  (bases 1 to 2841580)
  AUTHORS   Goodner,B., Hinkle,G., Gattung,S., Miller,N., Blanchard,M.,
            Qurollo,B., Goldman,B.S., Cao,Y., Askenazi,M., Halling,C.,
            Mullin,L., Houmiel,K., Gordon,J., Vaudin,M., Iartchouk,O., Epp,A.,
            Liu,F., Wollam,C., Allinger,M., Doughty,D., Scott,C., Lappas,C.,
            Markelz,B., Flanagan,C., Crowell,C., Gurson,J., Lomo,C., Sear,C.,
            Strub,G., Cielo,C. and Slater,S.
  TITLE     Genome sequence of the plant pathogen and biotechnology agent
            Agrobacterium tumefaciens C58
  JOURNAL   Science 294 (5550), 2323-2328 (2001)
   PUBMED   11743194
REFERENCE   3  (bases 1 to 2841580)
  AUTHORS   Hinkle,G., Slater,S.C. and Goodner,B.
  TITLE     Complete Genome Sequence of Agrobacterium tumefaciens C58
            (Rhizobium radiobacter C58), the Causative Agent of Crown Gall
            Disease in Plants
  JOURNAL   Unpublished
REFERENCE   4  (bases 1 to 2841580)
  AUTHORS   Hinkle,G., Slater,S.C. and Goodner,B.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-AUG-2001) Cereon Genomics, 45 Sidney Street,
            Cambridge, MA 02139, USA
REFERENCE   5  (bases 1 to 2841580)
  AUTHORS   Slater,S.C., Setubal,J.C., Zhao,Y., Goodner,B., Houmiel,K., Sun,J.,
            Kaul,R., Goldman,B., Chen,Q., Huang,W.Mun., Casjens,S., Farrand,S.,
            Burr,T., Nester,E., Kadoi,R., Ostheimer,T., Pride,N., Sabo,A.,
            Henry,E., Telepak,E. and Wood,D.
  CONSRTM   agrobacterium.org
  TITLE     Direct Submission
  JOURNAL   Submitted (30-OCT-2007) Virginia Bioinformatics institute, Virginia
            Polytechnic Institute and State University, Washington Street Box
            0477, Blacksburg, VA 24060, USA
  REMARK    Sequence update by submitter
COMMENT     On or before Nov 5, 2007 this sequence version replaced AE008688.1,
            AE007869.1.
FEATURES             Location/Qualifiers
     source          1..2841580
                     /organism="Agrobacterium fabrum str. C58"
                     /mol_type="genomic DNA"
                     /strain="C58"
                     /culture_collection="ATCC:33970"
                     /db_xref="taxon:176299"
                     /chromosome="circular"
     gene            203..1024
                     /locus_tag="Atu0001"
                     /old_locus_tag="AGR_C_5142"
     CDS             203..1024
                     /locus_tag="Atu0001"
                     /old_locus_tag="AGR_C_5142"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85826.1"
                     /translation="MENKKSFFHLHLISDSTGETLMSAGRAVSAQFHTSMPVEHVYPM
                     IRNQKQLAQVIDLIDKEPGIVLYTIVDQQLAEFLDLRCHAIGVPCVNVLEPIIGIFQT
                     YLGAPSRRRVGAQHALNADYFARIEALNFAMDHDDGQMPETYDDADVVIIGISRTSKT
                     PTSIYLANRGIKTANIPVVPNVPLPESLYAATRPLIVGLVATSDRISQVRENRDLGTT
                     GGFDGGRYTDRATIMEELKYARALCARNNWPLIDVTRRSIEETAAAILALRPRTR"
     gene            1056..1655
                     /gene="maf"
                     /locus_tag="Atu0002"
                     /old_locus_tag="AGR_C_2"
     CDS             1056..1655
                     /gene="maf"
                     /locus_tag="Atu0002"
                     /old_locus_tag="AGR_C_2"
                     /codon_start=1
                     /transl_table=11
                     /product="putative inhibitor of septum formation"
                     /protein_id="AAK85827.2"
                     /translation="MKQELILASSSASRQMLMRNAGLTFSAIPADIDERALDEQLERD
                     GASPEEVALELARAKALAVSALHPEALVLGCDQTMALGTRVYHKPKNMAEAATHLLSL
                     SGKVHRLNSAAVLVHNGKVVWQTVSSAELAVRTLSAEFVSRHLQRVGEKALSSVGAYQ
                     LEREGIQLFTSIEGDYFTILGLPLLPLLSKLRDMDVIDG"
     gene            1648..2508
                     /gene="aroE"
                     /locus_tag="Atu0003"
                     /old_locus_tag="AGR_C_3"
     CDS             1648..2508
                     /gene="aroE"
                     /locus_tag="Atu0003"
                     /old_locus_tag="AGR_C_3"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate 5-dehydrogenase"
                     /protein_id="AAK85828.2"
                     /translation="MADSRETLTINAFVVGYPIKHSRSPIIHSYWLKKFGIAGSYTAV
                     EVSPDDFPKFIATLKEGKPGAAVGGNATIPHKEAAYRLADHPDALAEELGAANTIWME
                     EGKLHATNTDGYGFVSNLDERHPGWDKTQRAVVFGAGGASRAVIQSLRDRDVAEIHVV
                     NRTVERARELADRFGPRVFSHPQAALQEVMHGAGLFVNTTSLGMNGTEAPHLDFSHLA
                     ANAVVTDIVYVPLKTPILNMAQEQGIATVDGLGMLLHQAKPGFRRWFGRIPEVDETLR
                     SLIIADMEKH"
     gene            2508..3089
                     /gene="coaE"
                     /locus_tag="Atu0004"
                     /old_locus_tag="AGR_C_5"
     CDS             2508..3089
                     /gene="coaE"
                     /locus_tag="Atu0004"
                     /old_locus_tag="AGR_C_5"
                     /codon_start=1
                     /transl_table=11
                     /product="dephospho-CoA kinase"
                     /protein_id="AAK85829.2"
                     /translation="MIVIGLTGSIGMGKTTTAKLFAEEGVPVLDSDEVVHGLYRAEAV
                     PLIDAAFPGTTISGMVDRQKLGDVLRKNPANFNRLEEIVHPLVRNRQEAFLAKARIDD
                     RAFALLDIPLLFETGAEGRVDKVVVVSCAPEIQRERVLSRPGMTEEKFEMILARQMPD
                     AEKRQRADFVVDSGNGVEAARDQVKEILQKLGA"
     gene            3110..3808
                     /gene="dnaQ"
                     /locus_tag="Atu0005"
                     /old_locus_tag="AGR_C_7"
     CDS             3110..3808
                     /gene="dnaQ"
                     /locus_tag="Atu0005"
                     /old_locus_tag="AGR_C_7"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III, epsilon chain"
                     /protein_id="AAK85830.1"
                     /translation="MREIIFDTETTGLESKLDRVIEIGGIELINHFPTGRTLHLYISP
                     EDRKVHPDALAVHGITDEFLKDKPKFAEVIDQIREFFDGARWVAHNATFDMGFINAEF
                     ARLGIEPVSAELVTDTLSLARRKNPMGPNSLDALCRRYGIDNSHRTKHGALLDSELLA
                     EVYIEMIGGRQTALGFGSAARQETIIIEEDVPLAPLQRPSALPSRLDADTIAAHGKLV
                     LGMGDKAIWNRYQN"
     gene            complement(3907..4389)
                     /gene="secB"
                     /locus_tag="Atu0006"
                     /old_locus_tag="AGR_C_9"
     CDS             complement(3907..4389)
                     /gene="secB"
                     /locus_tag="Atu0006"
                     /old_locus_tag="AGR_C_9"
                     /codon_start=1
                     /transl_table=11
                     /product="protein-export protein SECB"
                     /protein_id="AAK85831.1"
                     /translation="MTAENGAQGAVSPSLNILAQYIKDLSFENPGAPRSLQGRENAPA
                     ININVNVNANPISGSDFDVVLTLNAEAKDGDKILFAAELVYGGVFRIAGFPQEHMLPV
                     LFIECPRLLFPFARQIIADVTRNGGFPPLMIDPIDFSQMFAQRVAEEQAKAQVQAVPN
                     "
     gene            complement(4493..5029)
                     /gene="fxsA"
                     /locus_tag="Atu0007"
                     /old_locus_tag="AGR_C_11"
     CDS             complement(4493..5029)
                     /gene="fxsA"
                     /locus_tag="Atu0007"
                     /old_locus_tag="AGR_C_11"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85832.1"
                     /translation="MRFSFLPIVILMMPILEIAGFIIVGKAIGLWLTLALILFTSFLG
                     LLILRLGGVGMVRNLQAAGRTGAQPADELVNGAMRVVAGILLIIPGFITDILGLLLLS
                     PAIRRFFWKAFGPRVVVSGSFRQSGPQQGDYSGFRNGPGPAGNSKVVDLDEEEFHREG
                     SKDSPWSNRPDDRDLPKP"
     gene            5215..5868
                     /locus_tag="Atu0008"
                     /old_locus_tag="AGR_C_12"
     CDS             5215..5868
                     /locus_tag="Atu0008"
                     /old_locus_tag="AGR_C_12"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85833.2"
                     /translation="MLIFFQLRSVLGRRTGNEKPPFDPYSPRDVAKGPVADDNKVVTL
                     PKRGEAEEDNRFAEADALAPADTPLNASLRDVMTKDPSFRPKEFLNGARMAYEMIVMG
                     FADGDRKTLKNLLSKEVFDGFEAAISERESRGEVVKSTFVGIEKADITQAGVRDSEVQ
                     VTLRIVSQLISATYDKDGKLVDGDPEAVAEVDDIWTFSRDIRSRDPNWKLIATESEQ"
     gene            5865..6977
                     /gene="mltA"
                     /locus_tag="Atu0009"
                     /old_locus_tag="AGR_C_15"
     CDS             5865..6977
                     /gene="mltA"
                     /locus_tag="Atu0009"
                     /old_locus_tag="AGR_C_15"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-bound lytic murein transglycosylase"
                     /protein_id="AAK85834.1"
                     /translation="MNTPFSIDEVSFRDLPGWGQDDPRKLFPAMATILSHLRNAKPYR
                     TGALGITAAELVSLLELAERGQVNSPEQARQFFETNSVPFRISPAQGKSGFVTAFYEP
                     ELEVSATPDDVWRYPIYRRPPELVDIDNDNRPDGFDPSYAFGKADEEGISYFPDRRAI
                     DEGCLRGRGLEIAWARSKVDLFFVHVQGAARLVFPDGAIKRITYAAKAGHVFSPIGRL
                     LLDRGELDPKTISMQTIRQWLADHPDEVDGVLWHNRSYIFFREADVAGLDMGPIAAAK
                     VPLVAGRALAVDRLIHTFGLPFFIHAPTLTHLDDGKPFARLMLALDTGSAIVGPARGD
                     IFTGSGFEAGELAGTVRNEADFYILLPRIAAERYRR"
     gene            6974..7543
                     /locus_tag="Atu0010"
                     /old_locus_tag="AGR_C_17"
     CDS             6974..7543
                     /locus_tag="Atu0010"
                     /old_locus_tag="AGR_C_17"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85835.1"
                     /translation="MKGSRKLGKEERILWGRVAKTTRPISGRLEDLLAFDDVEEHPLE
                     PSVPQTGKSAFPRMIVETAEALPASPDKKPKTHQPMEKPVKRKLTRGRLPLEGRIDLH
                     GMFQSEAHAVLLDFLLRAHERGLRHVLVITGKGRSIGSDGALKRAVPMWFAKPEYRYL
                     ISSYEDASANHGGDGALYVRLSRRRGEKS"
     gene            7540..7905
                     /locus_tag="Atu0011"
                     /old_locus_tag="AGR_C_18"
     CDS             7540..7905
                     /locus_tag="Atu0011"
                     /old_locus_tag="AGR_C_18"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="AAK85836.1"
                     /translation="MTPFAEAVRQLRERKGVTQKEMAAAIGVSPAYLSALEHGKRGKP
                     SFDLLQRIAGYFNIIWDEAEELFFLAGSSDPKVVIDTVGLPPQYTAFANRLARDIRKL
                     PPSVVEELSAVLQKSRSCD"
     gene            8064..10499
                     /gene="gyrB"
                     /locus_tag="Atu0012"
                     /old_locus_tag="AGR_C_19"
     CDS             8064..10499
                     /gene="gyrB"
                     /locus_tag="Atu0012"
                     /old_locus_tag="AGR_C_19"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="AAK85837.2"
                     /translation="MTETSSSEVGANAEYGADSIKVLKGLDAVRKRPGMYIGDTDDGS
                     GLHHMVYEVVDNAIDEALAGHADLVTVTLNADGSVTVTDNGRGIPTDIHSSEGVSAAE
                     VIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSVWLKLRIRRNGKLHEIGFTHGVA
                     DAPLSVIGEYEGRSGTEVTFLASPQTFTMTDYDYGTLEHRLRELAFLNSGVRILLTDK
                     RHSDVKQQELLYDGGLEAFVRYLDRAKKPLVDKPIAIHSEKDGITVEVALWWNDSYHE
                     NVLCFTNNIPQRDGGTHMAGFRAALTRQVTSYADTSGIMKREKVSLQGEDCREGLTAI
                     LSVKVPDPKFSSQTKDKLVSSEVRPVVESLVNEALSTWLEEHPSEAKILIGKVVEAAV
                     AREAARKARELTRRKGALDIASLPGKLADCSERDPAKSELFLVEGDSAGGSAKQGRSR
                     ETQAILPLRGKILNVERARFDKMLSSQEIGTLITALGTSIGKDEFNADKLRYHKIIIM
                     TDADVDGAHIRTLLLTFFFRQMPELIERGHLYIAQPPLYKVTRGKSVQYLKDEKALEE
                     YLISMGIEEASLTLGTGEVRVGADLREVILDALRMRSLIDGLHSRYSRSIVEQAAIAG
                     ALNPELSADAARAQETVAEVARRLDMIAEETERGWSGVVLEDGGLRFERMVRGVKEIS
                     TLDMGLLGSADARHIDQLVARTRDIYATPPVLQRKDGSMELAGPRALLDAIFAAGRKG
                     LSMQRYKGLGEMNAEQLWETTLDANVRSLLQVRVNDATDADGLFARLMGDEVEPRRDF
                     IQENALNVANLDI"
     gene            complement(10604..11206)
                     /locus_tag="Atu0013"
                     /old_locus_tag="AGR_C_21"
     CDS             complement(10604..11206)
                     /locus_tag="Atu0013"
                     /old_locus_tag="AGR_C_21"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H-flavin oxidoreductase"
                     /protein_id="AAK85838.1"
                     /translation="MTNSNNRQSEYPVDPLFLDRWSPRAFDGSPMPKEHLLTILDAAH
                     WAPSASNHQPWRFVYAHKDSEDWPLFVELLMEGNQKWAKNASVLLFVISRDHTISHEG
                     EKKPSATHSFDAGAAWFSLAMQAHLLGYHAHGMGGIFKDRIVEKLDIPDGFKVEAGVA
                     IGTLTDKSILPDDLAEREVPSKRVPLADVAFEGRFTGKAD"
     gene            11335..12177
                     /gene="hpcE"
                     /locus_tag="Atu0014"
                     /old_locus_tag="AGR_C_22"
     CDS             11335..12177
                     /gene="hpcE"
                     /locus_tag="Atu0014"
                     /old_locus_tag="AGR_C_22"
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxyhepta-2,4-diene-1,7-dioate isomerase"
                     /protein_id="AAK85839.1"
                     /translation="MKLMRVGQPGQEKPAILDAEGKVRDLSAHVKDIGGDAISPEGLK
                     KIAAIDLATLPVLSEERIGACVAGTGKFICIGLNFSDHAAETGATVPPEPVIFMKATS
                     AIVGPNDNVTIPRGSEKTDWEVELGVVIGKTAKYVSEADALDYVAGYCVSHDVSERAF
                     QTERAGQWTKGKSCDTFGPIGPWLVTKDEITDPQNLGMWLKVNGQTMQDGSSKTMVYG
                     VAHVVSYLSQFMSLHPGDVISTGTPPGVGMGQKPPRYLKTGDVVELGIEGLGSQKQTF
                     VADI"
     gene            12339..13535
                     /gene="depA"
                     /locus_tag="Atu0015"
                     /old_locus_tag="AGR_C_24"
     CDS             12339..13535
                     /gene="depA"
                     /locus_tag="Atu0015"
                     /old_locus_tag="AGR_C_24"
                     /codon_start=1
                     /transl_table=11
                     /product="intracellular PHB depolymerase"
                     /protein_id="AAK85840.2"
                     /translation="MAPLRAGADMMRQACNNPLNPLSSTAFGRSLDAGFEVFERLTRR
                     YVKPEFDLGSTSVDGQTVVVTDETVWSRPFCSLVHFNRDLEPTRKPDPKVLLVAPMSG
                     HYATLLRGTVEALLPSADIYITDWADARIVPATEGTFDLDDYIDYVIEMLRHIGPGAH
                     VVAVCQPSVPVLAAVSLMEADGDTFAPASMTLMGGPIDTRINPTAVNGLATAKPIEWF
                     RDNVVMQVPWPQPAFGRYVYPGFLQLSGFMSMNLDKHMTAHKDFYLNLVKNDGDSAEK
                     HREFYDEYLAVMDLTAEFYLQTVETVFIDHALPKGNMLHRGRAVDPTAIHNVALFTVE
                     GENDDISGVGQTKAAHDLCRNIPEDKRAHYMQPDVGHYGVFNGSRFRKEIVPRMLDFI
                     GKHQMA"
     gene            13605..14372
                     /locus_tag="Atu0016"
                     /old_locus_tag="AGR_C_25"
     CDS             13605..14372
                     /locus_tag="Atu0016"
                     /old_locus_tag="AGR_C_25"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85841.1"
                     /translation="MFSLLRKSLKSPAPKKVVPSQRTVSVAGRQVPITVRENPRATRI
                     TLRIEPGGRALKLTIPMGLHHRQVDDFLERHQGWLEGKLLKFSPDDGLRPGATIDIRG
                     ISHRIEHTGSLRGLTHIAKDADGVAVLKVSGAPEHLRRRIATFLKKEAKADLERLVAI
                     HGRAAGRPVRSISMKDTRSRWGSCSHDGNLSFSWRIVMAPDRVIDYLAAHEVAHLSEM
                     NHGPKFWALCEKLCPHTSEAKDWLKRHGSKLHAIDFD"
     gene            14475..15137
                     /gene="trpF"
                     /locus_tag="Atu0017"
                     /old_locus_tag="AGR_C_26"
     CDS             14475..15137
                     /gene="trpF"
                     /locus_tag="Atu0017"
                     /old_locus_tag="AGR_C_26"
                     /codon_start=1
                     /transl_table=11
                     /product="N-(5-phosphoribosyl) anthranilate isomerase"
                     /protein_id="AAK85842.1"
                     /translation="MKPDIKICGLKTPETLERVVRRGASHVGFIFFEKSPRYIEPDLA
                     GRLAEAARGAAKVVAVTVDADNDYLDEIVDLVRPDILQLHGSESPERLLHIKALYGLP
                     VMKAISIRDAADLAKIEPYIGIADRFLLDAKAPAGSDLPGGNGVSFDWTILRSLDESV
                     DYMLSGGLNKDNVAEALAETRASGLDLSSGVESAPGVKDLSKIDAFFDVVNDWSKGPK
                     GA"
     gene            15139..16359
                     /gene="trpB"
                     /locus_tag="Atu0018"
                     /old_locus_tag="AGR_C_28"
     CDS             15139..16359
                     /gene="trpB"
                     /locus_tag="Atu0018"
                     /old_locus_tag="AGR_C_28"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase beta subunit"
                     /protein_id="AAK85843.2"
                     /translation="MNDAPTPNSFRAGPDEDGRFGIYGGRFVAETLMPLILDLQAEWD
                     KAKSDPEFQAELKYLGTHYTGRPSPLYFAERLTAELGGAKIYFKREELNHTGSHKINN
                     CLGQILLAKRMGKTRIIAETGAGQHGVASATVAARFGLPCVVYMGATDVARQAPNVFR
                     MKLLGAEVKPVTAGHGTLKDAMNEALRDWVTNVDDTYYLIGTAAGPHPYPEMVRDFQA
                     VIGEEAKAQMLEAEGRLPDMIIAAVGGGSNAIGIFHPFLDDKNVRIVGVEAGGKGLSG
                     EEHCASITAGSPGVLHGNRTYLLQDGDGQIKEGHSISAGLDYPGIGPEHSWLNDIGRV
                     EYVPIMDHEALDAFQMLTRLEGIIPALEPSHALAEVIKRAPKMGKDEIILMNLSGRGD
                     KDVHTVSKFLGMDV"
     gene            16364..17203
                     /gene="trpA"
                     /locus_tag="Atu0019"
                     /old_locus_tag="AGR_C_30"
     CDS             16364..17203
                     /gene="trpA"
                     /locus_tag="Atu0019"
                     /old_locus_tag="AGR_C_30"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase alpha subunit"
                     /protein_id="AAK85844.2"
                     /translation="MTVRMDKRFADLRAENRPALITYFMGGDPDFQTSLGIMKALPEA
                     GADVIELGMPFSDPMADGPAIQLAGQRALKGGQTLKTTLDLAREFRKQDNATPIVMMG
                     YYNPIYIYGVEKFLDDAIASGIDGLIVVDLPPEMDDELCIPALARGINFIRLATPTTD
                     GKRLPAVLKNTSGFVYYVSMNGITGSALPDPSLISGAVGRIKAHTELPVCVGFGVKTA
                     DHAKAIGAVADGVVVGSAIVNQIAGSLTKDGQATADTVPAVTTLVKGLSTGVRASRLA
                     AAE"
     gene            17231..18127
                     /gene="accD"
                     /locus_tag="Atu0020"
                     /old_locus_tag="AGR_C_32"
     CDS             17231..18127
                     /gene="accD"
                     /locus_tag="Atu0020"
                     /old_locus_tag="AGR_C_32"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-coenzyme A carboxyl transferase, beta
                     subunit"
                     /protein_id="AAK85845.1"
                     /translation="MNWITNYVRPRINSMLGRRPEVPENLWIKCPETGEMVFHKDLED
                     NKWVIPASGYHMKMPAKARLADLFDGGIYEALAQPKVAQDPLKFRDSKKYTDRLRDSR
                     AKTEQEDTILAGVGLLKGLKIVAVVHEFQFMAGSLGIAAGEAIVKAFERAISERCPLV
                     MFPASGGARMQEGILSLMQLPRTTVAVNMLKEAGMPYIVVLTNPTTGGVTASYAMLGD
                     VHIAEPGAEICFAGKRVIEQTIREKLPEGFQTSEYLLEHGMVDMVIDRREIPDTLASM
                     LKIMTKAPADNANAVVPLAASA"
     gene            18250..19593
                     /gene="folC"
                     /locus_tag="Atu0021"
                     /old_locus_tag="AGR_C_35"
     CDS             18250..19593
                     /gene="folC"
                     /locus_tag="Atu0021"
                     /old_locus_tag="AGR_C_35"
                     /codon_start=1
                     /transl_table=11
                     /product="folylpolyglutamate synthase"
                     /protein_id="AAK85846.1"
                     /translation="MTKPAIGEAEKIIEELMQLHPKGFDLSLDRISRLLEKLGNPQNR
                     MPPVIHVAGTNGKGSVSAFCRALLEAAGLPVHVHTKPHLVNWHERYRLGVAGERGRFV
                     EDAVFADALRRIEVANDGQKITVFEILTAVMFLLFSEHPADAAIVEVGLGGRFDATNV
                     INSPAVSIIMPISLDHEAYLGDRVELIAAEKAGIMKKGSPVVIGHQEYDAARETLVAT
                     AERLGCLVSVYGQDFSAHEEFGRMVYQDEFGLADAPLPRLPGRHQLANAAAAIRAVKA
                     AGFEVTERMIEKAMTSVEWPGRLQRILTGKIAEIAPKGAEIWIDGGHNPGAGEVIAEA
                     MAGFEEKTPRPLFIIAGMINTKDPVGYFKAFADIAEYVFTVPIGGTDAAIDPVVLAHA
                     AFDAGLVAAPTSTLTHALEELSRRVDPEGPPPRILIGGSLYLAGNALAFNGTVPQ"
     gene            complement(19641..19961)
                     /gene="trxA"
                     /locus_tag="Atu0022"
                     /old_locus_tag="AGR_C_37"
     CDS             complement(19641..19961)
                     /gene="trxA"
                     /locus_tag="Atu0022"
                     /old_locus_tag="AGR_C_37"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="AAK85847.2"
                     /translation="MATVKVDAANFQSEVLESAEPVVVDFWAEWCGPCKMIAPSLEEI
                     SSELAGKVKVAKLNIDENPELAAQFGVRSIPTLAIFKGGEVADIKVGAAPKTALSAWI
                     SSAA"
     gene            complement(20039..23596)
                     /gene="uvrD"
                     /locus_tag="Atu0023"
                     /old_locus_tag="AGR_C_39"
     CDS             complement(20039..23596)
                     /gene="uvrD"
                     /locus_tag="Atu0023"
                     /old_locus_tag="AGR_C_39"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependant DNA helicase"
                     /protein_id="AAK85848.2"
                     /translation="MTIDPFDAGPAADTPESWIDWTSARQRLASDPASSAWVSANAGS
                     GKTHVLTQRVIRLLLAGCRPSAILCLTYTKAAASEMSSRVFDRLAEWATLPDSDLKDR
                     ITTIEGKVPDRIKLAEARRLFAKALETPGGLKIQTIHAFCEALLHQFPLEANVAGHFS
                     VLDDRAATTLLAEARRSLLTAVSTEDDAELVQALAYVLDLADESGLEALLSAIIANRS
                     ALRSFLHEAKQSGGLDVRLRQEMQIAAGETEETAAEAFWPLPGLSGLVLDTYLTLADE
                     VGGSRVIEVAYALREAKRQPDPVRRMELIEAALLTAKGEKKSDAYVINKGMQKSAPDL
                     VDALTLARDHVVACRNRYRLVRMLVATKSALVLAERLIGDFEDLKKQRSQLDFEDLIE
                     RAANLLNRDTAGAWVHYKLDQGIDHILVDEAQDTSPVQWSIIQSLAADFFNGESARMG
                     RRTLFAVGDEKQSIYSFQGARPERFSQERDETKRRVDQVEQAFHRIRLPLSFRSTEDV
                     LAAVDQVFSDPKNASGLSADNEPVEHRSNRAGHPGTVEVWDMVAPETTEDEEDWTAPF
                     DALRESAPATIVARRIAARIADMIGNQTIIEKGVERAVEPGDILVLVRKRAAFVNALT
                     RELKRRKNIPVAGADRLRLTDHIAVQDLLALGRFVVLPEDDLSLAALLKSPLFNLTED
                     DVFEIAATRSEAESVWQRLQVLSGEETSRLSIVTDKLRHFISLSKTATVHDFFAAVLT
                     LHDGRKKFLGRLGNEASDVLDEFLSFALDHERTGLPGLQAFLSVLETDSPEVKREQDK
                     DRGEVRIMTVHASKGLEAPVVFVVDGGSKAFNHSHVPKLRFVEGDGDAFPVWLPGSGF
                     SNHLIRSDEERLKTAAEDEYRRLLYVAMTRAADHLVVCGYRGQKENPECWHAIVKAAL
                     AENQDHCQPQAFSADGEEWQGLVWRKSEARPALAPHKPAEPQQEEDHTLPPGLLAPLP
                     ALPSLPRPLSPSGAGTIIDDGADDLAVRSPLFGEKTEASSLALQRGKLVHRMLQALPD
                     FAESEREEAARRYAERAARFWPATDRERLIQAVLRVLSEPAVQPAFSANSRAEVSIMG
                     TMTLGRQHYAVSGRIDRLAVERDRVILVDYKTNRVPPREARELPFSHVAQLAIYREIL
                     APLYPGKEFVCALIYTESAAFVRVDDDAMAEALAAIKTK"
     gene            complement(23586..26771)
                     /locus_tag="Atu0024"
                     /old_locus_tag="AGR_C_40"
     CDS             complement(23586..26771)
                     /locus_tag="Atu0024"
                     /old_locus_tag="AGR_C_40"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85849.1"
                     /translation="MTLTHHAKRVLTIAAGTPFLKTLAETLCDGRLTAGYRYDPTDPL
                     SLASVTIYVPTRRSARVLRSEFVDLLGGRSAILPLIRPLGETDDDSGFFDIENPEIMD
                     LAPPISGTGRQIELARLILAWRNSLPDAIRAIHSDSPLVAPASPADAIWLARALGEVI
                     DAMDTEEKDWEALQHLDTGEHAQWWQLTADFLKIASVFWPARLAELNRSSAGRHRNAI
                     LRAEADRLANLPDTGPIIVAGSTGSIPAAADLIAAVAALPQGTVVLPGLDLAMPEEQW
                     QAIIEDPTDPSSRTHPQYGLYMLLQKLGMSRDEVVQIGALDRDLEKRAAVFSAALAPA
                     KSTSDWNGWREGRDPGFFDEAFAAATLIEAANQREEATAIAVALRLALEAPGPGRPSQ
                     AALITPDRGLARRVATELQRFGIEADDSAGTPLSATPQAGLTQLALEAILRPGDPVPI
                     ISLLKHPLARFGLSGDAFTKASKALELIALRGGRVETEIGNLEVVLDAQLLAQRDNRH
                     PPAWRVALPEGSVDAARDLARRIAIATEPLGSAFIRRDRSGRAFTDKLPLSDWAGRTG
                     RVIEAICADDSNDLAALWSGEAGDKLSSLFAELMESGDILDADGPQWIDIFAALVAGE
                     SIKPRSMRHPRIFIFGALEARLQSVDTVVIGGLNEGLWPGQTANNPFLSRSMKTAIGL
                     EPPERRIGQLAHDFEMANGTRQIFYTRALRQGSTPAVASRWLQRLLALGGENFAEQLR
                     KRGETYRHWAGLMDESIDQETAKRPAPKPPADLQPKSYSFSEVGRLRRDPYAIYARRI
                     LKLDPLDPFNRDPNAADRGTLYHGIIERYSREGHIPGTPASLEAMQRILDDCFDAENL
                     PVHVDVIWRPRFAAVARAFIDWEKERHPSIRRSFFEARAGQEIAEAGIRLTGVADRID
                     IKTSGQADIIDYKTGLAPSVNQARALLDPQLALEAAALMRGAFRETGSPTPENLIYVR
                     LRPGDRFFADQVNNEHSNRSGKRPPKSAIELATESIDQLAKFVRSLRDGENGFASRLV
                     PEEQQSYGGEYDHLARVSEWSTAEPGDGDDD"
     gene            complement(26768..27505)
                     /locus_tag="Atu0025"
                     /old_locus_tag="AGR_C_42"
     CDS             complement(26768..27505)
                     /locus_tag="Atu0025"
                     /old_locus_tag="AGR_C_42"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85850.2"
                     /translation="MTIKNAMVLAAGLGTRMRPITDTIPKPLVKIAGKPMIDYALDAL
                     VEAGAETIVVNVHHHAEQMISHLGHRTDAEILISDERTQLMNSGGGLAKGLKLLKPGP
                     VFVMNADLFWIGERLNAVSNLRKLAQFLDPARMDMALLCVDMDRTTGHNGKRDFNLAG
                     EGKLTRYRDGDANPVVYAGAIAMDSRLLDDAPADAFNLNIYFDRAIEKDRLFGLSLDG
                     HWITVGTPDAIDDAESIIRQFREKRFA"
     gene            complement(27520..29031)
                     /locus_tag="Atu0026"
                     /old_locus_tag="AGR_C_43"
     CDS             complement(27520..29031)
                     /locus_tag="Atu0026"
                     /old_locus_tag="AGR_C_43"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85851.1"
                     /translation="MSEDILPITISLAGEKDTIRLGEDLALALKPGDCLTLIGDLGAG
                     KSTLARAFIRAMADEPDLEVPSPTFTIIQTYTTRIPVAHLDLYRLSDVSELDELGIDE
                     MLEDGICLIEWPDIAAEVLPPAQTITLQLTHSGEGRVAVIEAPAQQKARLDRVFAIRE
                     FLAKNGRGDATRRFLSGDASTRAYETISTDGPDLILMDWRRPMRGAIVADGKTYAEIV
                     HLAQDARSFVAIGDYLRNSGFRAPEILAADIDQGILLLEDLGREGVLAADGTPIEERY
                     LQSVACLATLHQTPRPALLPMRDGSTYDIPSFDRQAMKIEVSLLVEWYLPHKRGKALT
                     DGEKQDYYAIWDGLIDALAGCETGLLLRDFHSPNILWQAQNSGIGQVGLIDFQDAMIG
                     PTAYDLASIVQDARVTIPPELQTRLMSHYLNSRKATPAFDEAAFLKAFAIMSAQRNCK
                     LAGIWVRLLERDKKPGYMKHMPRTFRYLADALSHPELAPLREWCVRMGMDFND"
     gene            complement(29028..31673)
                     /locus_tag="Atu0027"
                     /old_locus_tag="AGR_C_44"
     CDS             complement(29028..31673)
                     /locus_tag="Atu0027"
                     /old_locus_tag="AGR_C_44"
                     /codon_start=1
                     /transl_table=11
                     /product="two component sensor kinase"
                     /protein_id="AAK85852.1"
                     /translation="MTVHNSDLREQTVQRVENTHASVASSTRALERFCVFPDGKPAPT
                     FSGNALARCRLAIRAIRTGFSRARILLSGTVLTGSSTVAMAQDGLVAKTSARLFSSGE
                     TITYSLFVGMLSATLFSVVWLVRQRGNIEAESSEYRQALAQSHHKIAKYEALISDKSR
                     RIVIWDGVDKRPEFLGQLPAETGVPQADQDFLAFGRWLKPASAGQLEKSIEKLRSHAQ
                     SFDLTIETQRGEVIEVQGRVSGGNAFARFIALNNLRAELAELQVERERLLASVSTFQE
                     LLDSIEQPVWRRNGEGELTWVNHAYAHAVDARNAEQAVQEKRELLNTVTRQKIRAAAT
                     PESPYHDRISTVVSGNRSFFDVVDIKTAGGSAGIAIDATEAETIREELKRVLKSHAET
                     LDHLATPVAIFDGRQRLQFYNQAFASLWGFDLVLLESGPDNSELLDRLRSAGKLPEQL
                     NWKNWKETALSVYRSLDTKTDLWHLPNGQTLRVIATAHPQGGATWVFENLTEQVDLQM
                     RYNTLVKVQGETIDHLAEGVAVFGADGRIRLSNPAFRALWGVTADEAETGTHIRAIET
                     ACAQSYDGPDGWRAFSQFITSFDDERPSRQGTLELLSGLVLDYAIIPLPDAQTMLTFV
                     NMTDSVRAERALKEKNDALLKADELKNDFVQHVSYELRSPLTNIIGFTDLLKTPGIGQ
                     LTERQAEYLDHISTSSSVLLTIVNDILDLATVDAGIMQLNYSDNDLNELLDDVSVQIA
                     DRLQESGISLEIVAPAHLGSLVADHQRLKQILIKLLTNAINFAPEGSSVQLSCQRSEG
                     DFVFSVADKGPGIPEDMLKSVFDRFATRGNGGRRTGAGLGLSIVESFVSLHHGTVSID
                     SRPGNGTIVTCRIPSATLPHSIAAE"
     gene            complement(31670..31837)
                     /locus_tag="Atu0028"
     CDS             complement(31670..31837)
                     /locus_tag="Atu0028"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAL41059.2"
                     /translation="MRLTKRAASFLRAPFPQIYEDGIVIGLDSDTPKGGVDEMGCLVE
                     DAAHRTETDRG"
     gene            complement(31882..33282)
                     /gene="ahcY"
                     /locus_tag="Atu0029"
                     /old_locus_tag="AGR_C_46"
     CDS             complement(31882..33282)
                     /gene="ahcY"
                     /locus_tag="Atu0029"
                     /old_locus_tag="AGR_C_46"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylhomocysteine hydrolase"
                     /protein_id="AAK85853.1"
                     /translation="MSLEKDYIVADINLAAFGRKELDIAETEMPGLMSCRKEFGESKP
                     LKGARITGSLHMTIQTGVLIETLKELGAEIRWASCNIFSTQDHAAAAIAAAGIPVFAV
                     KGESLTEYWEYTDKIFQWTDGGLSNMILDDGGDATMYILLGARAEAGEDVLSNPGSEE
                     EEILFAQINKRLKASPGWFTKQRDALKGVTEETTTGVHRLYDLAKKGLLPFPAINVND
                     SVTKSKFDNKYGCKESLVDGIRRATDVMMAGKVAVVCGYGDVGKGSAASLQGAGARVK
                     VTEIDPICALQAAMDGFEVVRLEDVVSSADIFITTTGNKDVIRIEHMREMKDMAIVGN
                     IGHFDNEIQVASLRNLKWTNIKPQVDMIEFPKGNRIILLSEGRLLNLGNATGHPSFVM
                     SASFTNQVLGQIELFTKPGEYKNEVYVLPKHLDEKVARLHLEKLGVRLTELSDLQADY
                     IGISKQGPFKAEHYRY"
     gene            complement(33411..33686)
                     /gene="ptsH"
                     /locus_tag="Atu0030"
                     /old_locus_tag="AGR_C_49"
     CDS             complement(33411..33686)
                     /gene="ptsH"
                     /locus_tag="Atu0030"
                     /old_locus_tag="AGR_C_49"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphocarrier protein HPr"
                     /protein_id="AAK85854.1"
                     /translation="MSPLSRELPIINKRGLHARASAKFVQMVEGFDATITVSKDGMTV
                     GGTSIMGLMMLAASPGCSVYVEASGNQAVEALAALEALVANRFGEEA"
     gene            complement(33698..34099)
                     /locus_tag="Atu0031"
                     /old_locus_tag="AGR_C_50"
     CDS             complement(33698..34099)
                     /locus_tag="Atu0031"
                     /old_locus_tag="AGR_C_50"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, IIA component"
                     /protein_id="AAK85855.1"
                     /translation="MIGLVLVTHGKLAEEFRHALEHVVGPQKLIETVCIGPEDDMDQR
                     RQDIIDAVARANDGNGVIILTDMFGGTPSNLAISVMNNGNVEVIAGVNLPMLIKLAGV
                     RSEDNMDKALQDASDAGRKYINVASRVLSGK"
     gene            complement(34225..34689)
                     /locus_tag="Atu0032"
                     /old_locus_tag="AGR_C_51"
     CDS             complement(34225..34689)
                     /locus_tag="Atu0032"
                     /old_locus_tag="AGR_C_51"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85856.1"
                     /translation="MNAERFNLHATAIVVDGTGILFTGPSGSGKSELAFSFLTEAERC
                     GLPAALIADDQIFVYRDGETIIAERPEAIAGLLELRGSGIVSVKSVPSGVLHFAVTTV
                     LSPENPRLPEDDEALLMPCGGHLRLLRIPLSSLVPYGKFAALAQNLFKTNVK"
     gene            complement(34679..36469)
                     /gene="chvG"
                     /locus_tag="Atu0033"
                     /old_locus_tag="AGR_C_52"
     CDS             complement(34679..36469)
                     /gene="chvG"
                     /locus_tag="Atu0033"
                     /old_locus_tag="AGR_C_52"
                     /codon_start=1
                     /transl_table=11
                     /product="two component sensor kinase"
                     /protein_id="AAK85857.1"
                     /translation="MLKKTPETVSDSDDAEERGSERRHRIHPLTIIRRIFGNAVFSSL
                     TRRILFFNVAATVVLVGGILYLNQFREGLIDARVESLLTQGEIIAGAVSASASVDTNS
                     ITINPEKLLELQAGQSITPAPNDEDLSFPINPERVAPVLRRLISPTRTRARLFDADAN
                     LLLDSRHLYSRGQVLRFDLPPVTPETQTWGDWFTSMFNRMLQPSSLPQYKEAPGGDGS
                     IYPEVMNALTGVRGAVVRVTEKGELIVSVAVPVQRFRAVLGVLLLSTQAGDIDKIVHA
                     ERLAIMRVFGIATLVNIVLSLLLSSTIATPLRRLSAAAIRVRRGARTREEIPDFSARQ
                     DEIGNLSIALREMTTALYDRIDAIESFAADVSHELKNPLTSLRSAVETLPRAKTEESK
                     QRLTEIIFHDVRRLDRLISDISDASRLDAELARADASPLDLDVLMKGLVDISRQISTK
                     KKSVAIDYVADRKAGAKTSFVVNGHDLRIGQIVTNLIENARSFVSEESGRITVRLSRH
                     KDRCIVQVEDNGPGIQAEDIDRIFERFYTDRPASEGFGQNSGLGLSISRQIAEAHGGS
                     LRAENVVDKYGVISGARFTLSLPAAETHER"
     gene            complement(36525..37250)
                     /gene="chvI"
                     /locus_tag="Atu0034"
                     /old_locus_tag="AGR_C_54"
     CDS             complement(36525..37250)
                     /gene="chvI"
                     /locus_tag="Atu0034"
                     /old_locus_tag="AGR_C_54"
                     /codon_start=1
                     /transl_table=11
                     /product="two component response regulator"
                     /protein_id="AAK85858.2"
                     /translation="MQTIALVDDDRNILTSVSIALEAEGYRVETYTDGASALDGLIAR
                     PPQLAIFDIKMPRMDGMELLRRLRQKSDIPVIFLTSKDEEIDELFGLKMGADDFITKP
                     FSQRLLVERVKAILRRASSREASAATGGTLKPTADQQARTLERGQLAMDQERHTCTWK
                     GEPVTLTVTEFLILHSLAQRPGVVKSRDALMDAAYDEQVYVDDRTIDSHIKRLRKKFK
                     LVDGDFDMIETLYGVGYRFREAA"
     gene            37589..39199
                     /gene="pckA"
                     /locus_tag="Atu0035"
                     /old_locus_tag="AGR_C_56"
     CDS             37589..39199
                     /gene="pckA"
                     /locus_tag="Atu0035"
                     /old_locus_tag="AGR_C_56"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate carboxykinase"
                     /protein_id="AAK85859.2"
                     /translation="MNELGVHNPANGVAELGLGEASRVFYNLNESELYEHAIRNGEAE
                     LTIDGALRAVTGQHTGRSPKDKFVVRDASTENTIWWDNNKPLSPENFELLRQDMLAHA
                     AGKTLYVQDLIGGADEENALPTRVVTELAWHSLFIRNLLIRPKRETLSGFSQKLTIIN
                     LPSFKADPARHGVRSETVIACDLTNGLVLIGGTSYAGENKKSVFTVLNYLLPAKGVMP
                     MHCSANVGPEGDSAVFFGLSGTGKTTLSADPARTLIGDDEHGWGEHGIFNFEGGCYAK
                     AIKLSSEAEPEIYAATNRFGTVLENVVLDESRVPDFNDNSLTENTRSAYPLHFIPNAS
                     ETGIAGHPKTIIMLTADAFGVLPPIARLTPEQAMYHFLSGYTAKVAGTEKGVTEPEAT
                     FSTCFGAPFMPRHPAEYGNLLRELIGKHGVDCWLVNTGWTGGAYGIGKRMPIKATRAL
                     LTAALTGDLKNAQFRTDANFGFAVPLSLDGVDGAILDPRSTWADGAAYDAQAKKLVSM
                     FVSNFTKFEDHVDSKVRDAAPGLLLAAE"
     gene            39327..39761
                     /locus_tag="Atu0036"
                     /old_locus_tag="AGR_C_57"
     CDS             39327..39761
                     /locus_tag="Atu0036"
                     /old_locus_tag="AGR_C_57"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85860.2"
                     /translation="MASDPLYISNRITIAGWELTEQFVLAGGPGGQNVNKVSTAVQLF
                     FDIANSPSLSDRVKANAVRLGGRRVSKEGVLMIEASRFRSQERNREDARERLKELILE
                     AAAPPPPVRKATKPTKGSVERRLKAKSGRSDIKKMRGKPSGD"
     gene            complement(39781..40749)
                     /gene="panK"
                     /locus_tag="Atu0037"
                     /old_locus_tag="AGR_C_59"
     CDS             complement(39781..40749)
                     /gene="panK"
                     /locus_tag="Atu0037"
                     /old_locus_tag="AGR_C_59"
                     /codon_start=1
                     /transl_table=11
                     /product="pantothenate kinase"
                     /protein_id="AAK85861.2"
                     /translation="MPGTLDHFRADEYSPYHFFSSEEWAKFRADTPLTLSADEVKRLR
                     SLDDPIDLDEVRRIYLSLSRLLSSHVEASQLLFEQRNRFLNMGDVNKTPFVIGIAGSV
                     AVGKSTTARILKELLARWPSSPKVDLITTDGFLYPNEVLRRENLMERKGFPESYDIGA
                     LLRFLSAIKAGQPNVKAPRYSHLTYDVLPNEFTVIDQPDILIFEGINVLQSRDLPAGG
                     RIVPIVSDFFDFSIYIDADEDFIHNWYVNRFMNLRQTAFRDPNSFFNRYASISEEAAL
                     SIAEGLWQNINLKNLRQNIVPTRPRADLILRKGENHLIDTVALRKL"
     gene            complement(40779..41102)
                     /gene="hisE"
                     /locus_tag="Atu0038"
                     /old_locus_tag="AGR_C_60"
     CDS             complement(40779..41102)
                     /gene="hisE"
                     /locus_tag="Atu0038"
                     /old_locus_tag="AGR_C_60"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyl-ATP pyrophosphohydrolase"
                     /protein_id="AAK85862.2"
                     /translation="MSAFSLSDLERIVAKRAAASPDESWTAKLVAAGQERAAKKLGEE
                     AVEAVIAAIAQDRDGLKNEAADLLYHLLVVLKIADIPLSDVFAELERRTGQTGLAEKA
                     ARPTP"
     gene            complement(41118..41894)
                     /gene="hisF"
                     /locus_tag="Atu0039"
                     /old_locus_tag="AGR_C_62"
     CDS             complement(41118..41894)
                     /gene="hisF"
                     /locus_tag="Atu0039"
                     /old_locus_tag="AGR_C_62"
                     /codon_start=1
                     /transl_table=11
                     /product="imidazoleglycerol-phosphate synthase cyclase"
                     /protein_id="AAK85863.1"
                     /translation="MTLKARIIPCLDVKDGRVVKGVNFVDLIDAGDPVEAAKAYDAAG
                     ADELCFLDITASSDNRDTIFDVVSRTADHCFMPVTVGGGVRSVADIRKLLLCGADKVS
                     INSAAVKDPDFVAQAADKFGNQCIVVSIDAKRVSKDGEADRWEIFTHGGRQPTGIDAV
                     EFAIKMVERGAGELLVTSMDRDGTKSGYDIGLTRSIADQVRVPVIASGGVGTLDDLVA
                     GVRDGHATAVLAASIFHFGTYSIGEAKSYMAEHGIAMRLD"
     gene            complement(41891..42634)
                     /gene="hisA"
                     /locus_tag="Atu0040"
                     /old_locus_tag="AGR_C_63"
     CDS             complement(41891..42634)
                     /gene="hisA"
                     /locus_tag="Atu0040"
                     /old_locus_tag="AGR_C_63"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformino-5-aminoimidazole
                     carboxamide ribotide isomerase"
                     /protein_id="AAK85864.1"
                     /translation="MILFPAIDLKDGECVRLKLGDMEQATVYNEDPGAQAKAFEDQGF
                     EWLHVVDLNGAFAGETVNGAAVDAILKSTKNPVQLGGGIRTLDHIEAWLSRGLARVIL
                     GTVAVRDPVLVIEACKRFPGQVAVGIDAKGGKVAVEGWAEASELGIIELAKRFEGAGV
                     AAIIYTDIDRDGILAGINWASTLELADAVSIPVIASGGLASIDDIKRMLQPDAAKLEG
                     AISGRALYDGRIDPTEALDLIKAAKEVRA"
     gene            complement(42636..43286)
                     /gene="hisH"
                     /locus_tag="Atu0041"
                     /old_locus_tag="AGR_C_64"
     CDS             complement(42636..43286)
                     /gene="hisH"
                     /locus_tag="Atu0041"
                     /old_locus_tag="AGR_C_64"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase"
                     /protein_id="AAK85865.2"
                     /translation="MRVAIIDYGSGNLRSATKAFERAAREAGIDATIDLTDKPDHVAS
                     ADRIVLPGVGAYADCSAGLNAMPGMHEALIEAVEKKAHPFLGICVGMQLMSSRGLEKT
                     VSTGLGWIEGDVVEMTPSDPTLKIPQIGWNTLEIRHAHPLFDGIKTGADGLHAYFVHS
                     YHLAAKHSTDVIATTNYGGAMTAFVGRDNMAGAQFHPEKSQTLGLALISNFLRWKP"
     gene            complement(43288..43782)
                     /locus_tag="Atu8115"
                     /old_locus_tag="AGR_C_67"
     CDS             complement(43288..43782)
                     /locus_tag="Atu8115"
                     /old_locus_tag="AGR_C_67"
                     /codon_start=1
                     /transl_table=11
                     /product="Hypothetical Protein"
                     /protein_id="AAK85866.1"
                     /translation="MTSYLVLEAPNGPDRDHKTTRFIADRFVWLALIAPWLWLAVNRL
                     WLTTAVVVIATLVAGQISMLAGFEPVGILLGFAIGLITALEGRDFLVRHLIRKGWTLT
                     SVISAPDLSSAEDIYFSSLSENADKAEQLSRPVWTTSAQKSGGKNFVDDPAGSFLFDL
                     NGRR"
     gene            complement(43805..44401)
                     /gene="hisB"
                     /locus_tag="Atu0043"
                     /old_locus_tag="AGR_C_69"
     CDS             complement(43805..44401)
                     /gene="hisB"
                     /locus_tag="Atu0043"
                     /old_locus_tag="AGR_C_69"
                     /codon_start=1
                     /transl_table=11
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /protein_id="AAK85867.2"
                     /translation="MAERKGEIIRKTNETSVSVRVDIDGTGKSKISTGVGFFDHMLDQ
                     LSRHSLIDMDIEVQGDLHIDDHHTVEDTGIAIGQAIAKALGDRRGITRYASLDLAMDE
                     TMTKAAVDISGRPFLVWNVNFSAPKIGTFDTELVREFFQALAQNAGITLHILNHYGAN
                     NHHIAETCFKAVARVLRTATEIDPRQAGRVPSTKGMLA"
     gene            44644..45126
                     /gene="hslV"
                     /locus_tag="Atu0044"
                     /old_locus_tag="AGR_C_70"
     CDS             44644..45126
                     /gene="hslV"
                     /locus_tag="Atu0044"
                     /old_locus_tag="AGR_C_70"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein hslV"
                     /protein_id="AAK85868.2"
                     /translation="MAGDGQVSLGQTVMKGNARKVRRIGKGEVIAGFAGATADAFTLL
                     DRLEKKLEQYPGQLMRAAVELAKDWRTDKYLRNLEAMMLVADKSTTLAITGNGDVLEP
                     EHGAIAIGSGGNYAFAAARAMMDTDKSAEEVARQSLDIAADICVYTNHNLVVETLDAE
                     "
     gene            45214..46521
                     /gene="hslU"
                     /locus_tag="Atu0045"
                     /old_locus_tag="AGR_C_72"
     CDS             45214..46521
                     /gene="hslU"
                     /locus_tag="Atu0045"
                     /old_locus_tag="AGR_C_72"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock chaperone"
                     /protein_id="AAK85869.1"
                     /translation="MTTFSPREIVSELDRHIIGQHDAKRAVAIALRNRWRRQQLDESL
                     RDEVMPKNILMIGPTGVGKTEISRRLAKLAGAPFIKVEATKFTEVGYVGRDVEQIIRD
                     LVEIGIGLVREKKRAEVQAKAHQSAEERVLDALVGSTASPGTRESFRKKLRDGELDDK
                     EIDIEVADSGSGMPGFEIPGMPGANIGVLNLSEMFGKAMGGRTKKVRTTVSKSYTDLV
                     RDESDKLLDNEMIQREAVKSVENDGIVFLDEIDKIAARDGGMGAGVSREGVQRDLLPL
                     VEGTTVSTKYGPVKTDHVLFIASGAFHVAKPSDLLPELQGRLPIRVELKPLTKEDFRR
                     ILTETEASLIRQYKALMATEELDLDFTDDAIDALADVAVHLNSSVENIGARRLQTVME
                     RVLDEISFNAPDRGGSAVKIDQEYVKKHVGDLAADTDLSRYIL"
     gene            46716..47681
                     /locus_tag="Atu0046"
                     /old_locus_tag="AGR_C_75"
     CDS             46716..47681
                     /locus_tag="Atu0046"
                     /old_locus_tag="AGR_C_75"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85870.1"
                     /translation="MRKILLAFVVALAVSAVSSSYAEAATVVPPGNRNAEQPGVPGAS
                     ARRTKASNSSFERKYQKVIDLLSSDKALIAKIKSTAGRYGIDPIHMVGAIVGEHTYNV
                     DAYDRLQSYYVKAASYAGSSFRFGYKDETIAQFLTHAQFSKCQAKKDSYSLWNCREDV
                     WDDSFRGKTVDGVAYPNNRFSAVFFQPFYAGQTFGLGQINPLTALMLSDMVSRTSGYE
                     KLDENDATAVYTAIMDPDRSLAFMAASIRKSIDDYRSIADMDISKNPGVTSTLYNVGG
                     SQQRAAALAQKNRQRAGGGEQPLLPEENYYGWLVNDRIKDLQALL"
     gene            47736..49970
                     /gene="glcB"
                     /locus_tag="Atu0047"
                     /old_locus_tag="AGR_C_78"
     CDS             47736..49970
                     /gene="glcB"
                     /locus_tag="Atu0047"
                     /old_locus_tag="AGR_C_78"
                     /codon_start=1
                     /transl_table=11
                     /product="malate synthase G"
                     /protein_id="AAK85871.1"
                     /translation="MPRLTSDRLSVQSMPSEYKEAHVSRTDKFGLSIDDRLYAFLTDE
                     VLPGTGLDSETFFEGFSAIVHELSPKNRELLAKRDALQEKIDGWYRENGAPSDFDAYE
                     AFLKEIGYLLPEGPGFKVETNNVDPEIAVVAGPQLVVPVMNARYALNAANARWGSLYD
                     ALYGTDAISDADGAEKGRGYNPKRGDKVIAWARNFLDESAPLETGSWSDVTGFNIADG
                     LLQLAIGAATTGLKDAVQFKGFSGEAAKPATILLGKNGLHTEIVIDPSTEIGKSDRAG
                     ISDVILESALTTIMDCEDSVAAVDAEDKVLVYGNWLGLMRGDLTEAVSKGGNTFTRRL
                     NPDRYYTAPDGSALTLPGRSLMLVRNVGHLMTNPAILDRDGRDVPEGIMDAVVTALIA
                     LYDVGPSGRRQNSRAGSMYVVKPKMHGPEEVAFANEIFARVENLVGMAPNTMKMGIMD
                     EERRTTVNLKESIRAAKDRVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMKQAAWIAA
                     YENWNVDIGLECGLSGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPSPTAAT
                     LHATHYHKVDVAAVQEGLKSRGRAKLSDILSVPVAPRPNWTPEEIQRELDNNAQGILG
                     YVVRWVDQGVGCSKVPDINNIGLMEDRATLRISAQHMANWLRHGVVTEAQIIKTMKRM
                     AAVVDTQNAGDPAYLPMASDFDGSVAFQAAVELVLKGREQPNGYTEPVLHRRRLELKA
                     KQAG"
     gene            complement(50151..50864)
                     /locus_tag="Atu0048"
                     /old_locus_tag="AGR_C_80"
     CDS             complement(50151..50864)
                     /locus_tag="Atu0048"
                     /old_locus_tag="AGR_C_80"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85872.2"
                     /translation="MRIRTPLTLLGLTAALALAGCAETTSQSSAPTSGKIAASVPVAD
                     PVPAKVETVQIFNDVYGPVTDAGYALPAIPINRVNEKYRRQIVEFQTSERPGTIIVNT
                     RDRYLYYIMSGNRAVRYGIGVGKAGFAWAGEAYVAWKQEWPMWHPPKEMADRKPEVAK
                     YVEAGMGPGLSNPLGARAMYLFNEKGQDTLFRIHGSPEWASIGTAASSGCIRMINQDV
                     IDLYSRVRPGRSTKVVVIQ"
     gene            51048..51533
                     /locus_tag="Atu0049"
                     /old_locus_tag="AGR_C_81"
     CDS             51048..51533
                     /locus_tag="Atu0049"
                     /old_locus_tag="AGR_C_81"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85873.2"
                     /translation="MTILSFTNNNPLIDGRQSDKAMLVRRGVQVLLHEMRHSVLPELP
                     LASGRRADLISLSAKGEIWIIEIKSSIEDFRVDRKWPDYRLHCDRLFFATHPEVPTDI
                     FPEECGLILSDGYGAHMLRDAPEHKLPPATRKSVMLDFSRTAATRLMLAEWTTGRSFG
                     E"
     gene            complement(51594..52181)
                     /gene="actR"
                     /locus_tag="Atu0050"
                     /old_locus_tag="AGR_C_82"
     CDS             complement(51594..52181)
                     /gene="actR"
                     /locus_tag="Atu0050"
                     /old_locus_tag="AGR_C_82"
                     /codon_start=1
                     /transl_table=11
                     /product="two component response regulator"
                     /protein_id="AAK85874.1"
                     /translation="MKIEDQTPATSEPVDDIDPIGPDRSLLIVDDDGPFLRRLARAME
                     TRGFAVDTAETVSEGIARSKAAPPKYAVVDLRLADGNGLEVIEAIRQNRDDTQIVVLT
                     GYGNIATAVTAVKLGALDYLAKPADADDVFNALTQRKGEKTEVPENPMSADRVRWEHI
                     QRVYEMCERNVSETARRLNMHRRTLQRILAKRAPK"
     gene            complement(52255..53562)
                     /gene="actS"
                     /locus_tag="Atu0051"
                     /old_locus_tag="AGR_C_85"
     CDS             complement(52255..53562)
                     /gene="actS"
                     /locus_tag="Atu0051"
                     /old_locus_tag="AGR_C_85"
                     /codon_start=1
                     /transl_table=11
                     /product="two component sensor kinase"
                     /protein_id="AAK85875.2"
                     /translation="MAGHPIETTRLGRASRRIRLQTIIWLRWLAVAGQTATILFVAFA
                     LNFPLPLLACGLLIAALALANLFLTARFPSTYRLEPWEATLLLAFDLLQLTALIYITG
                     GLSNPFAPLICVQVIIAFASQPLKHSLILLGFAVICSTAIAFSPFPVPWYPDEVLPIQ
                     LLLHVGTWVAIIATTSFAAFYAYRVSHEANQLADALAATELVLEREKHLSQLDGLAAA
                     AAHELGTPLATISVVAKEMERELGHDEKYGEDIALLRSQSERCRDILRRLTSLSADNE
                     EHMSRLPLSSLIEEVMAPHREFGIRLELVEKTGRAEEPVGIRNAGIIYGLGNLIENAV
                     DYAREKVTVTVDHDAQNVAVTIEDDGPGYAHDVLARIGEPYVTERHNDTRAGGLGLGL
                     FIAKTLLERSGAAVTFENRASSKSGARVTIVWPRALMDDKRSR"
     gene            complement(53592..56078)
                     /gene="hrpB"
                     /locus_tag="Atu0052"
                     /old_locus_tag="AGR_C_86"
     CDS             complement(53592..56078)
                     /gene="hrpB"
                     /locus_tag="Atu0052"
                     /old_locus_tag="AGR_C_86"
                     /codon_start=1
                     /transl_table=11
                     /product="helicase"
                     /protein_id="AAK85876.2"
                     /translation="MTRTPVPIKTELPELPVSAVLGDIAQVLAAKKRAVLSAPPGAGK
                     TTLVPLRLLHEDWRGDGKIILLEPRRLAARAAAGRMAELLRENVGETVGYRMRLDNRV
                     SSKTRIEVVTEGVFARMVLDDPELSGVSTVIFDEFHERSLDGDFGLALALDVQAGLRE
                     DLRILVMSATLDVERIGALMGDAPVIQSLGRTFPIDIRYEERWQGIHVDEKVAKAITE
                     AHASETGSILAFLPGQAEITRTASRLEGRFPDDTDIIPLYGNLSQKEQDAAIKPAPGG
                     RRKIVLATSIAETSITIDGVRVVIDSGLQRLPVFEPATGITRLETVRVSRASADQRAG
                     RAGRTEPGIAIRLWHQGQTAALNAFTPPQILASDLSGLALDLAHWGVHDPSALAFLDA
                     PPEAALKESVALLKNLGALDNSGGLTRQGHLMRGLSLPPRLAAMVIASAEEGAGKKAA
                     MLAVMLTEQGLGGNDIDLDERLRRFFSERSERAQAARKLASRLLDAIGDKTAKAETPS
                     EVGALLLHAYPDRIALQRGARGRYVMANGRGAELAETERLAASKMLVVADITGRAAQP
                     RVLAAAAIERADIEERMPHLIVQQEQLLFDKASGQARARKVTRLGAIILDETPLPRPD
                     GEQAARALANGVREFGLDILPFSKETLQLRDRIGFLNASIGDPWPDVSDAALLARLEE
                     WFVPFQNGARSLQDIRPGSLSEGILSLVPHEVARDLGRLAPTHFEAPTGQRHPIRYDA
                     SEPTLSIRVQELFGLKAHPAIAQGRLPLLLELTSPAHRPIQTTRDLPGFWTGSWKDVR
                     ADMRGRYPRHPWPEDPASALPTSRAKPRGT"
     gene            56746..58225
                     /locus_tag="Atu0053"
     rRNA            56746..58225
                     /locus_tag="Atu0053"
                     /product="16S ribosomal RNA"
     gene            58553..58629
                     /locus_tag="Atu0054"
     tRNA            58553..58629
                     /locus_tag="Atu0054"
                     /product="tRNA-Ile"
     gene            58688..58763
                     /locus_tag="Atu0055"
     tRNA            58688..58763
                     /locus_tag="Atu0055"
                     /product="tRNA-Ala"
     gene            complement(59238..59627)
                     /locus_tag="Atu0056"
     CDS             complement(59238..59627)
                     /locus_tag="Atu0056"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAL41084.1"
                     /translation="MDQSLFAAPHGFSQRITSFFACACQGIHQMPLIHFFVLIVYAHH
                     LLDLAEPFLLAYAQRGAKSGNPGKTQSAAKAIPSLTIKRGTTVTVTFYNRNTNDDIDV
                     FDTILFEGTPVHFEVVSLRPASRDIIR"
     gene            59719..61975
                     /locus_tag="Atu0057"
     rRNA            59719..61975
                     /locus_tag="Atu0057"
                     /product="23S ribosomal RNA"
     gene            62235..62492
                     /locus_tag="Atu0058"
     CDS             62235..62492
                     /locus_tag="Atu0058"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAL41085.1"
                     /translation="MFPIRAVEDDHVDRTGVEAQQCVKLTVTNSSIDFFVPIDYVHRT
                     KVDDICSVFTLTWPSATTLQTARQTIGDGLASCMAAKLDLE"
     gene            62607..62725
                     /locus_tag="Atu0059"
     rRNA            62607..62725
                     /locus_tag="Atu0059"
                     /product="5S ribosomal RNA"
     gene            62964..63040
                     /locus_tag="Atu0060"
     tRNA            62964..63040
                     /locus_tag="Atu0060"
                     /product="tRNA-Met"
     gene            63196..65004
                     /gene="recQ"
                     /locus_tag="Atu0061"
                     /old_locus_tag="AGR_C_92"
     CDS             63196..65004
                     /gene="recQ"
                     /locus_tag="Atu0061"
                     /old_locus_tag="AGR_C_92"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase"
                     /protein_id="AAK85881.1"
                     /translation="MNADPLNILKAVYGYDAFRGRQGEIIQHVVAGNNAFVLMPTGGG
                     KSLCYQIPALAREGMGLVVSPLIALMVDQVAALRQAGVRAEALNSDLSPEERRTLWRD
                     VRAGNVDILYAAPETLLKPDVLDALQSIDLSLIAVDEAHCLSQWGHDFRPPYRQLDML
                     IARFPNTPRMALTATADEPTRAEILGHLAIDEADAFIAGFDRPNIRYAIMEKDNPRTQ
                     LKRFLNGRENESGIVYCLSKRKVEETAAWLREEGRDALPYHAGMDKAAREENQTRFQH
                     GEAVIIVATVAFGMGIDKPDVRFVVHIDLPGSIEAYYQETGRAGRDGLPSDVLMLYGY
                     EDIALRNRFIEESDAADQRKYMERQKLDALLGLAETAGCRRQVLLSYFGDRCEPCGNC
                     DTCSSPPDLFEGAIAAQKLLSCIYRTGERFGQAYVISVLLGAQDERITKFGHDSITTY
                     GIGKEHDNRTWRAILRQLVALRLIEVDLSGHGGLSISENGRRFLREKPSLMLRIPSAP
                     RSTRRDAPRNAMSTALPEADRGLFEALRAKRMEIARAQNVPPYVIFHDKTLIELAAAR
                     PASAKEMAQIAGVGQTKLERYGPAFLDTIMQHAAGE"
     gene            complement(65054..66286)
                     /gene="frcR"
                     /locus_tag="Atu0062"
                     /old_locus_tag="AGR_C_93"
     CDS             complement(65054..66286)
                     /gene="frcR"
                     /locus_tag="Atu0062"
                     /old_locus_tag="AGR_C_93"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, ROK family"
                     /protein_id="AAK85882.1"
                     /translation="MRQSVETAPQAPPTTMDMSGGANQIGVRAYNERLVLSLVRRHGG
                     LSKAEISRLCGLSAQTVSVIMRSLEKDGLLIRGERLRGKVGQPSTPMRLNPDAVFSFG
                     VKIGRRSVDLVLMDFVGRIRLKLRKTYPYPMPEWILPFVIEGISELESKLSAVERQKI
                     AGVGIAAPFELWNWAQEVGAPQAEMERWRDVDIRSEIANGISYPVFLQNDATSACGAE
                     LVFGAGQNYADFLYVFIGSFIGGGVVLNSALFSGKTGTAGAIGPLPVQGQDGNTVQLL
                     KIASIFVLENMLRERGIDPRPLWFSPDEWIDFGEPLENWIQKTAAALAQAVIAAASII
                     DFSSVIIDGGFPDWVRTRIVSATRLALKHHDLQGVTLPEIVEGAVGSQARAIGGASLP
                     LFSRYLIDQNVLFKDTTG"
     gene            66551..67573
                     /gene="frcB"
                     /locus_tag="Atu0063"
                     /old_locus_tag="AGR_C_94"
     CDS             66551..67573
                     /gene="frcB"
                     /locus_tag="Atu0063"
                     /old_locus_tag="AGR_C_94"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, substrate binding protein
                     (sugar)"
                     /protein_id="AAK85883.1"
                     /translation="MKTTVSALLGALALGVSFASAASAADTSVCLITKTDTNPFFVKM
                     KEGATAKAKELGVTLKSYAGKIDGDSESQVAAIETCIADGAKGILITASDTKGIVPAV
                     QKARDAGLLVIALDTPLEPVDAADSTFATDNLLAGELIGKWAAGTLGDKAKDAKIAFL
                     NLTPSQPTVDVLRNQGFMKGFGIDVKDINKIGDEDDKRIVGHDVTNGNEEGGRSAMEN
                     LLQKDPTINVVHTINEPAAAGAYEALKAVGREKDVLIVSVDGGCPGVKNVAEGVIGAT
                     SQQYPLLMAALGVEAVKKFADTGEKPKPTAGKNFFDTGVTLVTDKPVKGLDSIDTKEG
                     LKKCWG"
     gene            67798..68880
                     /gene="frcC"
                     /locus_tag="Atu0064"
                     /old_locus_tag="AGR_C_96"
     CDS             67798..68880
                     /gene="frcC"
                     /locus_tag="Atu0064"
                     /old_locus_tag="AGR_C_96"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, membrane spanning protein
                     (sugar)"
                     /protein_id="AAK85884.2"
                     /translation="MSDQPVRAQPHNEFEKVLSGSSTQVAAFDTHNKSLLEKFQHFLH
                     SSPAAVPLIVLVLSLAIFGMTLGGKFFSAFSLTLILQQVAIVGIVGAAQSLVILTAGI
                     DLSVGAIMVLSSVVMGQFTFRYGLPAELSIICGLAVGAFCGFINGVLVSRMRLPPFIV
                     TLGMWQIVLATNFLYSANETIRAQDIVQQAPILQFFGNNIRIGNAVFTYGVLAMVLLV
                     ALLWYVLNRTAWGRHLYAVGDDPDAAELAGVNVKRMLTTVYTLSGLICAFAGWALIGR
                     IGSVSPTAGQFANIESITAVVIGGISLFGGRGSIMGMIFGALIVGVFSLGLRLIGTDP
                     QWTYLLIGVLIILAVAIDQWIRKVAG"
     gene            68880..69662
                     /gene="frcA"
                     /locus_tag="Atu0065"
                     /old_locus_tag="AGR_C_98"
     CDS             68880..69662
                     /gene="frcA"
                     /locus_tag="Atu0065"
                     /old_locus_tag="AGR_C_98"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, nucleotide binding/ATPase
                     protein (sugar)"
                     /protein_id="AAK85885.1"
                     /translation="MAKEPILTARNLVKRYGRVTALDNADFDLYPGEILAVIGDNGAG
                     KSSLIKAISGAVTPDEGEIRLEGQPVQFRSPIEARKAGIETVYQNLALSPALSIADNM
                     FLGREIRKPGIQGSLFRALDRPAMEKFAREKLSELGLMTIQNINQAVETLSGGQRQGV
                     AVARAAAFGSKVVILDEPTAALGVKESRRVLELILDVRSRGLPIVLISHNMPHVFEVA
                     DRIHIHRLGKRLCVINPKDYSMSDAVAFMTGAKEAPQETLAA"
     gene            69659..70288
                     /locus_tag="Atu0066"
                     /old_locus_tag="AGR_C_100"
     CDS             69659..70288
                     /locus_tag="Atu0066"
                     /old_locus_tag="AGR_C_100"
                     /codon_start=1
                     /transl_table=11
                     /product="putative kinase"
                     /protein_id="AAK85886.1"
                     /translation="MTLKLETIVEDVLRRAEGQSRFIIAIAGPPGAGKSTLADALCDA
                     LRARGETAAVLPMDGFHMDNGILEERGLLSRKGAPETFDVRGFLDIVSAVREGGQEVL
                     VPVFDRSREIAIASARAIAPDTRLILAEGNYLLLNEAPWTVLSGSFDLTIFVGPSVAV
                     LEERLRNRWQGYGLNAAQIHAKLFENDLPNGKRVIENARPADIHIDIWE"
     misc_binding    70421..70645
                     /note="cobalamin riboswitch; predicted by RFAM"
                     /bound_moiety="adenosylcobalamin"
     gene            70953..71174
                     /gene="nrdH"
                     /locus_tag="Atu0068"
                     /old_locus_tag="AGR_C_102"
     CDS             70953..71174
                     /gene="nrdH"
                     /locus_tag="Atu0068"
                     /old_locus_tag="AGR_C_102"
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin protein"
                     /protein_id="AAK85887.2"
                     /translation="MTVTVYSKPACVQCTATYRALDRIGVPYEIIDISEDTDALDHVR
                     GLGYMQVPVVVAGERHWAGFRPDMIGSIS"
     gene            71188..71586
                     /gene="nrdI"
                     /locus_tag="Atu0069"
                     /old_locus_tag="AGR_C_104"
     CDS             71188..71586
                     /gene="nrdI"
                     /locus_tag="Atu0069"
                     /old_locus_tag="AGR_C_104"
                     /codon_start=1
                     /transl_table=11
                     /product="NrdI protein involved in ribonucleotide
                     reduction"
                     /protein_id="AAK85888.1"
                     /translation="MGLIVYYSSRSENTHRFLLKLERRLFRLPLGAEEDVPQVSEPYV
                     LVTPTYGGGGTKGAVPKPVIRFLNEPSNRNLIRGVIAAGNTNFGAAFASAGDIVSRKC
                     AVPFLYRFELLGTEEDVANVKHGLERFWTR"
     gene            71679..73760
                     /gene="nrdE"
                     /locus_tag="Atu0070"
                     /old_locus_tag="AGR_C_106"
     CDS             71679..73760
                     /gene="nrdE"
                     /locus_tag="Atu0070"
                     /old_locus_tag="AGR_C_106"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleoside-diphosphate reductase 2 alpha
                     chain"
                     /protein_id="AAK85889.2"
                     /translation="MLNLYDENGKIQLDKDRLAARQYFLQHVNQNTVFFHNLREKLDY
                     LVTEGYYEQEVLDQYSFNFVRDLYDEAYSRKFRFPTFLGAFKYYTSYTLKTFDGKRYL
                     ERYEDRVCMVALALARGDEQLARDLMDEIISGRFQPATPTFLNAGKKSRGELVSCFLL
                     RVEDNMESIGRSINSALQLSKRGGGVALSLTNIREFGAPIKQIENQSSGVIPVMKLLE
                     DSFSYANQLGARQGAGAVYLHAHHPDIMRFLDTKRENADEKIRIKTLSLGVVIPDITF
                     ELARNNEDMYLFSPYDVERVYGVPLTEISVTEKYHEMVADSRIRKKKIKAREFFQVIA
                     EIQFESGYPYIMFEDTVNRANPVAGRISMSNLCSEILQVSEASEFNADLSYSHMGKDI
                     SCNLGSLNIASAMDSADFGKTIETSIRALTAVSDMSHISSVPSVEKGNDASHAIGLGQ
                     MNLHGYLARERIFYGSEEGIDFTNIYFYTVTYHAIRASNRLAVERGQSFKGFENSKYA
                     SGDYFDKYTDREWLPATEKVRDLFEKAGIAIPTQEDWTALKQDVMASGLYNQNLQAVP
                     PTGSISYINHSTSSIHPIVSKIEIRKEGKIGRVYYPASYLSNDNLEYYQDAYEIGPEK
                     IIDTYAAATQHVDQGLSLTLFFRDTATTRDINRAQIYAWRRGIKTIYYIRLRQMALEG
                     TQVQGCVSCTL"
     gene            73777..74751
                     /gene="nrdF"
                     /locus_tag="Atu0071"
                     /old_locus_tag="AGR_C_107"
     CDS             73777..74751
                     /gene="nrdF"
                     /locus_tag="Atu0071"
                     /old_locus_tag="AGR_C_107"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleoside-diphosphate reductase 2 beta
                     chain"
                     /protein_id="AAK85890.2"
                     /translation="MNIAVKPASRIRAVNWNRIEDDKDLEVWNRLTSNFWLPEKVPLS
                     NDIPSWGTLKPEEQELTIRVFTGLTLLDTIQNGVGAVRLMPDSATPHEEAVLSNISFM
                     EAVHARSYSSIFSTLCSTPDVDDAYRWSEENEFLQRKSAIIMREYDSGDPLKKKIASV
                     FLESFLFYSGFYLPMFWSSRAKLTNTADLIRLIIRDEAVHGYYIGYKFQRALDRLGEA
                     QRQEIKDFAFDLLLELYDNEAKYTEDLYDGVGLTEDVKQFLHYNANKALMNLGYEALF
                     PAEACRVNPAILSALSPNADENHDFFSGSGSSYVIGKAVATEDEDWDF"
     gene            complement(74781..76016)
                     /locus_tag="Atu0072"
                     /old_locus_tag="AGR_C_108"
     CDS             complement(74781..76016)
                     /locus_tag="Atu0072"
                     /old_locus_tag="AGR_C_108"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85891.1"
                     /translation="MARWRMPDPIDQHQNHANYSVVATFLAGSYLWTFIVTGNPSMRL
                     IISLVLMISLLSSCAGRPGADVLQAVNTRAKDAKIVTAYVASTREKSEEAKKGFSALR
                     AAEPNYARFDISIPPTHKSGKIEWSTGKPDAKKDFVVTKAQMLSKTSFTTDLGDISRS
                     GKQIALFVHGYNYSYQEALFRAAQMAADANMDGVPLVFSWPSQANLTGYVADKESATY
                     SRDALATLLTDLTRQTPRKSIVVFGHSMGGWLVMEALRQLRFEGRNDVIAKLQVVLAA
                     PDIDADVFRKQIEVVGRLNPPLTVLVSKDDRALKASSILGADVTRIGALDVADPQVQE
                     AALKEGVQFVDISNLKASDPLNHDRYAALASLVPQLEASRNGNGQNGIGRAGAFVFDA
                     IGATVSSPFRLASQVVNPQ"
     gene            76045..77172
                     /locus_tag="Atu0073"
                     /old_locus_tag="AGR_C_109"
     CDS             76045..77172
                     /locus_tag="Atu0073"
                     /old_locus_tag="AGR_C_109"
                     /codon_start=1
                     /transl_table=11
                     /product="recF-like protein"
                     /protein_id="AAK85892.2"
                     /translation="MTNKVSLSRLKLTDFRNYAAAALVLDERHVVLTGDNGSGKTNLL
                     EAVSFLSPGRGLRRAVLSDVTRVGAEATGFSIFADVDGMDGEVAIGTGIEGDGEVVSR
                     RLRLNGTPVKSVDELTDHLRVLWLTPAMDGLFTGSSSDRRRFLDRLVLSLDPGHGRRA
                     SDFEKAMRGRNRLLSEGRFDPVWLDGIEKQMAELGISMAVARYEMLGLLKTLIEGRAG
                     NAAFPSATLSLAGFMDDRLNRPAVDLEDEYGLMLRDGRYRDAAAGRTLDGPHRVDLFV
                     RHAEKNMEAERCSTGEQKALLVGLVLAHAQLTANMTGYAPVLLLDEIAAHLDEGRRAA
                     LFDLIHALGGQSFMTGTDAAMFSALGERAQFFNVSHGGITA"
     gene            77195..77956
                     /gene="moeB"
                     /locus_tag="Atu0074"
                     /old_locus_tag="AGR_C_111"
     CDS             77195..77956
                     /gene="moeB"
                     /locus_tag="Atu0074"
                     /old_locus_tag="AGR_C_111"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin biosynthesis protein"
                     /protein_id="AAK85893.2"
                     /translation="MDPLSPEEIERYKRHILLPEIGGAGQQRLKAARVLVIGAGGLGA
                     PVLHYLAAAGVGTLGMIDDDVVSLSNLQRQVIHDTGTIGELKTESARKTIARLNPHVR
                     TLMYEERFSQVWAHDHLPSFDLLIDGSDNFDTRYAAADAAEAAKRPLVTGAVGRFDGS
                     VTVLKPYETNAEGSLLPGYRDLFPAPPPQGLIPNCAETGIVGALTGVIGTLMAMEAIK
                     VITGAGEPLIGRLLLYDALSARFETVKYKRRAREK"
     gene            77960..78436
                     /locus_tag="Atu0075"
                     /old_locus_tag="AGR_C_112"
     CDS             77960..78436
                     /locus_tag="Atu0075"
                     /old_locus_tag="AGR_C_112"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85894.1"
                     /translation="MIEIAKIGDDFDRWQDLLALIMTSFAYMDGVIDPPSSAYRLTLE
                     NLAEKARAEIAFVALDSDELLGCLFCRPEPPASLYVGKLCVSPKAQGKGIGKLLLLQA
                     EALARELALPALRLETRIELLSNHTKFAAWGFVKTAENAHAGYDRTTSIEMTKFLG"
     gene            complement(78443..79132)
                     /locus_tag="Atu0076"
                     /old_locus_tag="AGR_C_113"
     CDS             complement(78443..79132)
                     /locus_tag="Atu0076"
                     /old_locus_tag="AGR_C_113"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK85895.1"
                     /translation="MGIQAKFLLLISVLLVLVGSPAGAQPPSPEETAELYYRAWLNFD
                     RASMVRLDKEWGASGSGQRYTDMELVADPIAWQRQYKGVHSPKGTTSEQSDQFAKLWV
                     ASTARVLCKAEPAHVGSQTPAGVFVVRIKMNCSLPDVGPAFQRLKAATSADEIGDRTR
                     MPSVKLMKQMVEATRTAPLTHKVTTEVQLVSGPDKSIWRVGTAEIQPQTGIDRVSSVF
                     LSQMVQSGLLQ"
     gene            complement(79181..80185)
                     /locus_tag="Atu0077"
                     /old_locus_tag="AGR_C_114"
     CDS             complement(79181..80185)
                     /locus_tag="Atu0077"
                     /old_locus_tag="AGR_C_114"
                     /codon_start=1
                     /transl_table=11
                     /product="D-isomer specific 2-hydroxyacid dehydrogenases
                     family protein"
                     /protein_id="AAK85896.1"
                     /translation="MTHKKRPTVYITRKLPDVVETRMRELFDAELNIDDSPRSEEELV
                     AAMQRVDVLVPTVTDRITAAMIEKAGPQLKLIASFSNGIDHVDVDAAARKGITVTNTP
                     NVLTEDSADITMALVLAVPRRMIEGTRVLANGADEWLGWSPTWMLGRRISGKRIGIVG
                     MGRIGTAVARRAKAFGLSIHYHNRKRVNPATEAELEATYWDSLDQMLARVDIVSVNCP
                     STPATYHLISARRLALMQPTSYIVNTARGDIIDEAAMIQCLREGKIAGAGLDVYENEP
                     QVNPKLIKLAKEGKVVLLPHMGSATIEGRIEMGDKVIINIRTLFDGHRPPNRVLPGRN
                     "
     gene            80360..80899
                     /locus_tag="Atu0078"
                     /old_locus_tag="AGR_C_117"
     CDS             80360..80899
                     /locus_tag="Atu0078"
                     /old_locus_tag="AGR_C_117"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85898.2"
                     /translation="MGMRSVVSIVCIALSLGLLGAAGEAMAQGAAKGASGLPLPRFVS
                     LKSKRVNMRIGPSTDYAVSWMYLKSGMPVEIIQEYENWRRIRDADGTEGWVNQALLSG
                     ERTAVAAPWMRGKGKEVYVNMRREAQSGAAVTARLEPGVVFRIGECNGDWCRAEAGQA
                     SGWVSQGEIWGAYPGEAFK"
     gene            complement(80892..81884)
                     /locus_tag="Atu0079"
                     /old_locus_tag="AGR_C_118"
     CDS             complement(80892..81884)
                     /locus_tag="Atu0079"
                     /old_locus_tag="AGR_C_118"
                     /codon_start=1
                     /transl_table=11
                     /product="Atu0079-1 mutant of pfkB family carbohydrate
                     kinase"
                     /protein_id="AAK85899.1"
                     /translation="MTKFDVLTVGNAIVDIISRCDDRFLNDNAITKGAMNLIDAERAE
                     LLYSLMGPALEASGGSAGNTAAGVANFGGKAAYFGKVAEDQLGEIFQHDIRAQGVYFE
                     TKPEGTFPPTARSMIFVTEDGERSMNTYLGACVDLGPEDVEDDVVAKTKVTYFEGYLW
                     DPPRAKDAIRECARIAHENGREVSMTLSDSFCVGRYRDEFLDLMRSGTVDIVFANKQE
                     ALSLYETEDFELALTKIAADCKIAAVTMSEEGAVILRGTERVKVEAYPVHDVVDTTGA
                     GDLFAAGFLFGYTQDRSLEDCGKLGCLAAAAVIQQVGPRPMSSLKALGEKHGLI"
     gene            82362..83306
                     /locus_tag="Atu0080"
                     /old_locus_tag="AGR_C_121"
     CDS             82362..83306
                     /locus_tag="Atu0080"
                     /old_locus_tag="AGR_C_121"
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="AAK85901.1"
                     /translation="MSAVAANVAPIFILILIGWLTVKAGLLRADAGDILSDFVFKIAV
                     PTLIFRTLAEANFHGASPFRLWITYFAGVAVTWAFGHIVTRYVFKQDVRIAVIAGISS
                     AFANNIFIGLPLVGRSVGDEGLVALSILLAIHLPVMMIAGTILMENATHKAVGGEKRG
                     MAAVFKQVGRNLVTNPLVIGLAIGLSTNVSGVALTPILKTVVDQVASMAGPAALISLG
                     MALTKYTIRGNMGIAVTMTVFKLLLLPACVWAMGHALGLSREWTAALVLTSSVPTGVN
                     AWLIANRFGIGHSVAASTISISTATGVLSVSLWAWLLS"
     gene            complement(83313..84329)
                     /gene="rsmC"
                     /locus_tag="Atu0081"
                     /old_locus_tag="AGR_C_122"
     CDS             complement(83313..84329)
                     /gene="rsmC"
                     /locus_tag="Atu0081"
                     /old_locus_tag="AGR_C_122"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal RNA small subunit methyltransferase"
                     /protein_id="AAK85902.2"
                     /translation="MSRDAVKTLFHPFASDMLAMPKEGERVLFLGAEAGPRLDGFDAE
                     IVAVQHLRPLYRALEAQGTGVAPDVSGEDYDAALLLCGKHRGENENRVAEALSRVKAG
                     GLIVAAGSKEDGIVTLRKTLSKLGIESESTPKYHGVAIWFKRPEDVSAAVLKLAQKPA
                     TVEGRFTALPGMFSHDRVDDGSELLASRLPTDFDGNAADFGAGWGYLSIMLAEKSPRT
                     ARIDLFEADWNALEFAKTNLLENNPRLTARFFWQDLANEPPKEKYDLIIMNPPFHAAG
                     QAAEPALGQAFIKAAAGALRSGGKLLMVANRGLPYEPVLAAEFRTTAEVCRNARFKIL
                     SAQK"
     gene            complement(84465..86606)
                     /gene="pnpA"
                     /locus_tag="Atu0082"
                     /old_locus_tag="AGR_C_124"
     CDS             complement(84465..86606)
                     /gene="pnpA"
                     /locus_tag="Atu0082"
                     /old_locus_tag="AGR_C_124"
                     /codon_start=1
                     /transl_table=11
                     /product="polyribonucleotide nucleotidyltransferase"
                     /protein_id="AAK85903.1"
                     /translation="MFNKHSVEIEWAGRPLKLETGKVARQADGAVIATYGETMVLATV
                     VSAKSPKPGQDFFPLTVNYQEKTYAAGKIPGGYFKREGRPSEKETLVSRLIDRPIRPL
                     FPEGYKNDTQVVVTVIQHDLENDPDVLSMVAASAALTLSGIPFMGPVGGARVGYINGE
                     YVLNPHLDEMDESVLDLVVAGTQDAVLMVESEAKELNEEIMLGAVMFGHKGFQPVIDA
                     IIKLAEVAAKEPREFEPEDFSALENEMLGLAETELRTAYKITEKAARYAAVDAVKTKV
                     KAHFLPEEGEAKYSPEEIGAVFKHLQAKIVRWNVLDTKSRIDGRDLSTVRPIVSEVGI
                     LPRTHGSALFTRGETQAIVVATLGTGEDEQYVDSLTGMYKERFLLHYNFPPYSVGETG
                     RMGSPGRREIGHGKLAWRAIRPMLPTAEQFPYTLRVVSEITESNGSSSMATVCGTSLA
                     LMDAGVPLAKPVAGIAMGLILEGERFAVLSDILGDEDHLGDMDFKVAGTADGITSLQM
                     DIKIAGITEEIMKIALEQAQGGRKHILGEMANAITESRGQLGEFAPRIEVMNIPVDKI
                     REVIGSGGKVIREIVEKTGAKINIEDDGTVKIASASGKEIEAARKWIHSIVAEPEVGQ
                     IYEGTVVKTADFGAFVNFFGARDGLVHISQLASERVAKTSDVVKEGDKVWVKLMGFDE
                     RGKVRLSMKVVDQATGKEVAADKKDGEAAAE"
     gene            complement(86872..87141)
                     /gene="rpsO"
                     /locus_tag="Atu0084"
                     /old_locus_tag="AGR_C_126"
     CDS             complement(86872..87141)
                     /gene="rpsO"
                     /locus_tag="Atu0084"
                     /old_locus_tag="AGR_C_126"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S15"
                     /protein_id="AAK85904.1"
                     /translation="MSITAERKAALITEYATKAGDTGSPEVQVAILTERINNLTGHFK
                     DHKKDNHSRRGLLTLVSSRRSLLDYLKKKDEARYTKLIGALGIRR"
     gene            complement(87307..88254)
                     /gene="truB"
                     /locus_tag="Atu0085"
                     /old_locus_tag="AGR_C_127"
     CDS             complement(87307..88254)
                     /gene="truB"
                     /locus_tag="Atu0085"
                     /old_locus_tag="AGR_C_127"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine 55 synthase"
                     /protein_id="AAK85905.1"
                     /translation="MSKPRKQQHRKPKGRPISGWLILDKPLDFGSTEAVSKIKWLFNA
                     QKAGHAGTLDPLASGMLPIALGDATKTVPYVMDGRKIYEFTVTWGEQRATDDLEGEVV
                     ESSDQRPEEQAIRDILPNYTGVIMQTPPQFSAIKIAGERAYDLARDGETVEIPAREVE
                     IHRLTLLACPDADTAHFEVECGKGTYVRALARDMGRDLGCFGHISELRRTMVAPFGED
                     MMVPLETLTALEAIEDRDERLEALDAFLIDTAEALSSLPRLIINDDQAHRLKMGNPIL
                     LRGRDAPANHPEAYATAQGKLVAIGEIGEGEFRPKRVFG"
     gene            complement(88258..88674)
                     /gene="rbfA"
                     /locus_tag="Atu0086"
                     /old_locus_tag="AGR_C_129"
     CDS             complement(88258..88674)
                     /gene="rbfA"
                     /locus_tag="Atu0086"
                     /old_locus_tag="AGR_C_129"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-binding factor A"
                     /protein_id="AAK85906.1"
                     /translation="MAKATSSAPSQRMLRVGEQVRAALTQILQRGEVRDDLIEGTVIS
                     ISEVRMSPDLKIATAYVTPLGVADHTDIISALNRHAKFMRGRLGPQLRQMKYMPELRF
                     RDDTSFDNYQKIDALLRSPEVQRDLGPSNEKDDEQN"
     gene            complement(88750..91491)
                     /gene="infB"
                     /locus_tag="Atu0087"
                     /old_locus_tag="AGR_C_131"
     CDS             complement(88750..91491)
                     /gene="infB"
                     /locus_tag="Atu0087"
                     /old_locus_tag="AGR_C_131"
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-2"
                     /protein_id="AAK85907.1"
                     /translation="MTDNNDDKTLNAPAKKTLTLKPGGMNQGTVRQDMGRGRTNAVVV
                     ETRKRRPHRPEDEKPVQPVVAAPKPAAPAPVAARPQAPQPRIHQPGGQQQRPGSSQSQ
                     QRSGSSAPQQRQADRPRGNVLHDLSAGEMEARRRALMEAQARDVVEAKQRAEDEARRK
                     VEEEQRIAAEKMEAANRAAEEAAAAKVAASQPAAEVRAEPASERPAAAAAPAPRTDAR
                     PQSAAAAPRSAPATPDAAAPRGRRTGGDDEDDRGAVRRGSSLPARGKVVAPAPAKPAA
                     RLKTEEERRRGKLTVTSNLEEDGTPRGRSMASMRRRQEKFRRSQMQETREKVLREVIL
                     PETITIQELSQRMSERAVDVIKFLMKEGQMLKPGDVIDADLAELIAVEFGHTVKRVSE
                     SDVEEGIFNQTDDEGEMVSRPPVVTIMGHVDHGKTSLLDAIRQANVVSGEAGGITQHI
                     GAYQVEKNGHKITFIDTPGHAAFTAMRARGAQATDIAVLVVAADDSVMPQTIESINHA
                     KAAGVPIVVAINKIDKHEANPDKVRQQLLQHEVFVESMGGEVLDVEVSAKNKLNLDKL
                     LEAILLQAEILDLKADPSRTAEGTVIEAELDRGRGAVATVLVQKGTLKPGQIIVAGDQ
                     WGRVRALVNDKGDHVKEAGPAMPVEILGLSGTPSAGDRFAVVENESRAREISEYRQRL
                     ARDKAVARQTGQRGSLEQMMSQLQTSGLKEFPLVIKADVQGSVEAIIASLDKLGTDEV
                     RARVVHSGAGAITESDISLAEASNAAIIGFNVRANAQARTASERAGIEIRYYNIIYDL
                     VDDVKAAMSGLLSPERRETFLGNAEILEVFNITKVGKVAGCRVVEGKVERGAGVRLVR
                     DNVVIHEGKLKTLKRFKDEVNEVPVGQECGMAFENYEDIRAGDTIECFRVEHITRTL"
     gene            complement(91594..92295)
                     /locus_tag="Atu0088"
                     /old_locus_tag="AGR_C_134"
     CDS             complement(91594..92295)
                     /locus_tag="Atu0088"
                     /old_locus_tag="AGR_C_134"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85908.1"
                     /translation="MTSQAHEPDDLPETDDDGRIKGDVNGRMCIVTRQSGSPDELIRF
                     VAGPDGNVVPDLKRQLPGRGCWVTPERALIEKAIAKKLFARALKRDVKAGPELLALLD
                     RLMAQQLAGMMNMARKAGQFISGATKVDAAVRSGNAIAVFHATDAAADGVRKLDQARK
                     AWALGSDAGNEIPSFRLSSEAEMDELMGQNAFIHACALAGQAGEGVVKRATMLEQYRL
                     GGRSQAERDAARTEQ"
     gene            complement(92292..93908)
                     /gene="nusA"
                     /locus_tag="Atu0089"
                     /old_locus_tag="AGR_C_136"
     CDS             complement(92292..93908)
                     /gene="nusA"
                     /locus_tag="Atu0089"
                     /old_locus_tag="AGR_C_136"
                     /codon_start=1
                     /transl_table=11
                     /product="N-utilization substance protein A"
                     /protein_id="AAK85909.1"
                     /translation="MAVSANRLELLQIADAVAREKVIDREIVLAAMADAIQKAARSRY
                     GSETNIRADINSKTGEIRLQRLLEVVEAAEDYSTQIPLELARDRNPDAKLGDFIADPL
                     PPMDFGRIAAQSAKQVIVQKVREAERDRQYDEFKDRIGEIVNGTVKRVEYGNVIVDLG
                     RGEGIIRRDEMIPRENMRYGDRVRAYVYDVRREQRGPQIFLSRTHPQFMVKLFTMEVP
                     EIYDGIIQIKSVARDPGSRAKIAVISNDSSIDPVGACVGMRGSRVQAVVGELQGEKID
                     IIPWSQEPASFIVNALQPAEVAKVVLDEESERIEVVVPDEQLSLAIGRRGQNVRLASQ
                     LTGWDIDIMTEQEESERRQKEFNERTALFMEALDVDEMVGQVLASEGFAQVEELAYVD
                     LDEITSIDGFDEDTADEIQTRAREYLERLEAEMDAKRKELGVTDELRQIDGLTSQMMV
                     ALGEDGIKTIEDFAGCAADDLVGWSERKDGETKKFEGIFSKLDVSRVEAENMVVQARL
                     LAGWITAEELASEQEVEAEAAEEADTAEQE"
     gene            complement(93972..94568)
                     /locus_tag="Atu0090"
                     /old_locus_tag="AGR_C_138"
     CDS             complement(93972..94568)
                     /locus_tag="Atu0090"
                     /old_locus_tag="AGR_C_138"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85910.1"
                     /translation="MADTAQEPRLITETGIDQRIAEIIEPVLTGMGYLLVRVRLSNQN
                     GMTLQVMAEREDGTMNVQDCEAISMAISPVLDVEDPVEKAYHLEVSSPGIDRPMVRKT
                     DFTRWQGHLVKVETSILVENRKRFRGKIVEVDADSFKLERDQIAYGEEPTVVVPFNAL
                     SDAKLILTDDLIRDALRADKAAKAAAANQNDENEADED"
     gene            94974..96485
                     /locus_tag="Atu0091"
                     /old_locus_tag="AGR_C_139"
     CDS             94974..96485
                     /locus_tag="Atu0091"
                     /old_locus_tag="AGR_C_139"
                     /codon_start=1
                     /transl_table=11
                     /product="MFS permease"
                     /protein_id="AAK85911.2"
                     /translation="MMTSLSSSENMIALVQASTSLPIMMFSLISGALADSFDRRRIMI
                     SAQLLMLTASVLLTVFAWSGWLTPWLLLFFTFMIGCGTALNNPSWQASVGEMVPREDL
                     PAAVTLNSVGFNITRSVGPAIGGIIVAAAGAAAAFFVNALSYFTLIYALFRWQPPKYA
                     STLPREQLLAAISAGMRYVAMSPNIGKVLVRGFLFGLSASAILALMPIVARDLVEGGP
                     LTYGVMLGAFGVGAIGGALVSARLREVMSSEWIVRVAFLGFAFSSGVTAVSTSSIITS
                     LVLAIAGACWVLALSLFNTIVQLSTPRWVVGRALSLYQTLTFGGIAVGSWLWGELAED
                     YGISYSLLCSCVLMLLGVVVGLKLAMPAFASLNLDPLNRFVEPPLRLDVKPRSGPIAI
                     LIDYEIHDEDLGEFLPLMAERRRIRLRDGARNWNLMRDLENPDIWTESYHVPTWVEYV
                     RHNHRRTQADAEAWDRLLELHRGKTRPRVHRMIERQTIPPTDDIFHKPHTDQH"
     gene            complement(96508..97773)
                     /gene="mltB"
                     /locus_tag="Atu0092"
                     /old_locus_tag="AGR_C_140"
     CDS             complement(96508..97773)
                     /gene="mltB"
                     /locus_tag="Atu0092"
                     /old_locus_tag="AGR_C_140"
                     /codon_start=1
                     /transl_table=11
                     /product="lytic murein transglycosylase"
                     /protein_id="AAK85912.1"
                     /translation="MPHRFATKALAAILSVFSATTVLAQSAPKGAAAAKYDADFNAWL
                     KKEIWPEARKAGISQETLEATLSGLSISWNLPDLVIPGQKPPKEQSQSQAEFSSPGAY
                     FSEKRLQGLAVTGRSLAATHAATLRRIETKYGVPGDIVVAIWGRESGFGRAKLPHSVV
                     DVLATKAYMSTRKEMFRTELIDALKIVESGDIAASRMMGSWAGALGQPQFMPSSYLKY
                     AVDFDGDGHRDIWNSVPDALASIANYLSQRGWQRNRDWGFEVSIPANVSCAQEGPDLA
                     RPVADWAKMGITRISGKAFPVNDLTADGMMLVPAGRHGPEFVVTPNFYVIKEYNNSDL
                     YALFIGNLADRIAHGAGPFKGEWGNVGSMLRSDVLTMQKALVAKGYDVGKADGLAGFK
                     TRRSLGDWQSKNGLAPTCFPDATLKAKLK"
     gene            complement(97808..98413)
                     /gene="recR"
                     /locus_tag="Atu0093"
                     /old_locus_tag="AGR_C_142"
     CDS             complement(97808..98413)
                     /gene="recR"
                     /locus_tag="Atu0093"
                     /old_locus_tag="AGR_C_142"
                     /codon_start=1
                     /transl_table=11
                     /product="Recombination protein"
                     /protein_id="AAK85913.1"
                     /translation="MAKRVTGPEIEKLIQLLAKVPGLGPRSARRAALHLIKKKEQLLG
                     PLGHAMGEAYDKVKICSCCGNVDTIDPCTVCADDRRDQSVIIVVEDVSDLWALERAGA
                     MNTAYHVLGGTLSPLDGVGPEDLNIKGLIDRVSAGGIRELIIAVNATVEGQATAHYIT
                     DRLSGLGIKITRLAHGVPVGGELDYLDEGTLTAALRARTTI"
     gene            98472..99086
                     /locus_tag="Atu0094"
                     /old_locus_tag="AGR_C_144"
     CDS             98472..99086
                     /locus_tag="Atu0094"
                     /old_locus_tag="AGR_C_144"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85914.2"
                     /translation="MKIRAVCRGEAKSLPGKTTKTGIFKHAVNGPVMVDAEGIVSDAV
                     CNRKHHGGPDQAIYVMGSVDLDFWSSTLGSTVEPGFFGENLVLDGVDSAKLHVGDRFT
                     ANDVVLEVTAARIPCATLSARIGDPNFAPRFRQAGQSGFYCRVLKGGMLAAGEEVMFE
                     PYPGTKLPIPTILQRFRPMQLNEAERTAYLETPLASRFRAMLES"
     gene            complement(99146..99469)
                     /locus_tag="Atu0095"
                     /old_locus_tag="AGR_C_145"
     CDS             complement(99146..99469)
                     /locus_tag="Atu0095"
                     /old_locus_tag="AGR_C_145"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85915.1"
                     /translation="MRDIMGMMGKVKEMQSKMEKVQQEIAALEIEGRAGGGLVTVILN
                     GKGEMRGLKIDPSLFKEDEVEILEDLIVAAHKDAKEKGEAQAQEKMADLTAGLPLPPG
                     MKLPF"
     gene            complement(99494..101368)
                     /locus_tag="Atu0096"
                     /old_locus_tag="AGR_C_147"
     CDS             complement(99494..101368)
                     /locus_tag="Atu0096"
                     /old_locus_tag="AGR_C_147"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III, tau subunit"
                     /protein_id="AAK85916.1"
                     /translation="MSDTVPPKSSESQVGTGYRVLARKYRPKDFSDLMVGQEPMVRTL
                     TNAFETGRIAQAYMLTGVRGVGKTTTARILARALNYKTDTIDKPTIDLRIPGEHCQAI
                     MEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLSTQAFNGLL
                     KTLEEPPEHVKFIFATTEIRKVPITVLSRCQRFDLRRISAADLVGLFTAIAGKEGFEA
                     EPQALSMIARAAEGSARDGLSLLDQAIAHGGGRVEAEAVRGMLGLADRARIVDLFQHV
                     VKGDVAAALSEFNGQYEAGANPVVVLNDLADFTHLVTRMKYVPDAAEDPSLSEIERTR
                     GAEFAETIAVTALSRIWQMLLKGIPETENASRPAGAAEMVLIRLSHAANLPAPEDAAR
                     RLLELSSADGSYTNGGPSGGGNGGGARAYSSAQTVAAARPAEFAAPRQAGPQPSTMLR
                     AVPDSRPQEMQVAAPKTEERPEPKVPVNSLQDIADLCQKNRDPVMRAKVRNFVRLVRL
                     EPGRLDMRLGEGAPGSLPGELGVKLKEWTGIHWIVSLSKEQGEPTLVEAEGNARDARL
                     VDARQDPDVAAILAQFPGAKITDVRIRAAIQDEAEDITPPSVAESSEGDILPGDDIEF
                     "
     misc_feature    complement(101447..101544)
                     /note="Bacterial signal recognition particle RNA SRP_bact;
                     predicted by RFAM"
     gene            101634..102038
                     /locus_tag="Atu0097"
                     /old_locus_tag="AGR_C_148"
     CDS             101634..102038
                     /locus_tag="Atu0097"
                     /old_locus_tag="AGR_C_148"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85917.2"
                     /translation="METFRLDERLARDSVLVTRLGLCELRLQNDNRWPWLLLVPQRDG
                     VSELFDLTPLDQAVLTFETNLVASALKEITGATKINVGALGNIVRQLHVHIIARNEGD
                     TCWPGPIWGHGTAVPYAVGEKESLMKKISGAL"
     gene            102038..103000
                     /locus_tag="Atu0098"
                     /old_locus_tag="AGR_C_150"
     CDS             102038..103000
                     /locus_tag="Atu0098"
                     /old_locus_tag="AGR_C_150"
                     /codon_start=1
                     /transl_table=11
                     /product="mutT/nudix family protein"
                     /protein_id="AAK85918.1"
                     /translation="MMSMKIFETTAPHPEASLLTAFSKNALDRFAEKRTEECVAEALK
                     VDGTHIFAFSGNRLVLKHDEQVIDPLFSAYELAELQPDFDNAVLLGYRETGEPRIAVP
                     VAVAEDQLASHYKLADARTLYRDHLLDEELLSEVAQAVSLTHWNADNRFCGRCGGTME
                     QRIGGYKRICASCSHTIFPRTDPVVIMMTIDIERDLCLLGRGAHFASGMYSCLAGFVE
                     PGETIEQAVRRETHEESGVEIGRVRYHASQPWPMPHTLMIGCYAEALSSDIARDEIEL
                     EDCRWFTREEVAKMLEAPAGEGFSAPPIGAIAHRLMRDWVEWPE"
     gene            complement(103016..103879)
                     /gene="pheA"
                     /locus_tag="Atu0099"
                     /old_locus_tag="AGR_C_151"
     CDS             complement(103016..103879)
                     /gene="pheA"
                     /locus_tag="Atu0099"
                     /old_locus_tag="AGR_C_151"
                     /codon_start=1
                     /transl_table=11
                     /product="prephenate dehydratase"
                     /protein_id="AAK85919.1"
                     /translation="MNLITNRIAFQGEFGANSDMACRDMFPDMEPLPCPTFEDAFNAI
                     ENGEADLGMIPIENTLAGRVADIHHLLPESRLHIIGEYFMPIRFQLMVVPGVTKDEIR
                     TVHSHIHALGQCRKIIRSNGWKPVIAGDTAGSARLVSEKGDRSMAALAPRLAADLYGL
                     DILAENVEDSENNVTRFVVLSRDENWAKRQSSDEIVVTTFVFNVRNIPAALYKAMGGF
                     ATNGINMTKLESYQLGGKFVATQFYADIEGHPDDEPVRHALDELRFFSEKVRILGVYN
                     GHAMRGKLNQS"
     gene            complement(103891..104646)
                     /gene="kdsB"
                     /locus_tag="Atu0100"
                     /old_locus_tag="AGR_C_152"
     CDS             complement(103891..104646)
                     /gene="kdsB"
                     /locus_tag="Atu0100"
                     /old_locus_tag="AGR_C_152"
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-manno-octulosonate cytidylyltransferase"
                     /protein_id="AAK85920.1"
                     /translation="MKNRDFEKAVVLIPARMASTRLPGKPLADIGGRPMIVQVALRAR
                     EAGAERIVVAVDDEQVFAAVQNAGFDVMMTRGDHQSGSDRIFEALQKADPYGKAEYVI
                     NVQGDLPTIEAETIRASLRPMENAAVDIATLTVEITDEEEKTNPNVVKVVGSPLSETR
                     LRALYFTRTTAPYGDGPLYHHIGLYTYRRAALETFVRLPPSPLELRERLEQLRALEAG
                     MRIDAEIVRSVPLGVDTPHDLEKARKILAGRTL"
     gene            104797..105375
                     /gene="cycM"
                     /locus_tag="Atu0101"
                     /old_locus_tag="AGR_C_155"
     CDS             104797..105375
                     /gene="cycM"
                     /locus_tag="Atu0101"
                     /old_locus_tag="AGR_C_155"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c"
                     /protein_id="AAK85921.1"
                     /translation="MNSYVNMGVGALLGTVFVLMSVSIASEGIFHAPAPEKEGYTIVA
                     AESGGGEAGGGEAAAAATPIAKLLASADAAKGEAVFKKCTSCHTGESGGANKVGPNLF
                     DVVNRPIASHEGFSYSAGMKDFSKGASVHWDYDHLNYFLEAPKKHVPGTAMGFAGVKK
                     ETERADLIAYLRSLSANPAPLPDPNAAPAPMN"
     gene            complement(105470..106195)
                     /locus_tag="Atu0102"
                     /old_locus_tag="AGR_C_157"
     CDS             complement(105470..106195)
                     /locus_tag="Atu0102"
                     /old_locus_tag="AGR_C_157"
                     /codon_start=1
                     /transl_table=11
                     /product="exopolysaccharide production protein"
                     /protein_id="AAK85922.2"
                     /translation="MLGTKSSSHAVFYGAPYPAVPFETAEMQSPISDKKPSSLQRGQF
                     ALKRTIDIAGASIALVALAPVLATVALLVKLDSKGPVLFSQVRWGMNGRKIRVYKFRS
                     MQAELGDVTGVAQTVKNDPRITRIGAILRRTNIDELPQLINVLKGDMSLVGPRCHAVG
                     MLAAGRLYEELVPHYHMRHRMRPGITGLAQMRGLRGPTDRSDKARARIVSDLYYVENF
                     SVWLDIKIMVGTVISELRGGKGF"
     gene            complement(106484..108778)
                     /gene="pbpC"
                     /locus_tag="Atu0103"
                     /old_locus_tag="AGR_C_158"
     CDS             complement(106484..108778)
                     /gene="pbpC"
                     /locus_tag="Atu0103"
                     /old_locus_tag="AGR_C_158"
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein"
                     /protein_id="AAK85923.1"
                     /translation="MAGKGKSRERVEPSFGDFHESGDDLRLDASERISGASKQQAKKP
                     RPASGRTKSRKKEKRSRNSGRGVTGFIRSLFYWCIVLGIWGGIGVAGLVLYYGARMPS
                     ASSWSIPERPPNVKIVSVNGSVLANRGTTGGEALALEDMSPYIPQAVMAIEDRRFYSH
                     FGVDPLGLGRAIVTNVLTGRAVQGGSTLTQQLAKNLFLSPDRTLERKVQEVLLSFWLE
                     HEFTKDQILAMYLNRVYFGSNAYGVEAASRRYFNKSARDVNLGEAAMLAGLLKAPSRL
                     SPARDPQAAEERAQVVLQSMRDVGFITDDEIKTAMSQPPTKAKRFWSGAEHYAADMVL
                     EEVRGLVGEVKQDIVVDTTIDPNLERDAEKALTHVLQGDGKKQGASQAALVSIDGTGA
                     IRAVVGGADYAQSQFNRAVKAKRQPGSAFKPFVYVAALESGLTPYTIRNDGPVRIGNW
                     TPENYEKKYRGEVTLATALANSLNTIAAQLVMEVGPERVTQVAHRMGIESELQNNASI
                     ALGTSEVSLMELTASYAPFMNGGYKATPHIVKRITDADGKVLYENKYDNPPRVLSEEI
                     AATMNGMLSRVITEGTGKAARLQGWQAAGKSGTTQSFRDALFVGYTSNLTTGVWFGND
                     DGTSMKKVTGGGLPARAWKDFMTAAHSGLSPSPLFGLGAGGVPPLGDMQQPAPEAAPS
                     SIGEIISNALGGGTTDTRAYPDAPVSPNQPGMAMPPANIPSRDIEPGYQAGNGPVPPA
                     DIGGQAPAQSGPKQTTLLDILMGN"
     gene            complement(108895..109353)
                     /locus_tag="Atu0104"
                     /old_locus_tag="AGR_C_159"
     CDS             complement(108895..109353)
                     /locus_tag="Atu0104"
                     /old_locus_tag="AGR_C_159"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85924.1"
                     /translation="MSIESVRAFFIEKSPGVTVIETEGSSATVALAAEAHGVDPDQIA
                     KTICLKAGDTILLVVAAGTRRLDNRKFRDHFGAKPRMLGAEEVVAVTSHPIGGVCPFG
                     LPSALPVFCDISLKNYQEVVPAAGATNAAVKISPDVMVELTGAEWVDVCQ"
     gene            complement(109363..109557)
                     /locus_tag="Atu0105"
     CDS             complement(109363..109557)
                     /locus_tag="Atu0105"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAL41130.1"
                     /translation="MKLTDNWEEEYCQSNRATLGGGVRRFDDLKIQDTSLKNRRFIAA
                     QHCKKCIAISGRLEACPRSA"
     gene            109823..110032
                     /gene="cspA"
                     /locus_tag="Atu0106"
                     /old_locus_tag="AGR_C_161"
     CDS             109823..110032
                     /gene="cspA"
                     /locus_tag="Atu0106"
                     /old_locus_tag="AGR_C_161"
                     /codon_start=1
                     /transl_table=11
                     /product="cold shock protein"
                     /protein_id="AAK85925.2"
                     /translation="MATGTVKWFNATKGYGFIQPDDGSQDVFVHISAVERAGLTALND
                     GQKLSYELMQDRRSGKMSAGELVAS"
     gene            110062..110223
                     /locus_tag="Atu0107"
                     /old_locus_tag="AGR_C_162"
     CDS             110062..110223
                     /locus_tag="Atu0107"
                     /old_locus_tag="AGR_C_162"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK85926.2"
                     /translation="MNGEAGFFRPFSFERRAEQAGLEKAGVHTNIGFSSVSDENCQAG
                     ILKVPLLSC"
     gene            complement(110444..111835)
                     /locus_tag="Atu0108"
                     /old_locus_tag="AGR_C_165"
     CDS             complement(110444..111835)
                     /locus_tag="Atu0108"
                     /old_locus_tag="AGR_C_165"
                     /codon_start=1
                     /transl_table=11
                     /product="putative metalloprotease M20 family"
                     /protein_id="AAK85928.2"
                     /translation="MTDVSPILSNADDNLTSSLERLFELVRIPSISTDPAYKAECRKA
                     ADWLVRTLSALGFTASVRDTAGHPMVVAHHDAATKDAPHVLFYGHYDVQPVDPLELWE
                     NDPFEPAIKDIGAGRKVITGRGTADDKGQLMTFVEACRAYKAVNGVLPVRVTILFEGE
                     EESGSPSLKPFLDANAQELKADYALVCDTGMWDRDTPAIAAALRGLVGEEIVITAADR
                     DLHSGLFGGAAANPIHILTDILAGLHDETGRVTLAGFYDGVEEPPANIKASWETLGRS
                     AEAFLGEVGLSVPSGEKGRSVLEQTWARPTAEVNGIIGGYTGDGFKTVIAAKASAKVS
                     FRLVGEQNPAAIRDSFRAYVRSKIPADCSVEFHEHGASPAIQLSYDSPVLTKAKNALS
                     EEWPKPAVVIGMGGSIPIVGDFQKMLGMDSLLVGFGLTDDRIHSPNEKYELQSFHKGI
                     RSWVRILDALAAK"
     gene            complement(112000..112446)
                     /locus_tag="Atu0109"
                     /old_locus_tag="AGR_C_167"
     CDS             complement(112000..112446)
                     /locus_tag="Atu0109"
                     /old_locus_tag="AGR_C_167"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, MarR family"
                     /protein_id="AAK85929.2"
                     /translation="MDGRMGFSRDESAIYLAAKMAREFTMALQKRAAALGFSPGQFPI
                     LIELWHEEGLTQRQLLDRIDVEQATLANTLSRMERDGLIVRKSHPSDRRAQIIELTQR
                     GRDLEANAIAASEATEDTLLANFRRFERQLLLEYMRRAIESAKKAK"
     gene            complement(112724..113134)
                     /locus_tag="Atu8081"
                     /old_locus_tag="AGR_C_168"
     CDS             complement(112724..113134)
                     /locus_tag="Atu8081"
                     /old_locus_tag="AGR_C_168"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK85930.1"
                     /translation="MSKVSIFKAYFGAVFLTAIIAIAAWWQGDNATTIFHKALVVPLY
                     LLASTGLRSYFPEIFDSKRGILGTLEFHILNSAILAAFFILVLRPFPDDIGNQLVSFF
                     FLIAFTGTANFARAMHARKKNQYSDQTSPHLTDL"
     gene            113226..116222
                     /gene="polA"
                     /locus_tag="Atu0110"
                     /old_locus_tag="AGR_C_169"
     CDS             113226..116222
                     /gene="polA"
                     /locus_tag="Atu0110"
                     /old_locus_tag="AGR_C_169"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase I"
                     /protein_id="AAK85931.2"
                     /translation="MKKGDHLFLVDGSGFIFRAFHAIPPLNRKSDGLPVNAVSGFCNM
                     LWKLLKDARNTDVGVTPTHFAVIFDYSSKTFRNELYDLYKANRSAPPEDLVPQFGLIR
                     EATRAFNLPCIETEGFEADDIIATYARQAEAIGADVTIISSDKDLMQLVTANVHMYDA
                     MKDKQIGVPDVIEKWGVGPEKMIDLQAMTGDSTDNVPGIPGIGPKTAAQLLEEYGDLD
                     TLLARAGEIKQQKRRENIIANAELARLSRQLVALRTDVPLEQSLEELVLEPQNGPKLI
                     AFLKAMEFTTLTRRVAEATDSDASAIDPANVPVQWGADAHGPDLDAPAAAMAGDVSAE
                     GNNRPASAVAPAKRMIGEGSTPADLTTARQALFAATKIDTTAYTAIRDIATLDLWIAA
                     AREAGVVAFDTETTSLDPMQAELVGFSLAIADNGKDASGTDIRAAYVPLTHKTGSGGD
                     LFSDGIKLAEGQAPFAEALERLKDLLEDEAVLKVAQNLKYDYLLMKRHGVVMRSFDDT
                     MLISYVLEAGKTTHGMDTLSERWLGHTPIAYKDVTGSGKSSITFDFVNIDKATAYAAE
                     DADVTLRLWMALKPRLVSERLTKVYERLERPLVPVLAHMEERGITVDRQILSRLSGEL
                     AQKAASFEEEIYELAGERFNIGSPKQLGDILFGRMGLPGGSKTKTGQWSTSAQVLEDL
                     AAEGAELPRKIVDWRQLTKLKSTYTDALPSYIHPETKRVHTSYALASTTTGRLSSSEP
                     NLQNIPVRTAEGRKIRTAFISTPGHKLLSADYSQIELRVLAHVADIPQLRNAFENGID
                     IHAMTASEMFGVPVEGMPSEVRRRAKAINFGIIYGISAFGLANQLSIARSEAGDYIKK
                     YFERFPGIRDYMEATKAFARENGYVETIFGRRAHYPEIRSSNPSVKAFNERAAINAPI
                     QGSAADIIRRAMIRIEPALEAEKLSARMLLQVHDELIFEVEEAEIEKTLPVVVSVMED
                     AAMPAISMRVPLKVDARAADNWDEAH"
     gene            116299..117018
                     /locus_tag="Atu0111"
                     /old_locus_tag="AGR_C_171"
     CDS             116299..117018
                     /locus_tag="Atu0111"
                     /old_locus_tag="AGR_C_171"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85932.1"
                     /translation="MHAPLVSKDLDYISTANHDQPPRHLGSRFSAEGEFLPEPGNTVV
                     CHLVEGSQTESAIVSTRQRFLDMPEASQLAFTPVSSLHMTVFQGVIESRRALPYWPQT
                     LPLDTPIDAVTDYYRDRLSTFPTLPAFNMRVTGLRPVGMVMKGATAEDDSIVALWRDT
                     FADFFGYRHPDHDTYEFHITLSYIVSWFEPECLPRWQAMLDEELEKLRVAAPVIQMRP
                     PAFCEFKDMNHFKELVVFDKR"
     gene            117212..117397
                     /gene="rpmF"
                     /locus_tag="Atu0112"
                     /old_locus_tag="AGR_C_173"
     CDS             117212..117397
                     /gene="rpmF"
                     /locus_tag="Atu0112"
                     /old_locus_tag="AGR_C_173"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L32"
                     /protein_id="AAK85933.2"
                     /translation="MAVPKRKTSPSKRGMRRSADGLKSATYVEDKNSGELRRPHHIDL
                     KTGMYRGRQVLTPKESA"
     gene            117518..119386
                     /locus_tag="Atu0113"
                     /old_locus_tag="AGR_C_174"
     CDS             117518..119386
                     /locus_tag="Atu0113"
                     /old_locus_tag="AGR_C_174"
                     /codon_start=1
                     /transl_table=11
                     /product="two component sensor kinase"
                     /protein_id="AAK85934.2"
                     /translation="MESGFEACGRRGVSVKYRWILLMFLGLGLGYGAVTRGGGIIAES
                     YFGEMSDQGHTTLRLAVSALGGLLSRYEPLPALIADHDDIEELVAHPKDEALRQRANV
                     YLKSINTLLESSDIYIITLDGETIAASNYDGPTSFVGENFSYRPYFQDAAKGLKSRFF
                     ALGTTSHKRGYYFSAPILFNEEIKGVIVFKVDIEGIEASFGDGENRILVSDPEGIIFM
                     TGTPQWLYSGLMPLTPERLARTEASRRYANATLTELPLKNGNFGSHQLMTIAQNDGDR
                     EYMVLSQPMQDAGWTVSVLMDTGSLRTQVKTAMIAIILCLCLAAALIAAMLQRRRRLR
                     ERLTHQAEAQAELERRVEERTADLARVNQEIKHEIAERRQTEKQLRKMQNDLVQAGKL
                     AALGQMSAALSHEFNQPLAAAKNYAENASLLVERGRLEEVTENLRRISGLIDRMASIS
                     KHLRNFARKPNEKTAAVGLETVIRDTLEIVGPRLKAADAMLDIDLGPVPLAVKAGPVR
                     LQQVLVNIISNAADAVEGREDRRISLQTVQHGQAVSIFIRDHGPGVPAAISERIFDPF
                     FTTKGVGRGLGLGLSISYNIIKDFGGQLRVKNHEESGAEFEIELPAAAWRTEAAAE"
     gene            119383..120729
                     /gene="dctD"
                     /locus_tag="Atu0114"
                     /old_locus_tag="AGR_C_178"
     CDS             119383..120729
                     /gene="dctD"
                     /locus_tag="Atu0114"
                     /old_locus_tag="AGR_C_178"
                     /codon_start=1
                     /transl_table=11
                     /product="two component response regulator"
                     /protein_id="AAK85935.2"
                     /translation="MTMSRVLLIDDEEELRFSTAQALELSGFAVTMLASAEHALELIG
                     YSFDGVVVSDIRMPGMDGMTLLQKVRELDPEIPVILMTGHGDVQLAVNAMRNGAYDFI
                     EKPFTPQYLAGIIKRANDRRALVLENRRLKAVAGKHDDLETRLPGRTQVMVDLRYRIR
                     AIGATDADTLIVGDTGAGKEVVARALHDISARANRPFVAINCAALPQTLIESELFGHE
                     AGAFPGALRSRYGKFEHARGGTILLDEIGSMPFELQGRFLRVLQERVITRLGSNETVE
                     LDVRFIATSKVDLEQEVAAGRFRADLLYRLNVATLLVPSLSQRSADIPLLFLHLVREA
                     AARYGREDMDVPQHLLSAVSLREWPGNVRELRNAADRFVLGLESDVSEVSLALDDDGT
                     STLAPRVAAYEKSLIAHAIAVHGGNLKSVYESLGISRKTLYEKMQKYGLHRHMTEV"
     gene            120729..120932
                     /locus_tag="Atu0115"
     CDS             120729..120932
                     /locus_tag="Atu0115"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAL41140.1"
                     /translation="MGGFPPMDEALWVEIHPLPSIDSDKSGWREESAVAERRSRIANT
                     VTPAAMEEHARLKWRSFSSGRNR"
     gene            121502..121912
                     /locus_tag="Atu0116"
                     /old_locus_tag="AGR_C_180"
     CDS             121502..121912
                     /locus_tag="Atu0116"
                     /old_locus_tag="AGR_C_180"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85936.2"
                     /translation="MTDLLGGQVDIMCDQTTNTTKQIQGGTVKAYAVTTAKRLDVLPD
                     VPTVVEAGLPKLEVGIWHGIYTPKGTPAEINEKLSKSLQVALKDKNVAARFAELGTTP
                     SSESDATPAALKAKLESEIARWKPVIESAGQYAD"
     gene            122012..122473
                     /locus_tag="Atu0117"
                     /old_locus_tag="AGR_C_182"
     CDS             122012..122473
                     /locus_tag="Atu0117"
                     /old_locus_tag="AGR_C_182"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85937.1"
                     /translation="MKSLFNDPAEAICGAIFMGLGVFFALQSYGLEIGTAFRMGPGYF
                     PLVLAIILILLGGIIFLRSARPAGEGIGAIAWRGIFFILPAPIFFGFTVRGLGFVPAL
                     FFSALIASFASHKMSPLMAVILSAAITVFSVAVFNYGLGLPFQRFGPWLKF"
     gene            122483..123988
                     /locus_tag="Atu0118"
                     /old_locus_tag="AGR_C_184"
     CDS             122483..123988
                     /locus_tag="Atu0118"
                     /old_locus_tag="AGR_C_184"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85938.1"
                     /translation="MDLLNNLALGFVTASSLANLFFCLIGVLLGTLIGVLPGIGATAT
                     IAMLLPITFQLEPVSSLIMLAGIYYGAQYGGSTTAILINMPGESSSAVTAIDGYQMAR
                     KGKAGAALAIAAIGSFFAGTVSTFLVAIFAPPLTAIALEFGAAEYFSLMVVGLVSSIA
                     LAHGSIVKALAMVVLGLLLGLVGTDIYSGTPRFTLGIREYADGLNFVAVAVGVFGIAE
                     ILRNLENERTRSVLIAKVSSLMPSKEDFKAMIGPVLRGTAIGSALGILPGGGAILAAF
                     ASYTVEKRVSKNPEEFGHGAVAGVAGPESANNAGAQTSFIPLLTLGIPANPVMALMIG
                     AMIIQGIVPGPNVATEQPALFWGIIASMWIGNLMLVILNLPLIGLWVKLLTVPYYVLF
                     PIIMAFCAIGVYSVNSNVFDLYAVAFFGFIGYVLVKLRCEPAPLLLGFVLGPLLEENL
                     RRAMILSRGDPTTFVTRPISATLLFIALAVLIIVFLPSVKKKREEVFVEED"
     gene            124135..124347
                     /locus_tag="Atu0119"
                     /old_locus_tag="AGR_C_187"
     CDS             124135..124347
                     /locus_tag="Atu0119"
                     /old_locus_tag="AGR_C_187"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85939.2"
                     /translation="MTSETEKRIIALEETIAHQAKTIEELSDQLAEQWKVVEQTRAKL
                     DRLTERFLSLEEQSLDAPAITRPPHY"
     gene            124361..124912
                     /locus_tag="Atu0120"
                     /old_locus_tag="AGR_C_189"
     CDS             124361..124912
                     /locus_tag="Atu0120"
                     /old_locus_tag="AGR_C_189"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85940.1"
                     /translation="MKNDTAALAADIVDFWKKAGPDKWFDKDAAFDNHFHDRFRDAHF
                     AAARRELDGWLEGAESSLALMLLLDQFPRNCFRGTAHMYATDPLARFFADEAIRRGHD
                     QAVSEDLRVFFYLPFSHAEDIAAQQRACDLNQPLGGLYLHHAEEHRDIVERFGRFPHR
                     NGILLRETTPEERQYLEEGGFSG"
     gene            complement(124981..126114)
                     /gene="dnaJ"
                     /locus_tag="Atu0121"
                     /old_locus_tag="AGR_C_192"
     CDS             complement(124981..126114)
                     /gene="dnaJ"
                     /locus_tag="Atu0121"
                     /old_locus_tag="AGR_C_192"
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone, DnaJ family"
                     /protein_id="AAK85941.1"
                     /translation="MAKADFYETLGVSKTADEKELKSAFRKLAMKFHPDKNPDDADSE
                     RKFKEINEAYETLKDPQKRAAYDRFGHAAFENGGMGGGGMGGGGFANGGFSDIFEDIF
                     GEMMGGGRARRSSGGRERGADLRYNMEITLEEAFAGKTAQIRVPTSITCDVCSGSGAK
                     PGTQPKTCATCQGSGRVRAAQGFFSVERTCPTCHGRGQTISDPCGKCHGQGRVTEERS
                     LSVNIPSGIEDGTRIRLQGEGEAGMRGGPAGDLYIFLSVRPHEFFQRDGADLYCTVPI
                     SMTTAALGGTFDVTTLDGTKSRVTVPEGTQPGKQFRLKGKGMPVLRSAQTGDLYIQIQ
                     IETPQKLSKRQRELLQEFEQLSSKENNPESTGFFARMKEFFDG"
     gene            complement(126205..128106)
                     /gene="dnaK"
                     /locus_tag="Atu0122"
                     /old_locus_tag="AGR_C_195"
     CDS             complement(126205..128106)
                     /gene="dnaK"
                     /locus_tag="Atu0122"
                     /old_locus_tag="AGR_C_195"
                     /codon_start=1
                     /transl_table=11
                     /product="DNAK Protein"
                     /protein_id="AAK85942.1"
                     /translation="MAKVIGIDLGTTNSCVAVMDGKDTKVIENAEGARTTPSMVAFSD
                     DGERLVGQPAKRQAVTNPTNTLFAVKRLIGRRYEDPTVEKDKALVPFEIVKGDNGDAW
                     VKAQDKNYSPSQISAMILQKMKETAESYLGEKVEKAVITVPAYFNDAQRQATKDAGRI
                     AGLDVLRIINEPTAAALAYGLDKKEGKTIAVYDLGGGTFDISVLEIGDGVFEVKSTNG
                     DTFLGGEDFDMRLVEYLAGEFKKDQGIDLKNDKLALQRLKEAAEKAKIELSSSQQTEI
                     NLPFITADASGPKHLTLKLTRAKFESLVDDLVQRTVAPCKAALKDAGVTAAEIDEVVL
                     VGGMSRMPKVQEVVKQLFGKEPHKGVNPDEVVAMGAAIQAGVLQGDVKDVLLLDVTPL
                     SLGIETLGGVFTRLIDRNTTIPTKKSQTFSTAEDNQSAVTIRVSQGEREMAQDNKLLG
                     QFDLVGLPPSPRGVPQIEVTFDIDANGIVQVSAKDKGTGKEQQIRIQASGGLSDADIE
                     KMVKDAEANAEADKKRRAGVEAKNQAESLIHSTEKSVKEYGDKVSETDRKAIEDAIAS
                     LKTAVEAAEPDADDIQAKTQTLMEVSMKLGQAIYEAQQAEAGDASAEGKDDVVDADYE
                     EIKDDKKSA"
     gene            complement(128413..128502)
                     /locus_tag="Atu0123"
     tRNA            complement(128413..128502)
                     /locus_tag="Atu0123"
                     /product="tRNA-Ser"
     gene            128724..129041
                     /locus_tag="Atu0124"
                     /old_locus_tag="AGR_C_196"
     CDS             128724..129041
                     /locus_tag="Atu0124"
                     /old_locus_tag="AGR_C_196"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK85944.2"
                     /translation="MKAFLRFLSFLLLIAAIFLGVLDSIRSVSTSSVNITGILSVWNY
                     LLPASRTMVEAALAHYIHPEAWRFFENALSGVPAFALFLALSLLCWMAGYRKRKVMRR
                     SSV"
     gene            129114..129764
                     /gene="msrA"
                     /locus_tag="Atu0125"
                     /old_locus_tag="AGR_C_197"
     CDS             129114..129764
                     /gene="msrA"
                     /locus_tag="Atu0125"
                     /old_locus_tag="AGR_C_197"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide methionine sulfoxide reductase"
                     /protein_id="AAK85945.2"
                     /translation="MFLFDTLSKKTTMPTEETALPGREEALAVPETHFVNGRPLKGPY
                     PDGLEIIYLGMGCFWGAERLFWKTPGVWVTAVGYAGGFTRNPTYHETTTGQTGHAEVV
                     KVVYDPAVISLSGLLKIFFEEHDPTQGMRQGNDVGTTYRSAIYATTEGQLQQAQKARD
                     AFQQALDEAGHGHAITTEIGPLETFYYAEDYHQQYLAKNPGGYCGLRGTGVSCNIG"
     gene            129978..130970
                     /locus_tag="Atu0126"
                     /old_locus_tag="AGR_C_200"
     CDS             129978..130970
                     /locus_tag="Atu0126"
                     /old_locus_tag="AGR_C_200"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane lipoprotein"
                     /protein_id="AAK85947.2"
                     /translation="MKKSLLTLFALAAMSASALAADIKPALVYGTGGKFDKSFNEAAA
                     AGAEKFKAETGIDFRDFEPTSDTQGEQAIRNFASKGFNPVVAVSFAWTSAMEKVAAEF
                     PDTKFVIVDSVVELPNVRSVVYKEHEGSYLVGLLAGMASKTGKVGFIGGMDIPLIRKF
                     ACGYAQGAKAANDKIEVFQNMTGTTGAAWNDPVRGGELTKNQIDQGADVIYAAAGATG
                     IGVLQTAADNKKFSIGVDSNQNHLHPGSVLTSMVKRVDLAVYNAYKDAKDDKFTPGIV
                     ALGVKEDGVAYALDDNNKALITPEMTAAVDKAKADIIAGTVKVHDYMADNSCPK"
     gene            131053..132558
                     /locus_tag="Atu0127"
                     /old_locus_tag="AGR_C_202"
     CDS             131053..132558
                     /locus_tag="Atu0127"
                     /old_locus_tag="AGR_C_202"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, nucleotide binding/ATPase
                     protein (sugar/ribonucleotide)"
                     /protein_id="AAK85948.2"
                     /translation="MDPAIELMGIDKKFGAVHANKNINLSVAKGTIHGIIGENGAGKS
                     TLMSILYGFYQADAGEIRVNGKPVTIRDSQAAISAGIGMVHQHFMLVENFTVLENVML
                     GAEGGALLARGRAGARRELKRLEDDYGLEVDPDAVIEELPVGLQQRVEILKAMYRGAE
                     ILILDEPTGVLTPAEADHLFKILGVLREQGKTIILITHKLREIMAITDSVSVMRRGEM
                     VATRKTSETSVEELAELMVGRRVLLRVEKGETTPGDVLLSIRNLTVKDSRGVTMVDDV
                     SLDVRAGEIVGIAGVAGNGQSELLEAIAGIRKPYSGEIWVDGQKVDRPDPAILRKLGL
                     AHIPEDRHHMGLVLKFEEYENSILGYHHDERYGKGPFLNPEAIRKDAVEKIEKYDIRP
                     PNPQLKTANFSGGNQQKIVVAREIERDPKMLIIGQPTRGVDIGAIEFIHRRIIEMRDA
                     GKAILLVSVELDEIRSLSDRIMVMFAGRVVGEKTAEAEEQTLGLMMAGIAA"
     gene            132566..133669
                     /locus_tag="Atu0128"
                     /old_locus_tag="AGR_C_205"
     CDS             132566..133669
                     /locus_tag="Atu0128"
                     /old_locus_tag="AGR_C_205"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, membrane spanning protein
                     (sugar/ribonucleotide)"
                     /protein_id="AAK85949.1"
                     /translation="MSTASTPLPNWISYGLLPLLNVVTAFLISGLVVWSIGENPLAAL
                     RLLIEGALGRGDAIGFTLFYTTSFIFTGLSVAVAFHAGLFNIGSEGQAYVGGLGAALV
                     ALALDRYVPWYVTMPFAVIGAAVFGAAWAFIPAWLQAKRGSHVVITTIMFNFIAAALM
                     VYLLVNVLIVPGKMAPETRTFLPGGQLPKLDWLMAWFGLKLGPAPFNVSFLIALVMCF
                     LVWVLIWRTKLGYEMRTLGVSPSAAIYAGIPYSRTVIIAMLISGGLAGMMALNPVMGA
                     SARLQVEFVGGAGFVGIAVSLMGRSHPLGIIFSALLFGILYQGGADLSFEMPNITREM
                     IVVIQGLVILFAGALEYMYRPAIVHIYQRLAKG"
     gene            133676..134647
                     /locus_tag="Atu0129"
                     /old_locus_tag="AGR_C_207"
     CDS             133676..134647
                     /locus_tag="Atu0129"
                     /old_locus_tag="AGR_C_207"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, membrane spanning protein
                     (sugar/ribonucleotide)"
                     /protein_id="AAK85950.1"
                     /translation="MDFFDMLVSILGSTVRLTIPLLFTALAGLFSERAGVFDIGLEGK
                     MLAAAFASACVAYLTANPWAGLLAGIGVSILFSLIHGFAVITNRGNQIVSGVALNFIA
                     AGLTVVLGQAWFGQGGRTPQLPGEGRFAPIILPGADAMREVPFIGPLYANVISGNNIL
                     TYLAFLAVPLSWWVLYRTRFGLRLRAVGENPGAVDTAGISVTWMRYRAVIVAGFLCGF
                     SGAYLAVAQSAAFIANMSAGKGYIALAALIFAKWKPVPVMFACLLFGFLDAFANFMQG
                     KSVPGIGEVPVQIFQAMPYILTCILLAGFIGVAKPPKAGGVAYAKER"
     gene            134652..135056
                     /gene="cdd"
                     /locus_tag="Atu0130"
                     /old_locus_tag="AGR_C_209"
     CDS             134652..135056
                     /gene="cdd"
                     /locus_tag="Atu0130"
                     /old_locus_tag="AGR_C_209"
                     /codon_start=1
                     /transl_table=11
                     /product="cytidine deaminase"
                     /protein_id="AAK85951.2"
                     /translation="MSSDPKSHALFEAAVEAMAFAYAPYSKFPVGAAIRAEDGKIYTG
                     ANIENISFPQGWCAEPSAISAMIMGGAKKISEVAVIAEKLPLCSPCGGCRQKIAEFAT
                     PETKIYLCDETGVQKVMTMEELLPSVFKTELP"
     gene            135056..135856
                     /gene="deoD"
                     /locus_tag="Atu0131"
                     /old_locus_tag="AGR_C_210"
     CDS             135056..135856
                     /gene="deoD"
                     /locus_tag="Atu0131"
                     /old_locus_tag="AGR_C_210"
                     /codon_start=1
                     /transl_table=11
                     /product="purine nucleoside phosphorylase"
                     /protein_id="AAK85952.1"
                     /translation="MTDGLIDILVERLNGLMPRVAIVLGSGLGSLVEEVSDPIRVPYA
                     NLPGFPTSGVSGHAGELVAGYLGGEPVMMLSGRVHYYEKGDPAAMRAVIEALAGLGVQ
                     SLILTNSAGSVRQDMPPGSVMQITDHINYSGMNPLIGEESDRRFVGMTTAYDPDLMLA
                     MRNAAIRATVPLFGGVYMWFSGPSFETPAEIRMARVLGADAVGMSTVPEVILARFFGM
                     RVAAASVITNYGAGMTGAELSHEETKDMAPVGGKRLAAILKEMIAGGA"
     gene            135859..136632
                     /gene="deoC"
                     /locus_tag="Atu0132"
                     /old_locus_tag="AGR_C_211"
     CDS             135859..136632
                     /gene="deoC"
                     /locus_tag="Atu0132"
                     /old_locus_tag="AGR_C_211"
                     /codon_start=1
                     /transl_table=11
                     /product="2-deoxyribose-5-phosphate aldolase"
                     /protein_id="AAK85953.2"
                     /translation="MELQRPREAAALTLSLLDLTNLREDCTPQQIATLCQRAHTEFGN
                     TAAICIWPRFVAQARAAFGKDHTIRIATVVNFPSGDLDVATVVAETEAAIGDGADEID
                     LVIPYRKFMAGDESAVAEMIAAVRKACAAPVLLKVILETGELKDKALIRRASEIAIAE
                     GADFIKTSTGKVAVNATLEAADIMLQAIRDSKKKVGFKPAGGIGTVEDATLYLRLAET
                     IMAPNWAMPSTFRFGASGVLDDVLNVLAGGEPAKAASGY"
     gene            136629..137945
                     /gene="deoA"
                     /locus_tag="Atu0133"
                     /old_locus_tag="AGR_C_214"
     CDS             136629..137945
                     /gene="deoA"
                     /locus_tag="Atu0133"
                     /old_locus_tag="AGR_C_214"
                     /codon_start=1
                     /transl_table=11
                     /product="thymidine phosphorylase"
                     /protein_id="AAK85954.1"
                     /translation="MSLIPQEIIRRKRDGLSLAPQEIAAFIEALSKDGISEGQAAAFA
                     MAVFFRGMNRDEMVALTLAMRDSGDVLSWRDIGRPVADKHSTGGVGDNVSLMLAPIVA
                     ACGLAVPMISGRGLGHTGGTLDKLEAIPGYDVMPDEALFRRTVQSVGCAIIGQTGDLA
                     PADKRLYAIRDVTATVDSIPLITASILSKKLAAGLETLVLDVKVGNGAFMQSLEDARI
                     LARALVDVANGAGLPTTALITDMNQPLCDAAGNAVEIVNCLEFLAGGKAGTRLEKVVL
                     SFAAEMLVQARKAATLEEGEALASAALSSGRAMEIFARMVSVLGGPSDFIENPSRYLA
                     CAPIILPVPAARSGWLASCATRDLGMVVVELGGGRTKPSDTINPAVGISDILPLGVRV
                     EKGEPIAVVHAASSEDAERAVKRIEDCFGIADNAPEIAASVLERIT"
     gene            complement(137938..138474)
                     /locus_tag="Atu0134"
                     /old_locus_tag="AGR_C_215"
     CDS             complement(137938..138474)
                     /locus_tag="Atu0134"
                     /old_locus_tag="AGR_C_215"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85955.2"
                     /translation="MRSNHLLARAIFLLVGLSVSATQIPALMEKFQPHPETGAAKSGA
                     TAEASRPQPVSLGSVSLKADERGHFNATFRINGKSFDGLVDTGASMVAINETMARRLG
                     YGVNSLDFKYAISTANGQTLAAHVKLDRVEIGAIRVQNVDTMVLKDNALSNMLVGMSF
                     LKQLSSFKVSGGEMRLVR"
     gene            complement(138594..139223)
                     /gene="upp"
                     /locus_tag="Atu0135"
                     /old_locus_tag="AGR_C_216"
     CDS             complement(138594..139223)
                     /gene="upp"
                     /locus_tag="Atu0135"
                     /old_locus_tag="AGR_C_216"
                     /codon_start=1
                     /transl_table=11
                     /product="uracil phosphoribosyltransferase"
                     /protein_id="AAK85956.1"
                     /translation="MDGVTVIEHPLVRHKLTIMRKKETSTAGFRRLLREISTLLCYEV
                     TRDLEMTMETIDTPLETIQAPVLEGKKLVFASILRAGNGLLEGMLELVPSARVAHVGV
                     YRDHDTLEAVEYYFKAPESLDARLVIVVDPMLATGNSSIAAVEKLKERGAKNIRFLCL
                     LAAPEGIKNFREAHPDVPIYTAAIDRHLNEKGYIVPGLGDAGDRMYGTK"
     gene            complement(139319..140296)
                     /gene="add"
                     /locus_tag="Atu0136"
                     /old_locus_tag="AGR_C_218"
     CDS             complement(139319..140296)
                     /gene="add"
                     /locus_tag="Atu0136"
                     /old_locus_tag="AGR_C_218"
                     /codon_start=1
                     /transl_table=11
                     /product="adenosine deaminase"
                     /protein_id="AAK85957.1"
                     /translation="MTSHLLKAEIHCHLEGAAPPALVVKQAEKYGIDTSGFLRDGQYV
                     WSDFAEFIQCYDAVAQVFKSDEDYAVLTETYLTELAEANTIYSELIISPDHGDRIGLG
                     ADAYLAGVAEGIRIAKEKTGIETRIIVTGERHFGPERVIAAAEYAARIRHPLVTGFNM
                     AGEERMGRVADYARAFDIARDAGLGLTIHAGEVCGPESVADALDLVKPSRIGHGVRAI
                     EDAALISRLVETGTVLEVCPGSNIALSVYPDFASHPLKALSDAGVRVCISSDDPPFFF
                     TSLAREYALAADAFGFNDAEINRMTRTALECAFVDEATRERLLARLGDA"
     gene            complement(140293..141513)
                     /gene="drm"
                     /locus_tag="Atu0137"
                     /old_locus_tag="AGR_C_219"
     CDS             complement(140293..141513)
                     /gene="drm"
                     /locus_tag="Atu0137"
                     /old_locus_tag="AGR_C_219"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopentomutase"
                     /protein_id="AAK85958.1"
                     /translation="MARAFLLVLDSFGVGGAPDAERYGDLGANTLGHIAEFCAAGAAD
                     RAGLRAGPLKLPNMCSLGLLEIARQASGDIPAGMEPPERIFGLHGSASEISKGKDTPS
                     GHWEIAGTPVTFDWGYFPTEGDAFSPELVEAICRQADIPGILGNCHASGTEIIAALGE
                     EHIRSGKPICYTSSDSVFQIAAHETHFGLDRLIALCETVRKLLDPLNIGRVIARPFIG
                     ETVATFERTGNRRDFSVPPPEPTLLDRLVEAGRKVHAIGKIGDIYAHQGVTRVIKANG
                     NAALMDATLHAIDEAENGDLVFTNFVDFDMLYGHRRDVAGYAAALEAFDARIPEIHRK
                     MAPGDIALLTADHGCDPTWRGTDHTRERVPIMAFGPGIRSRDVGIRSSYADIGESIAH
                     HLGIEAGSHGRSFI"
     gene            complement(141629..142459)
                     /gene="surf"
                     /locus_tag="Atu0138"
                     /old_locus_tag="AGR_C_221"
     CDS             complement(141629..142459)
                     /gene="surf"
                     /locus_tag="Atu0138"
                     /old_locus_tag="AGR_C_221"
                     /codon_start=1
                     /transl_table=11
                     /product="surfeit 1"
                     /protein_id="AAK85959.2"
                     /translation="MRAERGPPKQTISLPVALRKDRDMSEIAPQNRRIRPAAIVVLFL
                     TIALTGCLLALGTWQVQRLFWKLDLIERVDVRAHAEPVDAPAASDWPALGNPSDYEYR
                     RVKLTGTLLNDREVQVYTVTDLGPGYWVMTPLRRDDGSSIIVNRGFVPSDRRDPSSRT
                     GGEPTGNVEIVGLMRAPETGGLFLRTNDPANGRWYSRNIPQITQASGLSDVAPFYVDA
                     DATPNPGGLPVGGKTMLTFPNNHLSYAVTWYILAAMVVAAGWYVLRNLNAPKSKRDAD
                     "
     gene            complement(142569..142961)
                     /gene="cyoD"
                     /locus_tag="Atu0139"
                     /old_locus_tag="AGR_C_223"
     CDS             complement(142569..142961)
                     /gene="cyoD"
                     /locus_tag="Atu0139"
                     /old_locus_tag="AGR_C_223"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome o ubiquinol oxidase subunit IV"
                     /protein_id="AAK85960.2"
                     /translation="MSSEAHAHHDAHGDDHHHDGASHGTFKSYMIGFVLSVILTAIPF
                     WLVMGGVLENKTLLVIAIMGLGVIQIFVHMIYFLHMDTRSEGGWTFMALIFTVVVLLI
                     TLSGSLWVMYNMNKNMMPLHIEDVKNLP"
     gene            complement(142961..143587)
                     /gene="cyoC"
                     /locus_tag="Atu0140"
                     /old_locus_tag="AGR_C_225"
     CDS             complement(142961..143587)
                     /gene="cyoC"
                     /locus_tag="Atu0140"
                     /old_locus_tag="AGR_C_225"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome o ubiquinol oxidase subunit III"
                     /protein_id="AAK85961.1"
                     /translation="MAHTPAQSVDGAEPPVFYLKEDHHPENGTSIGFWLYLMSDCLIF
                     AVLFATYAVLGRSYAAGPSGADLFDLKLVAINTGFLLLSSITYGFAMLEMEKQKVKST
                     LIWLGITGLFGLAFLAVELYEFHHLIEEGAGPQRSAFLSAFFALVGTHGLHVTFGTIW
                     LVTLMVQVAKHGLIAANKRRLMCLSMFWHFLDVIWIGVFSFVYLMGVL"
     gene            complement(143594..145597)
                     /gene="cyoB"
                     /locus_tag="Atu0141"
                     /old_locus_tag="AGR_C_227"
     CDS             complement(143594..145597)
                     /gene="cyoB"
                     /locus_tag="Atu0141"
                     /old_locus_tag="AGR_C_227"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome O ubiquinol oxidase subunit I"
                     /protein_id="AAK85962.1"
                     /translation="MIVNSDQTSFLFGKLTWESIPLHEPILVATFAAVALGGIVVVGA
                     LTYFRLWGYLWNEWFTSIDHKKIGIMYIILALVMLLRGFADAIMMRVQQAIASGGSEG
                     YLPPHHYDQIFTAHGVIMIFFMAMPMITGLMNFVVPLQIGARDVSFPFLNNFSFWMTT
                     AGAIITMISLFVGEYAQTGWLAYPPLSGIDGSPGVGVDYYIWGLQIAGVGTTLSGINL
                     IVTIIKMRAPGMTMMRMPIFVWTSLCSNILIVASFPILTATLALLTLDRYAGTNFFTN
                     DLGGNPMMYVNLIWIWGHPEVYILVLPAFGIFSEIVATFSGKRLFGYASMVYATAVIT
                     ILSYLVWLHHFFTMGSGANVNAFFGITTMIISIPTGAKIFNWLFTMYKGRIKFDVPML
                     WTIGFMITFVIGGMTGVLLAVPPADFVLHNSLFLIAHFHNTIIGGVVFGVLAGIVYWF
                     PKAFGYRLDPFWGKLSFWFWFIGFYFAFMPLYILGLMGITRRISQFEDNSLQIWFVIA
                     AFGAFLIALGIASFIIQLIVSFLKRDQLRDVTGDPYNARTLEWSTSSPPPQYNFAFTP
                     VIHDVDAWHDMKKRGYSRPLDGFIPIHMPKNTGAGVIISAISVVLGFALVWHIWWLAA
                     LSFIGVIAVSIAHTFNYNRDYYIPASDVSTVEAERTKLLAKQA"
     gene            complement(145674..146672)
                     /gene="cyoA"
                     /locus_tag="Atu0142"
                     /old_locus_tag="AGR_C_230"
     CDS             complement(145674..146672)
                     /gene="cyoA"
                     /locus_tag="Atu0142"
                     /old_locus_tag="AGR_C_230"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome o ubiquinol oxidase subunit II"
                     /protein_id="AAK85963.2"
                     /translation="MNPSGDVAIQQRDLIITSTVLMLLIIVPVIVLTLFFAWKYRESA
                     KAEDYDPEWHHSTRLEMVIWSAPVAIILMLGTVTWISTHRLDPYRPLERIDENRQVTA
                     DIKPITVEVVAMDWKWLFFYPELGIGSVNEFAAPVDVPINFKITGTTAMNSFFVPALA
                     GQIYAMGGMQTKLHAVINKEGVYDGISANFSGPGFSHMRFKFHGLSQQGFDQWVAKVK
                     EGGKGFGRQEYLEFAKPSEREPVQYFASVDPELYSAILNRCVEPNKLCMRDMMHIDAN
                     GGGGKEGIDIAKALNSVVCTPLAPYGVASGPQSTPAAIKGQTFEPAALPETKQVAG"
     gene            147053..148375
                     /locus_tag="Atu0143"
                     /old_locus_tag="AGR_C_231"
     CDS             147053..148375
                     /locus_tag="Atu0143"
                     /old_locus_tag="AGR_C_231"
                     /codon_start=1
                     /transl_table=11
                     /product="MFS permease"
                     /protein_id="AAK85964.1"
                     /translation="MSYTNAAPSFGQAPEANGAGPTSVDPDRITIAVILARMTEFFDF
                     FIYAIASALVFPHVFFSFVDPLTATLYSFAVFSLAFIARPIGSLIFLQIDRKFGRAVK
                     LMAALFTLCGSTMAISFLPSYDEAGMLAPCLLAAFRIGQGLGLGGAWDGLVSLLAMNA
                     PQKQRGWYAMMPQIGAAMGFGLASAFFIVFVTQLSNAEFLAWGWRFPFFVALALNVLA
                     LFARLRMIVTPEFQAMLEQHELEPRPMFRMLRSQFPVVLTGAFVPLASFALFHLVTVF
                     PLSWVSLNTSQRVSDFLFVQFVSAIICGGMIVVSGILADRIGRRKLLAIAAALIGLFS
                     LVAPVLLSSGDIGRYLFVLIGFSLLGLSFGQAGGALASRFSREYRYTGASLTSDISWL
                     IGAGFAPLVALGFSSKFGLFAVGIYLMSGAVCTLVALWFSRTLEMPSE"
     gene            148441..148662
                     /locus_tag="Atu0144"
     CDS             148441..148662
                     /locus_tag="Atu0144"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAL41168.1"
                     /translation="MFFYCVTAILILTRHIMKYYVSNTDIIQCVLLPECRSPGNAMRT
                     TTIIICEKAAIAATPLDGRKTTVRAIKRR"
     gene            148937..154285
                     /gene="gltB"
                     /locus_tag="Atu0145"
                     /old_locus_tag="AGR_C_235"
     CDS             148937..154285
                     /gene="gltB"
                     /locus_tag="Atu0145"
                     /old_locus_tag="AGR_C_235"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase large subunit"
                     /protein_id="AAK85965.2"
                     /translation="MSAEGVGDGAGVSLDLSLSFFRELTGDAALPAGRFGVGNFFLPQ
                     NPAFHGEAVGIIGNALKEQGFSVLLVRDVPVNDTAIRPAAIPYQLPIRQWVFSAPVEC
                     ATLAEFDWRIHKALLAIEALAYTVPDLAGFYPLSLSARTQVLKGRLNSQEVMPYFCDL
                     TDPRHKVHTMYFHTRFSTNTDPHPSMAQPFRLMAHNGELNTDKKNRLSEAAVALAKNA
                     SIVRPKGQSDSCRLDQTLQARVMEDGLDLVTAVVSMMPPAWENDDTLSPGVKSMLEYF
                     SLYEEKNDGPAALIFGDGTIIGARLDRLGLRPLRTVETDDYLCVMSEAGQIAFPAESV
                     IRRGRIEAGGMLYYDHTERRAFSTVEALELLASRRDYSSLLSDARVMLGDLPEVPADK
                     QGSPLRYNGDLERHQRYVAYSHNQESFKFLMDPMLASGAEKISAMGYGNAINALSDQE
                     GGVAKYFSQRFAQVTNPPLDSIREADGMTLRVALGAKPNSGAKKARQIVVRSPILTHL
                     DMLRIREQPETPVRRFEMLYTPVFDAEDANEAALRQAIDGLCGEVVAFAAEEGGIAVV
                     TDRHVSAGRAALPMIMVVSAINQRLIEEGLRLRISLIVESGQFSSSHHIAAGLGFGAS
                     AVYPLGVQFRAEEKFGADADKAFKRFAKAAEKSLMKTMGKVGLCTAESYIGGEFFEPN
                     FLDTSDPVLKRYFPNVKTPVGGVTFAVIAQAVADWHRKALSVKGENDIPLLGLFKERA
                     EGAGHSYGTTAVRGFVDMTEEKIGFDKGTENEEALRLLPLNRLEDAFGLNDAAYYHNS
                     FDRLTPDAIDAFEVTPGYRAFSRMMAEERARRPAALRDVLELPADVTFAGSAEEFRRE
                     MGRFCRHGNNSFMVRGLRCDEAADGSFRLQLIGPHGHELARLAALGQSLLDRFDDDIA
                     GHWLEGGALMVQAKGEAFAYMSLIRTAPNSIPLETVQKASEITKTLASGAMSHGALVA
                     AAHEAVAHGTNMVGGMSNSGEGGEHISRYGTIRASRIKQFASGRFGVWAGYLADPMLE
                     EIEIKIGQGAKPGEGGQLPSPKVTVEIAAARGGTPGVELVSPPPHHDTYSIEDLAQLI
                     HDAKAARVRVIVKLVSSEGIGTIAVGVAKAGADVINVAGNTGGTGAAAVTSLKYTGRA
                     AEIGIAEVHQALCATGLRAKVLLRCSGAHQTASDVVKSALLGGDSFEFGTTALMMLKC
                     VMAKNCNIKCPAGLTTNQEAFNGDPRALAQYLMNIAHETREILAGLGLRSLREARGRS
                     DLLHLLDHPASVGQLDLRAMLAVVEEVKIDNPVYMEKDFALDDAFIELVRSALVDSRR
                     ENIELGGNRFLNNCNKSVGGQLAVDIERMLNHELSDEQLDALPAVKRDSRGRRFLEAG
                     SVRIDTSGSAGQSFGAFCNDGMIMVHTGTCNDGVGKSACGGTIVVRSPGGGSKETGGN
                     VLVGNFALFGATGGRTFVEGQAGDRFAVRNSGATAVVEGVGDFACEYMTNGAVLNLGS
                     FGKGFGNGMSGGFVYQYDPYGDLPKKVSHDSILLGSITGEDEQAAIHNQAVHQLLTLH
                     VAETGSAKAAWLLENWESEQHNFAYGMPRALLLYQDSDEILKAKPRKELLEELASALA
                     GYQLRKFKLAYRDRKAVLNGTVPGYGETDTEDMYALINNYTVLSMAQAIALQRLPMAS
                     GPSDPAIEKAVRNLILTEDYALMQRLLKYAREALSDHSDQQLAVMIAAKRLDDYKQAL
                     ARRNIWSVDSPGTYGWIIQQNRKNIEKIGRLPGFEELFAARAIPDLATASSHSRAA"
     gene            154282..156051
                     /gene="cysJ"
                     /locus_tag="Atu0146"
                     /old_locus_tag="AGR_C_238"
     CDS             154282..156051
                     /gene="cysJ"
                     /locus_tag="Atu0146"
                     /old_locus_tag="AGR_C_238"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite reductase (NADPH) flavoprotein
                     alpha-component"
                     /protein_id="AAK85966.1"
                     /translation="MMKIPYIPQDAPFNGDQRAWLAGFLAGLHSRTAIGLETSVAAAA
                     PKSAASVLNILVGTQTGNAEALAMDIAAAARTQGMQPVVTALDDVSMDSLGSMKRVIV
                     VTSTYGEGEMPDNAQLFWEALAADSAPRLDEMNFAVLALGDTGYDGFCQAGKLIDTRF
                     EQLGGRRMKARIDCDIDFEDAAAAWIGEALPLALAVDGGKEAAVTMPDIAAQPTRAKS
                     GWSRKNPYPATVGVNRRLSGSGSSKEIRHYEFDLRESGLDYEAGDALGVVPLNNPKLA
                     GALLGHFGAVGDSQVAGLDRPVGDALLNIYEISTPSRELVAEIGKRAGHEELSHILAN
                     GDKEQLAAFLWSKDILDLLNLGGKPLFELAEFVTFLKPLQHRAYSISSSPLLAKDSVH
                     LTIASVRYRAEGRERGGVCSTYLADRVEAGQSAGIFVSPNKAFRVPQDDNAPVIMVGP
                     GTGIAPFRAFLQERQARGARGKNWLFFGDQHRQSDFIYENELGDMSRDGVLTRLDLAF
                     SRDQAEKIYVQTRMRQNGKALYQWLEEGGYFYVCGDATRMAKDVDDALHSIISDEAGI
                     SAEAASDYVNRLKREKRYLRDVY"
     gene            complement(156090..156596)
                     /locus_tag="Atu0147"
                     /old_locus_tag="AGR_C_239"
     CDS             complement(156090..156596)
                     /locus_tag="Atu0147"
                     /old_locus_tag="AGR_C_239"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85967.2"
                     /translation="MGAVEFAIVFPILLALYLTSFELTIGYNTYKRASSAAATINDLI
                     SKTGSVDKTYLTGMQDVAAAVFAPYSTKGLKLKISGIKIDAQKQAKITWSWDEKNLRP
                     YAVGSVVTVPTRLLVQDSFLIHVELSVPHELLMFMPDVASSGTKSITIGRDYFFKQRD
                     AETACTNC"
     gene            complement(156680..157276)
                     /locus_tag="Atu0148"
                     /old_locus_tag="AGR_C_240"
     CDS             complement(156680..157276)
                     /locus_tag="Atu0148"
                     /old_locus_tag="AGR_C_240"
                     /codon_start=1
                     /transl_table=11
                     /product="Atu0148-1 mutant of a conserved hypothetical
                     protein"
                     /protein_id="AAK85968.2"
                     /translation="MRLARLKPLLEKFGFSRDGTAAIEFAILAIPYFLVVFAIIETFI
                     ALMAEQVVANATETMSRRLRTGQISSSITKEDFRRSFCNEVSVMIACSEDEIKKEEKL
                     YVDLRSFTAFKDIPTTIPLKAYGEYYDLDTAQFGFKPGGPETINMLRVYYRWRVVADI
                     IRPYLTKIRPADGSMPSHFLIVATSAFMSEKYITGGGA"
     gene            complement(157461..158267)
                     /gene="fabI"
                     /locus_tag="Atu0149"
                     /old_locus_tag="AGR_C_242"
     CDS             complement(157461..158267)
                     /gene="fabI"
                     /locus_tag="Atu0149"
                     /old_locus_tag="AGR_C_242"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-(acyl-carrier-protein) reductase"
                     /protein_id="AAK85969.2"
                     /translation="MNGIMQGKRGLIMGVANNHSIAWGISKALAAQGAELAFTYQGEA
                     LGKRVKPLAAELGSDFIVPCDVEDIASVDALFATIREKWGALDFVVHAIGFSDKNELK
                     GLYANTTRENFSRTMVISCFSFTEIAKRAAELMTNGGSMLTLTYNGSQRVIPNYNVMG
                     VAKAALEASVRYLAADYGPRDIRVNAISAGPVRTLAGAGISDARAIYAWNQKNAPLRR
                     TADIDDIGGSALYLLSSLSRGVTGECHYVDCGYNITSTPTLEVLSKADAE"
     gene            complement(158274..159497)
                     /gene="fabB"
                     /locus_tag="Atu0150"
                     /old_locus_tag="AGR_C_244"
     CDS             complement(158274..159497)
                     /gene="fabB"
                     /locus_tag="Atu0150"
                     /old_locus_tag="AGR_C_244"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-(acyl-carrier-protein) synthase"
                     /protein_id="AAK85970.2"
                     /translation="MRRVVVTGLGIVSSIGGDAAEVTASLRQAKSGISFSPDFAEHGF
                     KCQVWGKPSLDPTDLVDRRAMRFLSQGGAWNHVAMKQAIADSGLEESDISGNERTGII
                     MGSGGPSTRTIVEAADITLKNNSPKRIGPFAVPKAMSSTASATLATWFKIHGVNYSIS
                     SACSTSAHCIGNAAEMIQWGKQDVMFAGGHEDLDWSMSNLFDAMGAMSSKYNETPGVA
                     SRAYDVNRDGFVIAGGAGVLVLEELEHAKARGAKIYAEIVGYGATSDGYDMVAPSGEG
                     AIRCMRQALATVKGDIDYINTHGTSTPVGDSKEIGAIREVFGDKIPHIQSTKSLTGHS
                     LGAAGVQESIYGLLMMQERFIGESAHISELDPEFAGVPIVRSRIDDAKIDTILSNSFG
                     FGGTNATLVFQRHNG"
     gene            complement(159573..160088)
                     /gene="fabA"
                     /locus_tag="Atu0151"
                     /old_locus_tag="AGR_C_246"
     CDS             complement(159573..160088)
                     /gene="fabA"
                     /locus_tag="Atu0151"
                     /old_locus_tag="AGR_C_246"
                     /codon_start=1
                     /transl_table=11
                     /product="D-3-hydroxydecanoyl-(acyl carrier-protein)
                     dehydratase"
                     /protein_id="AAK85972.2"
                     /translation="MATRQSSYNYEEILSCGRGELFGPGNAQLPLPPMLMVHRITEIS
                     ETGGAFDKGFIRAEYDVSPDDWYFPCHFQGNPIMPGCLGLDGMWQLTGFFLGWLGEEG
                     RGMALSTGEVKFKGMVRPNTKLLQYGIDFKRVMRGRLVLGTADGWLKADGETIYQASD
                     LRVGLSKEKAA"
     gene            160159..160416
                     /locus_tag="Atu0152"
                     /old_locus_tag="AGR_C_247"
     CDS             160159..160416
                     /locus_tag="Atu0152"
                     /old_locus_tag="AGR_C_247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK85973.2"
                     /translation="MQGQRPLRPHSLSSEPSLQKSLPQYAVRIQEPSGWNQRKFAGIA
                     GLQPFATLGDAETIESIPCKRYMLLQLTGFISLFGTGLHGI"
     gene            160406..160825
                     /gene="irr"
                     /locus_tag="Atu0153"
                     /old_locus_tag="AGR_C_249"
     CDS             160406..160825
                     /gene="irr"
                     /locus_tag="Atu0153"
                     /old_locus_tag="AGR_C_249"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, Fur family"
                     /protein_id="AAK85974.2"
                     /translation="MAFDATLDIGTRLRRSGLRPTRQRVALGDLLFAKGDRHLTVEEL
                     HDEAVTAGVPVSLATVYNTLHQFTEAGLIRVLAVEGARTYFDTNVSDHHHFFVEGENE
                     VLDIPINNLQIDNLPEAPEGMEIAHVDVVIRLRRKRG"
     gene            complement(160901..161539)
                     /locus_tag="Atu0154"
                     /old_locus_tag="AGR_C_252"
     CDS             complement(160901..161539)
                     /locus_tag="Atu0154"
                     /old_locus_tag="AGR_C_252"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85975.2"
                     /translation="MTLLGFLDYAGVAVFAATGALAASRKQLDLIGFLFFAAATGIGG
                     GTVRDLVLGRTPVFWVINPTYILVCVSVAVLLFFTAHLFESRYRVLIWLDALGLSAYC
                     VMGAAKGLAASGSATVAIVTGVLTATFGGVLRDIMAGEPSVLLRPEIYITCALLGSSI
                     FIVVYFFGAPLYAASAAGFLTAFCVRSGALIFGWTFPPYKGKPGRRPEDVMK"
     gene            161618..162136
                     /locus_tag="Atu8116"
                     /old_locus_tag="AGR_C_253"
     CDS             161618..162136
                     /locus_tag="Atu8116"
                     /old_locus_tag="AGR_C_253"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK85976.1"
                     /translation="MIATSITETDAKENAVRIALVAALQALVLLMFPVALSAQQQLVS
                     DPEIYEKDHFRNECKVAAFGDDFVTRLDINNDGLMDAVVNHGVLDCDGEKGRSCDDEG
                     CPYNFYVQVKEGGYLMIATARIYSYDFIKRFGNMVFVLKMHPRYCERTDKEPCLMTVR
                     VRGTKFVTISRK"
     gene            complement(162149..162859)
                     /locus_tag="Atu0156"
                     /old_locus_tag="AGR_C_254"
     CDS             complement(162149..162859)
                     /locus_tag="Atu0156"
                     /old_locus_tag="AGR_C_254"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85977.2"
                     /translation="MTRQRRRNIIRARRTGTGIALVAAISFIAGMTDAVGLHLSGDFV
                     SFMTGNTTRAAISLEAGVYSHAAKLLFAIVAFVAGNAGGIVVAHKFDRSILAVLVGVG
                     LLVAIAALLRGDAFALTQFYLVVFAMGMVNAAVEHIEGLPIGLTYVTGALSRFGRGIG
                     RFLLGERSLDWGIQIVPWLGMISGAICGAVLGVTLQSGALWVVAATVFAVAVATLVIP
                     RSLRHRYNQRVRIRRIAP"
     gene            163006..164007
                     /locus_tag="Atu0157"
                     /old_locus_tag="AGR_C_256"
     CDS             163006..164007
                     /locus_tag="Atu0157"
                     /old_locus_tag="AGR_C_256"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, substrate binding protein"
                     /protein_id="AAK85978.1"
                     /translation="MPQIKRKKYRTKINQKGVPIMKRTWVIAAIATLVSSASAYAETA
                     VTIGMSGWTGFAPLTLAKQAGIFEKNGLKVDIKKIPQASRHLALASGDIQCAATTVET
                     WIAWNANGVKSTQIFQMDKSHGADGIAVRSDVSKVADLKGKTVAASAPGTSPYFFLAW
                     ILKENGLTLKDVKVVNLEPGPAAQAFVAGQNDAAMTYEPYLSTVRAAPDKGKILATTL
                     DYPAVMDTFGCTPDFLKANPQAAKALADSYFQALELIKADPEKSYATMGADVKQAGEA
                     FAASAKFLEWQDKAANQKFFEGEFKTFSEKSADLLLEIGVIKSKPDLSTLADTSFIK"
     gene            164146..164919
                     /locus_tag="Atu0158"
                     /old_locus_tag="AGR_C_257"
     CDS             164146..164919
                     /locus_tag="Atu0158"
                     /old_locus_tag="AGR_C_257"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, membrane spanning protein"
                     /protein_id="AAK85979.1"
                     /translation="MQPLQPIKNSTRIILGILFFVLFFSAWGFATLGGFVSPTFLADP
                     ITMLKDGIYLLTDQGFAGDIGMTIWRVVGGFVLASLIAVPVGIAMGAYKPIEALLEPF
                     VSFARYLPASAFVPLLILWAGIGEMQKLLVIFIGAVFQIILMVAVAVAGTRRDLVEAA
                     YTLGAKDRGVVRRVLIPANAPDIAEILRLVLGWAWTYVIVAELIGASSGIGYMIINSQ
                     ALMATGQIIFGIIVIGVIGLISDFAFKSLNRKLFAWRLA"
     gene            164919..165704
                     /locus_tag="Atu0159"
                     /old_locus_tag="AGR_C_259"
     CDS             164919..165704
                     /locus_tag="Atu0159"
                     /old_locus_tag="AGR_C_259"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, nucleotide binding/ATPase
                     protein"
                     /protein_id="AAK85980.2"
                     /translation="MSELVIKGVSRTFPGVQGGQPTLALQPTNLEIPRNDFVTILGPS
                     GCGKSTLLRIIAGLDRPTTGEVLLSGKAVTGPGADRGMVFQSYTLFPWLTIRENVAFG
                     LRERGVAEKEKWEIVDSYIDKVGLRGFENHWPKQLSGGMQQRTAIARALANGPKILLL
                     DEPFGALDNQTRGLMQELLLGIWEREQKTVIFVTHDIEEAVFMASRVVTMSARPGRIK
                     SITPVDLPHPRHYTIKASPEFSELRAKLTEEIRSEAIAAAAHG"
     gene            165739..166476
                     /gene="hutC"
                     /locus_tag="Atu0160"
                     /old_locus_tag="AGR_C_262"
     CDS             165739..166476
                     /gene="hutC"
                     /locus_tag="Atu0160"
                     /old_locus_tag="AGR_C_262"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, GntR family"
                     /protein_id="AAK85981.1"
                     /translation="MRSTGADLEEKSLHQRIRNDVERHIMSGEWPPGYRIPFEHEMTR
                     QYGCSRMTVNKALGELVQRGLIERRRRLGTFVRQPHAQSAVLEIHDIEREVQAIGLVY
                     GYRLDKRRLRPAGKEDGAAMALAADAPVLELTCTHFAGGVPFCLEERIVNIAAVPEAE
                     GTDFSQVGPGTWLLKMVPWSAAEHRISAVSADRKNAVALGIASGAACLVIDRRTWHGA
                     DYITRVRVTYPGDRHALVAQFSPSQNS"
     gene            166742..167764
                     /gene="exbB"
                     /locus_tag="Atu0161"
                     /old_locus_tag="AGR_C_264"
     CDS             166742..167764
                     /gene="exbB"
                     /locus_tag="Atu0161"
                     /old_locus_tag="AGR_C_264"
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transport protein"
                     /protein_id="AAK85982.1"
                     /translation="MAVTLLTGLSAGAVFAQQAPETQIQSAPPTETVQPSQAPVAPAT
                     PSAPTAEPSPTAQPSSPQPAQFEQPAQTNQTPAPSETSTPVETVNAEPASAERRTDIP
                     HNLSPWGMFMAADWVVKGVMIGLAFASLVTWTVWVAKSIELAGARVRAGSTLKVIRRA
                     KTLAEATDAVENKGGPAALMLRMATHEMQLSDAVVEHTDGGGIKERVSSALSRIETHA
                     GRRMSRGTGALATIGSTAPFVGLFGTVWGIMNSFISISESQTTNLAVVAPGIAEALLA
                     TAIGLVAAIPAVVIYNVFARSITGYRHLLADAAAGVERLVSRDLDFRRIPPGSTSKPA
                     VSLVGR"
     gene            167771..168274
                     /gene="exbD"
                     /locus_tag="Atu0162"
                     /old_locus_tag="AGR_C_265"
     CDS             167771..168274
                     /gene="exbD"
                     /locus_tag="Atu0162"
                     /old_locus_tag="AGR_C_265"
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transport protein"
                     /protein_id="AAK85983.1"
                     /translation="MAGGIRENSGDDLSENHEINVTPFIDVMLVLLIIFMVAAPLATV
                     DVNVDLPASTAKPAERPEEPLYLTVKDDLSLNLGNDAVAREALAAAIDRQTGGKKDTR
                     IFLRADKAVDYGHFMEIMNLLRDAGYLKIALVGLENAAAVSQPAGSTTAQPSGQPAAP
                     AGQGTAP"
     gene            168271..169194
                     /gene="tonB"
                     /locus_tag="Atu0163"
                     /old_locus_tag="AGR_C_267"
     CDS             168271..169194
                     /gene="tonB"
                     /locus_tag="Atu0163"
                     /old_locus_tag="AGR_C_267"
                     /codon_start=1
                     /transl_table=11
                     /product="tonB protein"
                     /protein_id="AAK85984.1"
                     /translation="MTENGFPQARHSRLGEVTLWSAAALLMLSVHAGFAYYLMQEPEE
                     QDAGGQPPAAIMIEMAAIPEAVKTEETTQAQDVEDTREVKSESSEPVEEAAPEEPPPP
                     EPVAETPPPEPVQPPEPPVEEIVEPQEIPEPVEPIDPVQEQMMAELENVEVPLPVMRP
                     PPPRVEKKVEKKEPEEKKKVERQRPKPQQASEFRETAKAEAQQSNRTAASRSNAGFFS
                     SSSVSKADWDAKVRSAIKRRLARAAGKSGMAITVSFKIDSGGSVGGVSILSSTGNSAM
                     DQKLLAVIQKTSVSPPPPGVNPSFTLPVLFE"
     gene            169337..170326
                     /locus_tag="Atu0164"
                     /old_locus_tag="AGR_C_268"
     CDS             169337..170326
                     /locus_tag="Atu0164"
                     /old_locus_tag="AGR_C_268"
                     /codon_start=1
                     /transl_table=11
                     /product="putative malate dehydrogenase"
                     /protein_id="AAK85985.2"
                     /translation="MKFSIAEAEDLVSSIFERNGVLPQNARSVAKALVASEAAGQGGH
                     GFRRIPVYVRQARVGKVDGQARPVVRRVKPGVLSIDANHGYAYPAIDCALEELPEMAR
                     QQGIALAAIHRSHHAGVMALTVERFAEMGLVALMFANAPASMAPWGGHTPLYGTNPIA
                     FAAPIGGADPLVIDLALSKVARGKIMAARQKGETIPGDWALDRNGRPTTDPEEAIAGT
                     MVPAGEAKGAALALMVEIMAAAVTGGNFAFQASSLLDDKGAPPSLGHTIIAIDPVSSG
                     GAAFTERLALIAGEIEKQENVRLPGRRSQGIRKQALESGIAIESDILAEIQSL"
     gene            complement(170547..170792)
                     /locus_tag="Atu0165"
     CDS             complement(170547..170792)
                     /locus_tag="Atu0165"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAL41189.1"
                     /translation="MSSKTPHEHRQTRDIVLSDRERQYLGLVARGKHPSHVALITGAD
                     ETEVKDTLERVRNRLGAANLLNAVSIALLRGLIEQDA"
     gene            complement(170930..171184)
                     /locus_tag="Atu0166"
     CDS             complement(170930..171184)
                     /locus_tag="Atu0166"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAL41190.1"
                     /translation="MCRNVTIEMQNLAPDVILLARHIAYESAAYPGDMTETFQSFETA
                     FCARPVIVISAIGVAVPPKPRNNVPIGIGCCESGFLLHNS"
     gene            complement(171256..172296)
                     /locus_tag="Atu0167"
                     /old_locus_tag="AGR_C_275"
     CDS             complement(171256..172296)
                     /locus_tag="Atu0167"
                     /old_locus_tag="AGR_C_275"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, AraC family"
                     /protein_id="AAK85986.1"
                     /translation="MPEKRVSDEISVVAGLAAGVSNYARSRGIDIVPICKALDIDPAT
                     FSSLTERISLDRFSRLLETCALISGDDAFGLQCAATFPAGASGAFGYGLISAPTVRSF
                     LRFLQDHVYYATNNSNFTMVADATQVTLSWSFAPGIAKRDQYVDLSLAVLVQRLRDIL
                     GERVNQIEIGLERQKPINIQLFKERLTRRVSFSQAIHTMRLPASLLDVANPNADERLF
                     ELMNLQCRMLRPETSADPTHFIDQVKRYMQMRLSDAELSLGEIAPYFNLSERSFQRRL
                     AELGTNLNEIKDAIRKNAGFKLLVESDLPVSDISYRLGYSTPGAFSRSVSRWFGATPT
                     DIRRKHAHHSAG"
     gene            complement(172384..172935)
                     /gene="gmk"
                     /locus_tag="Atu0168"
                     /old_locus_tag="AGR_C_277"
     CDS             complement(172384..172935)
                     /gene="gmk"
                     /locus_tag="Atu0168"
                     /old_locus_tag="AGR_C_277"
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate kinase"
                     /protein_id="AAK85987.2"
                     /translation="MIVIVGPSGAGKDTLMDYAAAQLSGRPGFHFTRRVITRSCDAGG
                     ENHDAVSMHEFNQLEDAGAFAVSWQAHGLKYGIPAAVYRHLEAGDVVIANGSRSALPH
                     FGTAFSRLKVVNIVARPDVLARRLEQRGRESRDDILRRLERSSLAVAGDFDVTTVDNS
                     GAIEDAGKTIMQVLQQSAGSSQP"
     gene            complement(172980..174116)
                     /gene="phnM"
                     /locus_tag="Atu0169"
                     /old_locus_tag="AGR_C_279"
     CDS             complement(172980..174116)
                     /gene="phnM"
                     /locus_tag="Atu0169"
                     /old_locus_tag="AGR_C_279"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85988.1"
                     /translation="MTEHALSNARIVLEDDIILGSVLIRDGKIADISEGASKTGEDLE
                     GDFLIPGLVELHTDHLEQHYSPRPGVIWDKIAAIQAHDAQVASSGITTVFDCLRLGSD
                     EDGGFKKGEMREMADAIEAAADQNRLRADHLLHLRCEVASADVLEHFEDFETDPRVRL
                     ISLMDHSPGQRQFQSMDQYIFYYQKKRGLSDEAFAEFVRRRQAASAEYSAKHRDYLAA
                     SCAKRGITVASHDDATEAHVGEAIGHGVKLAEFPTSVEAAKASHSAGMSVLMGAPNIV
                     RGKSHSGNIAARDLAEIGVLDVLSSDYVPFSLLFAPFLLADQVEAISLSEALRMVTAT
                     PARTVGLVDRGRIATGLRADLVRVHREDGVPVARSVWRQGKRVA"
     gene            complement(174113..174802)
                     /locus_tag="Atu0170"
                     /old_locus_tag="AGR_C_280"
     CDS             complement(174113..174802)
                     /locus_tag="Atu0170"
                     /old_locus_tag="AGR_C_280"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85989.2"
                     /translation="MRYAIYFSPAKDHPLTEAASRWLGRNAFSGTLHDDHDDYADLTE
                     EPRRYGFHATLKAPFELAEKYSEAELLAAVEDFAANQSAFEIPRVVVGALGPFFALVP
                     DRVYQPLQDFAAEVVDHFDRFRAPLSETDIARRRPQMLTESQRQNLSLWGYPHVMDDF
                     RFHMTLTGRIDEEEQPAMQEILSTRFAEFVDQPLAISGLALFIEETRGAPFTVHRWHP
                     LGQQPKKDANP"
     gene            complement(175086..176435)
                     /gene="phnE"
                     /locus_tag="Atu0171"
                     /old_locus_tag="AGR_C_284"
     CDS             complement(175086..176435)
                     /gene="phnE"
                     /locus_tag="Atu0171"
                     /old_locus_tag="AGR_C_284"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, membrane spanning protein
                     (phosphonate)"
                     /protein_id="AAK85991.1"
                     /translation="MSSSFILNTAERERLTAAHRHVFNRSFMQRYGLLVGLLVATAYL
                     IGCFFFFNVGPAFMQGRWDRASSYIQDWYSWRAQPRLRFEDGKVAPQWSSRGQYPADA
                     KIDWLQPLPDGGYSVVYAGTQNRLDITPTRVDVYVDGKNYPVIINDDAVVAPQGLPDE
                     IQQDGKKVLVHYGFAGQAEIRTSQVYVQRRFLGWANFLFDTKSEFWGKGYGELAALAL
                     WGERLDPARSNIGHMVDDFLDNSVWQHADILSKLMQTLVMAFVGTLFGTLVALPLAFI
                     AARNITANRAANWGMKRLFDFLRSIDMLIWALFFTRSFGPGPIPGIAAIFFTDTGALG
                     KVYAEALENVDDKQREGVKSVGASPIAVNRFGVLPQVLPVFISQSLYFWESNTRSATI
                     IGAVGAGGIGLKLLEAMGTNADWDKVAYMVLLILFVVFLFDHISNSLRSRLIGKTQH"
     gene            complement(176435..177421)
                     /gene="phnE"
                     /locus_tag="Atu0172"
                     /old_locus_tag="AGR_C_285"
     CDS             complement(176435..177421)
                     /gene="phnE"
                     /locus_tag="Atu0172"
                     /old_locus_tag="AGR_C_285"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, membrane spanning protein
                     (phosphonate)"
                     /protein_id="AAK85992.2"
                     /translation="MATTLHNGTLSPEGLSASSRTVMRHYQQQLATRRIYTVISLVIF
                     LVILAASLNFANAANSGKFFERLPYFFDFMKTFVPDSPLEIFRAMFDLPSPYADGSLK
                     YNYVADRVYITDGFYIPHFIYQLIITLNIALVSTIIGTSFAFVLCFFASTNLVGAGLV
                     RWVVRRVMEVLRAFPEIVVAGLLTAILSIGPIAAIIAISVHTIGALGKLFFEVVENAD
                     MKPDEGLRAAGANWLERVRFAIVPQVLPNFVSYALLRAEINVRASTIIGAVGGGGIGE
                     VFRLSIGNDHASKTYAIIILLLITIIAVDQFSSWLRRRLIGQQSFEFGRGAA"
     gene            complement(177492..178397)
                     /gene="phnD"
                     /locus_tag="Atu0173"
                     /old_locus_tag="AGR_C_288"
     CDS             complement(177492..178397)
                     /gene="phnD"
                     /locus_tag="Atu0173"
                     /old_locus_tag="AGR_C_288"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, substrate binding protein
                     (phosphonate)"
                     /protein_id="AAK85993.1"
                     /translation="MLKKVLLSAVALGVLAGSAMAQDVKVLRIGLDGSENEADQIRNT
                     KCVADGLKAATGVSEVQVFPSPDYNGVIQGLLGGTIDIASMGASSYAKIALADPKAVD
                     PILTTAGADGSTGYYTIMVARKDSGIKTLADAKGKKIGFADPDSTSGFLVPNVAIPKE
                     TGVPVKEYFSETGFGGGHENLVLAVLDKKFDVGTTFGSGVGKWEEGYTAGNLYQMVKK
                     GNLDMDDIVQVWKSPLIPNGPLMVTNKLGDAMKQKVEDFFMELPKKDLACFQGFTQGK
                     NTAYIKVDPSFYQTIIDARKSVIGG"
     gene            complement(178483..179343)
                     /gene="phnC"
                     /locus_tag="Atu0174"
                     /old_locus_tag="AGR_C_290"
     CDS             complement(178483..179343)
                     /gene="phnC"
                     /locus_tag="Atu0174"
                     /old_locus_tag="AGR_C_290"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, nucleotide binding/ATPase
                     protein (phosphonate)"
                     /protein_id="AAK85994.2"
                     /translation="MSFHLKQVTRRFGKHTAVDSVDVEIPQGQMVGVIGRSGAGKSTL
                     LRMINRLVDPSSGSIHFNDTEVSSLKGAALRAWQRDCAMIFQQFNLVPRLDVLTNVML
                     GRLNHRSTALSLFNIFSHEERLMAIAALERLGIEHVAMQAAGTLSGGQQQRVAIARAL
                     MQSPKMVLADEPIASLDPLNAKIVMDALRDINEREGITVITNLHTLDTARNYCERIIG
                     MSQGRVVFDGTPAELTAAAVTEIYGTDSQGSGIDETMTSTSINIPGAQLAARPVQQSA
                     GPEPLALAGL"
     gene            complement(179560..180177)
                     /locus_tag="Atu0175"
                     /old_locus_tag="AGR_C_291"
     CDS             complement(179560..180177)
                     /locus_tag="Atu0175"
                     /old_locus_tag="AGR_C_291"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="AAK85995.1"
                     /translation="MSVKVGLEPVIHESARVTNSSIGRYTEISERCRLEEVEMGDYSY
                     VMQDGAIWCATIGKFVNIAASVRINATNHPMQRATLHHFTYRARSYWDDAEDETDFFA
                     ARRAKRVVIGHDVWIGHGATILPGITVGNGAVIGAGAVVSKDVAPYTIVGGVPARLIR
                     ERFPAELGKRMDDLNWWDWDHARLRSALEDFRALDAEDFVAKYGG"
     gene            complement(180174..180881)
                     /gene="phnL"
                     /locus_tag="Atu0176"
                     /old_locus_tag="AGR_C_293"
     CDS             complement(180174..180881)
                     /gene="phnL"
                     /locus_tag="Atu0176"
                     /old_locus_tag="AGR_C_293"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, nucleotide binding/ATPase
                     protein (phosphonate)"
                     /protein_id="AAK85996.2"
                     /translation="MTTPLIVSEVFKSFTMHLRDGIELPVVRDVSFSVSGGECVVLGG
                     PSGIGKSSILKMLYGNYAIDSGQILIRHQGEVIDMGNASPRTILDIRHRTIGYVSQFL
                     RTVPRVAAIDVVAEPLLARKVAAEDAREQAAMLLSKLNLPRELWSLPPATFSGGEQQR
                     VNIARGFITDHAILLLDEPTASLDATNRRVVVDMIREKKEKGTALLGIFHDEEVREAV
                     ADRILDVSQFSPRKAAA"
     gene            complement(180949..181725)
                     /gene="phnK"
                     /locus_tag="Atu0177"
                     /old_locus_tag="AGR_C_295"
     CDS             complement(180949..181725)
                     /gene="phnK"
                     /locus_tag="Atu0177"
                     /old_locus_tag="AGR_C_295"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, nucleotide binding/ATPase
                     protein (phosphonate)"
                     /protein_id="AAK85997.2"
                     /translation="MSDAPLLKVRDVSKYYGDRAGCRNVSFELYPGEVLAIVGESGSG
                     KTTLLNCISTRLMPTAGSVEYRMRDGSVRDLYHMGEAERRFLMRTDWGFVHQNPADGL
                     RMAVSAGANVGERLMAVGNRHYGNIRQSASEWLERVEIGTDRIDDQPRAFSGGMRQRL
                     QIARNLVTSPRLVFMDEPTGGLDVSVQARLLDLVRGLVNDLGLAVVVVTHDLAVARLL
                     SHRMMVMKGGDVIEHGLTDRVLDDPREPYTQLLVSSILQV"
     gene            complement(181722..182624)
                     /gene="phnJ"
                     /locus_tag="Atu0178"
                     /old_locus_tag="AGR_C_297"
     CDS             complement(181722..182624)
                     /gene="phnJ"
                     /locus_tag="Atu0178"
                     /old_locus_tag="AGR_C_297"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85998.1"
                     /translation="MLKEVSFDDGLAAYNFAYLDEQTKRMIRRAILKAIAIPGYQVPF
                     ASREMPMPYGWGTGGVQLTASILGPDDVLKVIDQGADDTTNAVSIRAFFQKVADVAVT
                     TRTKDATIIQTRHRIPEEELHSGQVLVYQVPIPEPLRFLEPRETETRVMHALEEYGLM
                     HVKLYEDIARNGRISTTYAYPVKVAGRYVMDPSPTPKFDNPKMNMSDALQLFGAGREK
                     RIYAVPPYTDVVSLDFEDHPFEIQRFDKPCALCGGENVYLDEVVLDDKGGRMFVCSDT
                     DHCEDRRAHGHKGHLLADVKEAAE"
     gene            complement(182758..183867)
                     /gene="phnI"
                     /locus_tag="Atu0179"
                     /old_locus_tag="AGR_C_299"
     CDS             complement(182758..183867)
                     /gene="phnI"
                     /locus_tag="Atu0179"
                     /old_locus_tag="AGR_C_299"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK85999.1"
                     /translation="MYVAVKGGETAIANAHRLLADQRRGDRDLPAMTVAQIVSQLSLA
                     VDRVMAEASLYDQSLAALAVKQARGDMIEAIFLLRAYRTTLPRFGYSVPVDTADMVVQ
                     RRVSATYKDLPGGQLLGPTFDYTHRLLDPSLLEDEGVETATQREGEPEYVVRVSDILA
                     QEGLIESDGDMPDDHIAGDLTREPMEFPMPRDLRLQSLARGDEGFLLALAYSTQRGYG
                     RTHPFVGEIRIGEVEVELDVPELGFSVSLGDIKVTECQMVNQFKGSAKAPPQFTRGYG
                     LVFGQSERKAMAMSLVDRALRAGEFGEDVVAPAQDEEFVISHADNVQATGFVEHLKLP
                     HYVDFQAELGLVRKMRADFEAINANGAEWMSDAAE"
     gene            complement(183869..184480)
                     /gene="phnH"
                     /locus_tag="Atu0180"
                     /old_locus_tag="AGR_C_302"
     CDS             complement(183869..184480)
                     /gene="phnH"
                     /locus_tag="Atu0180"
                     /old_locus_tag="AGR_C_302"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86000.1"
                     /translation="MMGVKAEALTGGFSSAVFDSQRIFKKLMDGMARPGTPQTIETAV
                     APPLPLAAATGAVLLALCDHDTPVWLNGALRKTAVPGWIGFHTGAPATEEKGAAHFAV
                     IEAGSAIASFGLFAQGSQEYPDRSTTLIIELSDLDGGRELLLSGPGIRHVNIISPSGL
                     PDIFPMLWAENNAIFPRGVDVILTAGDKFVCLPRTTRIKPVEA"
     gene            complement(184477..184938)
                     /gene="phnG"
                     /locus_tag="Atu0181"
                     /old_locus_tag="AGR_C_303"
     CDS             complement(184477..184938)
                     /gene="phnG"
                     /locus_tag="Atu0181"
                     /old_locus_tag="AGR_C_303"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86001.1"
                     /translation="MNNEAANIDSERKRVAALLARATVQELETVWSRQDASPQTENVR
                     GPETGLVMVKGRIGGGGAPFNLGETTVTRATVKLASGTVGHAHVLGTGRKKAWYAAVF
                     DALWQESQTRGFIEAELLSPVEKRLSEEKQRKTKETAATRVDFFTMVRGED"
     gene            185021..185758
                     /locus_tag="Atu0182"
                     /old_locus_tag="AGR_C_306"
     CDS             185021..185758
                     /locus_tag="Atu0182"
                     /old_locus_tag="AGR_C_306"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, GntR family"
                     /protein_id="AAK86002.1"
                     /translation="MSPVAAMKRKNGVALWRQIADRIRGEIAAGDHDETGMLPPEMTL
                     AEKFGVNRHTVRSAIAALASEGILEPMQGRGTMIARKERLSFPISLRTRFTAGIGDQV
                     KEMEALLLSHTTEPASADLAARLQLPSGAPLVRLETLRKADTRPVSRSTTWFPADRFA
                     GIGEAYRKSGSITAAFKALGVADYVRISTVISAIHADTQDLADLELSPGAILLVTQAL
                     NADMDGVPVQYAVSRFSADTVEFTVEN"
     gene            complement(185768..186595)
                     /gene="dapB"
                     /locus_tag="Atu0183"
                     /old_locus_tag="AGR_C_307"
     CDS             complement(185768..186595)
                     /gene="dapB"
                     /locus_tag="Atu0183"
                     /old_locus_tag="AGR_C_307"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate reductase"
                     /protein_id="AAK86003.2"
                     /translation="MGSSGMKLVVVGAAGRMGQALIRLIHQTPGVQLHAAVAREGSAF
                     VGRDAGEIAGLGPIGIEITSDPLQAFLHAEGVIDFTSPATSITFAGLAAQARIVHVVG
                     TTGCSPQDEEKFKAASRHARIVKSGNMSLGVNLLSVLTQQAAQALDAQNWDIEILEMH
                     HKHKVDAPSGTALLLGEAAAAGRKVDLTAASVRVRDGHTGAREAGTIGFATLRGGSVI
                     GEHSVIFAGEGERVELSHYAGDRSIFARGAITAAVWAFDKKPGFYSMLDVLGLSQAE"
     gene            complement(186737..187759)
                     /gene="glk"
                     /locus_tag="Atu0184"
                     /old_locus_tag="AGR_C_310"
     CDS             complement(186737..187759)
                     /gene="glk"
                     /locus_tag="Atu0184"
                     /old_locus_tag="AGR_C_310"
                     /codon_start=1
                     /transl_table=11
                     /product="glucokinase"
                     /protein_id="AAK86004.2"
                     /translation="MPKTSDTEYLSFPILLGDIGGTNARFSILIDSFAEPVHLTTVKT
                     AEYPGIDDAIQQAVLDKTSLQPVSTILAIAGPIEGDEIPLTNCHWVVKPKDMLAKLGL
                     KDVIVINDFEAQALAIAALDDDNREPIGSGKKDMLASRVVLGPGTGLGVAGLVYARHM
                     WFPVPGEGGHIDIGPRSARDYVVFPHIETIEGRVAGEQILCGRGLVNLYRAICKADGI
                     EPVFSDPADITSQGLSGQNAQAKETLSLFSTYLGRVAGDLALIFMAKGGVYLAGGISQ
                     KIIPALKSPEFRAAFEDKAPHSALMRTIPTFVVTHPQAALSGLATYARTPADFGLALD
                     GRRWRA"
     gene            complement(187787..188170)
                     /gene="mgsA"
                     /locus_tag="Atu0185"
                     /old_locus_tag="AGR_C_311"
     CDS             complement(187787..188170)
                     /gene="mgsA"
                     /locus_tag="Atu0185"
                     /old_locus_tag="AGR_C_311"
                     /codon_start=1
                     /transl_table=11
                     /product="methylglyoxal synthase"
                     /protein_id="AAK86005.1"
                     /translation="MEGQRCIALIAHDEKKDDMADFARHHQKVLASFRIVATGTTGGR
                     VQEACPGLEVIRLKSGPLGGDQQIGAMIATGEVDMLIFFTDPLTAMPHDVDVKALTRL
                     ATVYDIPMALNRATAENLIDFNSAD"
     gene            complement(188270..189325)
                     /gene="mepA"
                     /locus_tag="Atu0186"
                     /old_locus_tag="AGR_C_314"
     CDS             complement(188270..189325)
                     /gene="mepA"
                     /locus_tag="Atu0186"
                     /old_locus_tag="AGR_C_314"
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-insensitive murein endopeptidase"
                     /protein_id="AAK86006.1"
                     /translation="MTAGSPRVLKAALLAMSVVSALQLQIETASAEDRPAKEVFGHMA
                     LPSAAASQPIGSYAKGCQSGAIAMPTDGPGWQAMRLSRNRRWGQPQLISFLERFSQDA
                     QKIGWPGLLLGDISQPRGGPMLTGHASHQIGLDVDVWWRPMPSPRLTVEQRETVPFIS
                     MLDKSKFLTVDDRKWSPLNARLVMMAASYPQVERVFVNPAIKQKLCQTWTGDRTFMGK
                     IRPIYGHDEHFHIRLECPPGAPNCKPQAEVGKGDGCDKSLAWWFTKEPWAPPKKDPNA
                     KPVKPRQVMVSDLPAACAAVAAAPSANPEGIAAQAYSSSPAQAVRQQNVEQVIQNAPA
                     IQPPSDIPLPTQRPTLN"
     gene            189528..191372
                     /locus_tag="Atu0187"
                     /old_locus_tag="AGR_C_316"
     CDS             189528..191372
                     /locus_tag="Atu0187"
                     /old_locus_tag="AGR_C_316"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, substrate binding protein
                     (peptide)"
                     /protein_id="AAK86007.1"
                     /translation="MILAPLKSRILIALAASALLIPAVASAQSTDVWRKGISTVGELK
                     HPDGFDHFDYVNTKAPKGGTLRLSTSGTFDTLNPLLAKGERATGLSLVYDTLMKSTEE
                     ELSASYGLLAEGVSYPDDIEKATFRLRQDAKWADGKPVTPEDVVFSFEKAKDLSPQLA
                     TYYTHVTKAEVSGERDITFTFDEKNNRELPQIVGQLLIVPKHWWEGTGPDGKPRDISR
                     GTLEPVMGSGPYKIAAVSPGSSVTYERRDDYWGKDVNVNVGMNNFKTIAYTFFADQDV
                     EFQAFKSGTVDFRQEASSSRWVTGYDFPAVKEGRVKKEELPNIYRSVGIMQAFVPNMR
                     REKFQNPKLRKALNYAFDFEELNRTLAYGQFQRITSFFMGSELASSGLPTGRELEILQ
                     ELKDQVPPEVFTTEYRNPVAGDPAKQRDNLREAVKLMKEAGYELRGNRMVNAATGQQL
                     DMEFLIDSSGMERTILPYVQNLKKIGINATIRTVDASQYTNRTRSFDFDVTIKLWATS
                     ANPGNEQADFWGSAAADRQGSNNLAGIKNPAVDALVRKVIFAPNRDEQVAAARALDRV
                     LLANSYVIPQFYRGEMFIAYWNTLIRPENLPEYGVGFPDAWWSGKAGN"
     gene            191514..192608
                     /locus_tag="Atu0188"
                     /old_locus_tag="AGR_C_318"
     CDS             191514..192608
                     /locus_tag="Atu0188"
                     /old_locus_tag="AGR_C_318"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, membrane spanning protein
                     (peptide)"
                     /protein_id="AAK86008.1"
                     /translation="MGAYILRRLALMIPTIVGIMGISFLVIQFAPGGPVEQVVAQLTG
                     QGDSASDRLSGGGDLMGQSGGFDESGSKYRGAQGLDPELIKKLEKQFGFDKPPLTRFL
                     EMMWNYIRFDFGDSFFRNSSVIDLIIDKLPVSASLGFWILIISYVISIPLGIKKAVSD
                     GSTFDVWTSGIIIIGYAVPSFLFGILLIVLFAGGSFFDWFPLRGLVSDNFDQLNWWQK
                     IIDYFWHLTLPLIALSLSAFATTTLLTKNSFIDEIKKQYVVTARAKGLSERKVLYGHV
                     FRNAMLIVIAGFPGAFISAFFTGSLLIENIFSLDGLGRLGYLSVVNRDYPIVFGTLFI
                     FSLMGLVVGLLSDLIYTWIDPRIDFERRDV"
     gene            192608..193753
                     /locus_tag="Atu0189"
                     /old_locus_tag="AGR_C_319"
     CDS             192608..193753
                     /locus_tag="Atu0189"
                     /old_locus_tag="AGR_C_319"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, membrane spanning protein
                     (peptide)"
                     /protein_id="AAK86009.2"
                     /translation="MSLAQPAGTETLVKPKRPWFSPTTKRRWQNFKANRRGYWSFWLF
                     LILFFLSLIAEFIANDKPILASYKGEILVPVMVDYPEEKFGGFLAQTDYKSSFIQDEI
                     NANGWMIWPPIRYSYQTVNSNIPHSAPTAPFWLMDEKERCSAYPQGNADPGCTLGNLN
                     WLGTDNQARDVTARMIYGFRISVLFGLTLTIASALVGVTAGAIQGYFGGWTDLLLQRF
                     IEIWSSMPVLYILLIIAAILPPGFFVLLGIMLLFSWVGFVGIVRAEFLRARNFEYVRA
                     ARALGVGNWTIMFRHLLPNAMVATLTFLPFILSGSITTLTSLDFLGFGMPPGSPSLGE
                     MIAQGKNNLQAPWLGLTAFFTMSIMLSLLIFVGEAVRDAFDPRKTFR"
     gene            193759..195399
                     /locus_tag="Atu0190"
                     /old_locus_tag="AGR_C_320"
     CDS             193759..195399
                     /locus_tag="Atu0190"
                     /old_locus_tag="AGR_C_320"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, nucleotide binding/ATPase
                     protein (peptide)"
                     /protein_id="AAK86010.2"
                     /translation="MKETNTQPLLSVRDLSVAFHQGGATSVAVDHVSFDLMPGEVVAL
                     VGESGSGKSVTANSILKLLPYPAASHPSGKILFDGKDMLTLPERALRAVRGNDITMIF
                     QEPMTSLNPLHTIERQIGEILELHQAITGAEARQRTLELLLQVGIREPEKRLKAYPHE
                     LSGGQRQRVMIAMALANRPKLLIADEPTTALDVTVQAQILELLGDLKTQHGMSMLFIT
                     HDLGIVRKFADRVCVMTKGKIVETGTVEQVFTDPQHAYTRHLLAAEPKGEPPHSDASK
                     PVVMQGDDIKVWFPIKAGLMRRVIDHVKAVDGIDITLRAGQTVGVVGESGSGKTTLGL
                     ALSRLIASKGRISFIGQSIDSYSYEMMKPLRNRLQVVFQDPYGSLSPRMSVGEIIAEG
                     LKVHERSLSADERDTRVATALEEVGLDPATRWRYPHEFSGGQRQRIAIARAMVLKPRF
                     VMLDEPTSALDMSVQAQVVDLLRDLQAKHELAYLFISHDLRVVKALANDLIVMRHGKV
                     VESGPAAEIFANPQQDYTKALLAAAFNIEAVETKAVSQ"
     gene            195499..196738
                     /gene="dadA"
                     /locus_tag="Atu0192"
                     /old_locus_tag="AGR_C_323"
                     /note="D-amino acid dehydrogenase; Frameshift
                     (pseudogene)"
                     /pseudo
     gene            196923..198281
                     /gene="glnA"
                     /locus_tag="Atu0193"
                     /old_locus_tag="AGR_C_326"
     CDS             196923..198281
                     /gene="glnA"
                     /locus_tag="Atu0193"
                     /old_locus_tag="AGR_C_326"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="AAK86012.1"
                     /translation="MYDIENAKKFFADNPDIEILEAFVIDANGVPRGKWIPRERAIDV
                     LEKGMAIPRSVYALDIWGRDVHAAGLAEGTGDPDGFCFPVPGTLSRVTWLGRPTAQVL
                     LAMKNADGTGFYGDPRHVLSQVLNAYKKAGLTPVVATELEFYLIDPVRSALDPVRPPH
                     SREGRWHTGQTQVLSISELQDFEDVFHDIATACRAQGVLADTTLRENGPGQYEINLNH
                     VPDALQAADFAVFLKRIVKGVARRHELDATFMAKPYGLQAGNGMHVHFSVLDRDGRNI
                     YAGENGPSDALMHSVGGLLENMGESMAIFAPHANSYRRLTPSEHAPTYASWGIDNRSA
                     AVRVIVASKAATRIEHRVAGADTNPYLVLAMILSAAIAGMKEKRQPGGAIAGDSHAIN
                     HEPLPTNWDYALQRFTRSSFAYATLGQKYRTLFSACKQQELSEFSLRVTDVEYDAYIR
                     TV"
     gene            198256..199584
                     /gene="ordL"
                     /locus_tag="Atu0194"
                     /old_locus_tag="AGR_C_328"
     CDS             198256..199584
                     /gene="ordL"
                     /locus_tag="Atu0194"
                     /old_locus_tag="AGR_C_328"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="AAK86013.1"
                     /translation="MTPISGRCEMAEVTNIPNPGHTSSWYAASANVKSVRPTLEGALE
                     ADVCIIGGGFTGISAALELSERGYAVIVLEGVRVGFGASGRNGGQIVNGYSRDLETIA
                     RRYGHEKAVKLGEMSLEGGTIIRSRVAKYGIDCDLVDGGFFAAFTPKQIREMEAHKAH
                     WEKHGHGGLEMVSEADVGQYVKTNRYAGGMIDRFGGHIHPLNLVQGEAAAAESLGARI
                     FENSRVIAVEQGANPIVRTAMGSVKAKYVLVCGNAYLGTLLPEIGERMMPVSSQVMAT
                     EPLDADLIEALLPANYCVEDANYILDYYRRTSDNRLLYGGGIGYGGSDPADLTGVIRP
                     NMLKTFPQLEKTKIEFAWSGNFALTLTRIPHMGRLSDNIYFSHGDSGHGVTTTHLLGK
                     ILGEAVAGHAERFDIWSSLPNYPFPGGKTFRVPLTMLGAWWYGLRDKLGL"
     gene            complement(199684..200175)
                     /gene="gntK"
                     /locus_tag="Atu0195"
                     /old_locus_tag="AGR_C_329"
     CDS             complement(199684..200175)
                     /gene="gntK"
                     /locus_tag="Atu0195"
                     /old_locus_tag="AGR_C_329"
                     /codon_start=1
                     /transl_table=11
                     /product="gluconokinase"
                     /protein_id="AAK86014.1"
                     /translation="MMGVSGSGKSTVAEGLAEKLGIAFIEGDKLHPKSNVDKMSEGIP
                     LTDDDRWPWLDLIGAELRNGSEGKGVLVSCSALKKIYRDRLREATGGPLAFVYLDGSL
                     ELLSRRMGERKGHFMPLSLLQTQLATLEVPTGEPGVVTVSIDSTPEEIVANALAGLKT
                     LKF"
     gene            complement(200281..201021)
                     /locus_tag="Atu0196"
                     /old_locus_tag="AGR_C_332"
     CDS             complement(200281..201021)
                     /locus_tag="Atu0196"
                     /old_locus_tag="AGR_C_332"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, membrane spanning protein
                     (proline/glycine/betaine)"
                     /protein_id="AAK86015.2"
                     /translation="MKNAFSFLSLGLLVLALIIFLAAPQIFAPIFRPLVQANAPAIYT
                     QANLFSLTLSHLTIVAIATGLATLTAGALAVLVTRPFGADFLPLSRSIVNIGQTFPPV
                     AVLALAVPMIGFGEKPTLIALFLYALLPVFENTLTGLTTLPATVMDAARGSGMTGWQR
                     LTKVELPLALPAILAGVRLSAVISLSTATIGSTVAARTLGEVIIAGLQSNNLAFILQG
                     GLIVAALAILIHAGFSALERSAARKTGH"
     gene            complement(201018..201956)
                     /locus_tag="Atu0197"
                     /old_locus_tag="AGR_C_334"
     CDS             complement(201018..201956)
                     /locus_tag="Atu0197"
                     /old_locus_tag="AGR_C_334"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, nucleotide binding/ATPase
                     protein (proline/glycine/betaine)"
                     /protein_id="AAK86016.1"
                     /translation="MIEIDTITKRYGDTTVVDQVSLTVAPRTVTVIVGTSGSGKTTLL
                     RMINRLVEPTSGTIRIDGEDISAIPGFKLRRQIGYAIQGHGLFPHRTVAENIATVPQL
                     IGWDRQRIKAKIDALMHLFQLDPALYADRFPHELSGGQQQRVGVARALAAEPNILLMD
                     EPFGALDPVIRAKAQNDLLDIQKKLGVTIVLVTHDMDEAFHLADRIAVMDKGRIVQDC
                     PPAELVLKPATDFVRTMIGENERALKLLSVLTVADIVEPGSAEGAPLTEGTSQRDALS
                     AMLWAGRDVLPVIKDDGQPIGRVRRDVLLQRATGAP"
     gene            complement(201953..203098)
                     /locus_tag="Atu0198"
                     /old_locus_tag="AGR_C_335"
     CDS             complement(201953..203098)
                     /locus_tag="Atu0198"
                     /old_locus_tag="AGR_C_335"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, membrane spanning protein
                     (proline/glycine/betaine)"
                     /protein_id="AAK86017.2"
                     /translation="MGVLISCLLLYALFASPFMTFRANRIVQGETRTIFEALPSAAAT
                     LLAAIILLAVFFAFFRFPAWLKLAAALAGLAALAVFVGQAASFLTPDGNSFARVSPSS
                     GFWFLFVGLALLATDCIARLEPKPAIRILLLLLAIAALSAILASGLWNDLSIIKEYTG
                     RADIFWIEAVRHVELAIGSLIAATVAGIPLGILCYKVERLRAGVLNSLNIVQTIPSIA
                     LFGLLIAPLGWIAATVPGAARIGIAGIGMAPAFVALFLYSLLPVVSNTVVGLAGVSHA
                     IREAARGLGMTPVQRLLRVEFPLAMPVILTGIRIVLVQNIGLATIAALIGGGGFGVFV
                     FQGIGQTAMDLVLLGTVPTVLLGFAAAITLDALIDSNLFSAGGRQKP"
     gene            complement(203203..204114)
                     /locus_tag="Atu0199"
                     /old_locus_tag="AGR_C_337"
     CDS             complement(203203..204114)
                     /locus_tag="Atu0199"
                     /old_locus_tag="AGR_C_337"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, substrate binding protein
                     (proline/glycine/betaine)"
                     /protein_id="AAK86018.1"
                     /translation="MNRLMTLTGAGLALAFSVSIAQAQVVVSSKIDTEGGVLGNIILA
                     VLNQNKIETTDRIQLGATPVVRKAITAGEIDIYPEYTGNAAFFFSKADDPLWKDAAKG
                     YEEAKTLDYDANKIVWLAPSPANNTWAIALRKDVADKNNLKTLSDFGKYVAGGGTVVL
                     AASSEFVNSAAALPAFQTTYGFTMKPDQLITLSGGDTAATIAAAANQTNNANAAMVYG
                     TDGGIAPSGLVVLEDDKHVQPVYQPAPIIREEVLKKHPNIEELLKPVFEKLDLATLQD
                     LNARVQVGGEQAKTVAMDFLTKNGFAK"
     gene            complement(204265..205311)
                     /locus_tag="Atu0200"
                     /old_locus_tag="AGR_C_342"
     CDS             complement(204265..205311)
                     /locus_tag="Atu0200"
                     /old_locus_tag="AGR_C_342"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86019.2"
                     /translation="MIIKPEFHTFALTALVGSMGALLASLLHIPAPFLSGPALAVTIT
                     GLAGVKLGIPAFIRNACFVVVGISMGTSVTPSVIDAAKTWPLSFIVVLVAVVIMLYVA
                     YWILHYGFGYDRTTAMLGASPGHLSYIISLGAETKSDLATVSIVQSVRVLALTLSVPL
                     IVEYFDLVSTEPLITNPPMGFFTLALTIAASLLTGWLFLRWKFPAALLLGGVAISIGT
                     HITGLTEGGVPSWLSLPVYVLIGCLIGTRFSNVSLMEVRKGFLAGFVVTIAVMVIAGT
                     IAWLISRVTGVPLNAVMIAYAPGGLETMAAMAVMMHADTAYVGSHHVIRLLFLSVLMP
                     LVMGKDARKRDGDT"
     gene            complement(205480..205950)
                     /gene="aau3"
                     /locus_tag="Atu0201"
                     /old_locus_tag="AGR_C_344"
     CDS             complement(205480..205950)
                     /gene="aau3"
                     /locus_tag="Atu0201"
                     /old_locus_tag="AGR_C_344"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86020.1"
                     /translation="MRLTKQTNYAVRMLMYCAANEGKLSRIPEIARAYGVSELFLFKI
                     LQPLNKAGLVETVRGRNGGVRLGKPAEKISLFDVVRVTEDSFAMAECFEDGAVECPLV
                     DSCGLNSALRKALNAFFDVLAEYSIDDLVKARPQINFLLGIDTEMPKIAALPAA"
     gene            206109..207173
                     /locus_tag="Atu0202"
                     /old_locus_tag="AGR_C_346"
     CDS             206109..207173
                     /locus_tag="Atu0202"
                     /old_locus_tag="AGR_C_346"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, substrate binding protein
                     (iron)"
                     /protein_id="AAK86021.2"
                     /translation="MEAFIMASLKSRFSAAVFSGLTILSLAPAALAEGEVNVYSYRQP
                     ELIQPLLDAFTKETGIETNVLFLDKGLVERIQAEGVNSPADVLLTVDIARLVEAKEGK
                     VTQPVLADPVIEKDIPANLRDPEGEWFGLTTRGRVVYASKERVTQKDITYEELADPKW
                     KGKICIRDGQHSYNIALIASMIAHHGVDYTRTWLTGLKNNLARKPDGTDRSQAKSIFS
                     GECDIALGNTYYVGLMLTNDQEPDEKIWAGSVRVIFPNAGDRGTHVNISGMALTKYAP
                     NRDNALKLMEFLASREAQEIYAKQVFEYPVLSGAEPSDVVKGFGPINPDKLPLTDIAA
                     HRKQASELVDEVGFNDGPTN"
     gene            complement(207198..208115)
                     /locus_tag="Atu0203"
                     /old_locus_tag="AGR_C_347"
     CDS             complement(207198..208115)
                     /locus_tag="Atu0203"
                     /old_locus_tag="AGR_C_347"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86022.2"
                     /translation="MEISHRVGTIPREIHFPDGSLFETSDNEGVDRLLGLYLPKRAGF
                     VHRLEQFRPRLIGITAAAVLLAYGTYKLALPAVVELAVAMTPPIVPKIMSASTMQALD
                     QTVFSASELPLEEQNAIRVQFSRIAAHAEGSPEDYKLNFRKGGYIGPNAFALPDGTLV
                     LTDELVELAGGDRQMIIGVLAHEIGHVEYEHSLRQLYRAAGVAGLVMLIAGDVGSAME
                     DILTQGGGLLALSHSRDAERQADQRSVELMRKADLDPTAIERFFALLEEKLGDKGGTS
                     IISTHPGTPQRRKAIIDYNASLDNKPAGN"
     gene            complement(208258..209361)
                     /locus_tag="Atu0204"
                     /old_locus_tag="AGR_C_349"
     CDS             complement(208258..209361)
                     /locus_tag="Atu0204"
                     /old_locus_tag="AGR_C_349"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86023.1"
                     /translation="MNDISVSADRHAIERGSFNGNAKEYFGIWIVNILLTIMTLGIYS
                     AWAKVRRKRYFNGNTLLAGRAFGYHATGGQIFKGRLIAFAFIVFSQLVGLIHPFLVFA
                     PTILLLIFLPWVITRSIRFNARVTSYRNVRFDFVGTAWGAFVSILLGSFVALLSIGIL
                     APLASRWANRYIVSNLHYGDRRFSTDPKIGALYRAWIIPALLVVVGGVLAVFLLIFLA
                     MVLVQAAGIGSRELATAPENYEIVTLFGLGQILINLLVAMLIYGFASTVYKAGVRNVV
                     VSSTLLDGKHELHSDLHRGRYLWIVFSNLIVTIFTFGLMRPWAAVREAQYAVERMGIS
                     FKGDMGEVLSSMEATGAAVSAEYMDMEGFEFGF"
     gene            complement(209585..211141)
                     /gene="mmsA"
                     /locus_tag="Atu0205"
                     /old_locus_tag="AGR_C_351"
     CDS             complement(209585..211141)
                     /gene="mmsA"
                     /locus_tag="Atu0205"
                     /old_locus_tag="AGR_C_351"
                     /codon_start=1
                     /transl_table=11
                     /product="methylmalonate-semialdehyde dehydrogenase"
                     /protein_id="AAK86024.1"
                     /translation="MLCTNSSAMLHPSKNRGGLPMKEIGHFINGKHVPGASGRTSNVY
                     NPATGEVQATVALASDAELRAAVESAKAAQPKWAATNPQRRARVFFKFVELLNRDLNE
                     LAVLLSSEHGKTVEDSKGDIIRGLEVCEFVCGIPHLQKGEFTEGAGPAIDMYSIRQPV
                     GIGAGITPFNFPGMIPMWMFAPAIACGNAFILKPSERDPSLPIRLAELMIEAGLPAGM
                     LNVVNGDKGAVDAILTDPDIGAVSFVGSTPIARYVYGTAAMNGKRAQCFGGAKNHMII
                     MPDADLDQAVNALMGAGYGSAGERCMAVSVAVPVGEDTANRLVEKLIPQIESLRIGPY
                     TDDKADMGPLVTKEAQTRVRGLIDSGVEQGAKLLVDGRDFKLQGYEDGYFVGGCLFDH
                     VTPDMDIYKTEIFGPVLSVVRAKNYEDALELPMKHEYGNGVAIYTRDGDAARDFASRI
                     NIGMIGINVPIPVPLAYHSFGGWKASSFGDLNQHGTDSIKFWTKTKTITSRWPSGIKS
                     GAEFVMPTMK"
     gene            211253..211570
                     /locus_tag="Atu0206"
     CDS             211253..211570
                     /locus_tag="Atu0206"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAL41229.1"
                     /translation="MASDEPVVRMAEIEIDPTHLEAYRRLLAEEIEASVRLENGVLAL
                     NAVAIKGSPEKLRILEVYANQAAYEAHLQTPHFLKYKEGVAGMVTSLTLIEVEPVMMR
                     SKP"
     gene            211567..212448
                     /locus_tag="Atu0207"
                     /old_locus_tag="AGR_C_354"
     CDS             211567..212448
                     /locus_tag="Atu0207"
                     /old_locus_tag="AGR_C_354"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LysR family"
                     /protein_id="AAK86025.1"
                     /translation="MNWDDVRIFLAVARSGQILAASKRLGLNHATLSRRLTLLEQALK
                     TQLFIRRTNGCEMTEEGQRFLGAAERMETEMLNAQANLGRVDTAVAGTVRIGAPDGLG
                     VSFLAPRLGRLTARYPDLKIQLVPVPRSFSLSQREADIAITIERPEQGRLMFSKLTDY
                     SLGLYASADYLADHGTPDDVEALKRHRRIGYVEDLIFSPSLNYTGEIMRDWDAAFEIS
                     SATGQTEAVRSGAGIGILHNYIAGQYPELMRIMPHLGISRSYWTAYHESARQLVRVRT
                     VVDFLQELVAEERRIFI"
     gene            212655..213491
                     /locus_tag="Atu0208"
                     /old_locus_tag="AGR_C_357"
     CDS             212655..213491
                     /locus_tag="Atu0208"
                     /old_locus_tag="AGR_C_357"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86026.2"
                     /translation="MGKWLVSTYSQGQVILIRSAAALVILVPIVWRAGLSGLVNVERP
                     GLQVARVFFSTAELFCFYFAVASLPLADVMTYWLAAPIYVAALAPFLLGEKVGWRRWT
                     AIAIGFVGVLIALKPSSASLTSAALFSILGSAAFAFMMLSGRQLRNTPDTVLAFWQII
                     GAGLAGIVAVFMTPSGWLPVQSSFDLAFLSLLGVVAMAAHVLVNRALKLADAATVAPL
                     QYTLLLWAVIFGWLFFNDVPQTSIVVGAGLIVFSGLYIFFRENTLKRRRDAADRLAAE
                     QV"
     gene            213782..214888
                     /locus_tag="Atu0209"
                     /old_locus_tag="AGR_C_359"
     CDS             213782..214888
                     /locus_tag="Atu0209"
                     /old_locus_tag="AGR_C_359"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86027.1"
                     /translation="MSAAQKTTLSYFKWAFIVTVVGLILGGYLGWEMTGTIGGTATIF
                     FICAVLAVLEISLSFDNAIVNANKLKDMTPVWQHRFLTWGILIAVFGMRIVFPLLIVV
                     VAANVGPWTALVMAATQPERYAEIMRDAHLPIAAFGGTFLMMVGLNFFFDHEKDVHWV
                     RWIEEKAATYSSVKGIEIAFVLIVMLVFSRIIGASDNPELGPVAANTFFHSAIWGLLT
                     FLLVEVVGGILDRSQEMLEGAAKGGFGAFLYLEVLDASFSFDGVIGAFALTQNLFIIA
                     IGLGIGAMYVRSMTIMLVEKGTLAEYRYLEHGAFYAILILSVIMYVQTMFHIPEVITG
                     LGGATLIGISLWSSIRHNRQQSAGTADAARGAEI"
     gene            215253..215597
                     /locus_tag="Atu0210"
                     /old_locus_tag="AGR_C_361"
     CDS             215253..215597
                     /locus_tag="Atu0210"
                     /old_locus_tag="AGR_C_361"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86028.2"
                     /translation="MPAQLSPTEALGLWHRVSTAQVIDDQPDLTLRQTAILLQIYLVP
                     PPHTVRGLAAMLGVTKPVITRALDSLGALGLVDRVRDERDRRNVVIKRTVAGALYLEK
                     FGDLIIDQARKI"
     gene            215616..216467
                     /locus_tag="Atu0211"
                     /old_locus_tag="AGR_C_363"
     CDS             215616..216467
                     /locus_tag="Atu0211"
                     /old_locus_tag="AGR_C_363"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86029.1"
                     /translation="MMLDRRLNVFRPDLADAKLQGVVEAERFVSGSPAQVTAPVIGLR
                     PTPDLATGIDTELLCGETVRVFDRANGWAWVQADVDGYAGYVPETAIGNVVAATHQII
                     APRTFLYPSAELRKPPVAALSMGSLIRIVGEAETRGTRYLMTEKGEGIIAAHCRALDA
                     ALEEDYVAVALRFIETPYLWGGRSGFGIDCSGLVQLSMAMTGRRVLRDTDMQVKSLGV
                     EIERDELRRGDFVFWKGHVGLMENEETLLHANGHTMNVARENLDAAIERIGWLYEKPT
                     AFRRREG"
     gene            216563..216922
                     /locus_tag="Atu0212"
                     /old_locus_tag="AGR_C_365"
     CDS             216563..216922
                     /locus_tag="Atu0212"
                     /old_locus_tag="AGR_C_365"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK86030.2"
                     /translation="MKTRTATRLAAILTAALLNTSAEAQTVFQNGFAPAPDAYANLPG
                     VKDPRTLQPKVRYNCHSELGVTGYSRGPYRDVFGSRGLPVQGYRCTDENGISSFGGKN
                     PISKDWYPGINPVDPTF"
     gene            217114..218418
                     /gene="pncB"
                     /locus_tag="Atu0213"
                     /old_locus_tag="AGR_C_367"
     CDS             217114..218418
                     /gene="pncB"
                     /locus_tag="Atu0213"
                     /old_locus_tag="AGR_C_367"
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate phosphoribosyltransferase"
                     /protein_id="AAK86031.2"
                     /translation="MTKTDIATRVHNHTWKLDPIVRSLIDTDFYKLLMLQMIWKLYPE
                     VDATFSLINRTKTVRLAEEIDEMELREQLDHARTLRLSKKENIWLAGNTFYGRSQIFE
                     PEFLSWLSSYQLPEYELFKRDGQYELNFHGRWMDTTLWEIPALSIINELRSRSAMRSL
                     GYFTLDVLYARAKAKMWEKVERLRELPGLRISDFGTRRRHSFLWQRWCVEALKEGIGP
                     AFTGTSNVLLAMDSDLEAVGTNAHELPMVVAALAQTNEELAAAPYQVLKDWNRLYGGN
                     LLIVLPDAFGTAAFLRNAPEWVADWTGFRPDSAPPIEGGEKIIEWWRKMGRDPRTKML
                     IFSDGLDVDAIVDTYRHFEGRVRMSFGWGTNLTNDFAGCAPKTIASLKPISIVCKVSD
                     ANGRPAVKLSDNPQKATGDPAEVERYLKFFGEEDHKEQKVLV"
     gene            complement(218477..219871)
                     /locus_tag="Atu0214"
                     /old_locus_tag="AGR_C_368"
     CDS             complement(218477..219871)
                     /locus_tag="Atu0214"
                     /old_locus_tag="AGR_C_368"
                     /codon_start=1
                     /transl_table=11
                     /product="leucine aminopeptidase"
                     /protein_id="AAK86032.1"
                     /translation="MAPYQFIERPTPFSSKAGSTLPVFAVTPAHIEQGAIDPVALDWA
                     KKAGFKAEAGAVLLVPSSDGSLGGVLLGLGGNPSEVPFITGKLARELPEGEWHIETAP
                     LTANRLALGFGLGSYRFDKYKTTKTSGAKLLIPQDAEDGEIKRVLAGVFLARDLINVP
                     ANDMGPDELEIAFRALAAHYKAKVNVTTGDDLLKENFPLIHAVGRASESAPRLLEMNW
                     GKKGNPRLTLVGKGVCFDTGGLDIKPAASMALMKKDMGGAANVLGLALMIMDAKLPVD
                     LRVLVPAVENSISANAFRPGDIYKSRKGLTVQIDNTDAEGRLVLADALAYADEDAPDL
                     MIDMATLTGAARVALGPDLPPFYTDDADLAHDIAEASIDTDDPLWRMPLYMGYDKDIR
                     SRAADITNAPSGGMGGSITAALFLKRFVTNTKRWAHFDIYGWSLSERHHSSIGGEAQG
                     IRALFHYIAHQFAK"
     gene            220014..220838
                     /locus_tag="Atu0215"
                     /old_locus_tag="AGR_C_369"
     CDS             220014..220838
                     /locus_tag="Atu0215"
                     /old_locus_tag="AGR_C_369"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86033.2"
                     /translation="MTAFSLGETRRTGLLRGACLAALVLAVSGCASTNKPDRMSTGSI
                     PAATRSYDHLNMEQLRQAEETAGKAYERNPKDRSVGMNYASVLMMTGKNTQALAVMQQ
                     IAIANPADREVLAAYGKSQAAAGQLEQALSTIQRAQTPDRPDWRLYSAEGAVLDQLGR
                     SNEARSRYRQALDLKPNDPSVLSNLGMSYVLSSDPRTAETYLQSAISQPGADSRVRQN
                     LALVVGLQGRFAEAERIAVQELSAQQAQANLTYLRAMLSQQNSWQQLAKKDRKPAG"
     gene            complement(220902..221888)
                     /gene="ctpI"
                     /locus_tag="Atu0216"
                     /old_locus_tag="AGR_C_371"
     CDS             complement(220902..221888)
                     /gene="ctpI"
                     /locus_tag="Atu0216"
                     /old_locus_tag="AGR_C_371"
                     /codon_start=1
                     /transl_table=11
                     /product="components of type IV pilus"
                     /protein_id="AAK86034.1"
                     /translation="MTGDLFSRLTDPQTIIAILVTLAVFATLYTLIMPFLERKDLAKR
                     MKAVSSERELIRSRERERLATVTRDGRTSLRGNNNKSARRIVEKFNLREALADQNTMN
                     KLRAAGFRSQNALNTFLAARFVLPFIFLAVAFTWVFVLGNLADKAFVVRLMAVLVFGY
                     IGFYAPNIYVSNRMTKRQASIKRAWPDALDLMLICIESGVSMESAMRRVAEEMGEQSP
                     ELAEEMILTTAELSFLQDRRTALENFGMRTQLDGVKSVVQALIQAERYGTPLAQALRV
                     LAQEGRDERMNEAEKKAAALPPKLTVPMIIFFLPVLIAVILGPAGIRVADTF"
     gene            complement(221898..222902)
                     /gene="ctpH"
                     /locus_tag="Atu0217"
                     /old_locus_tag="AGR_C_372"
     CDS             complement(221898..222902)
                     /gene="ctpH"
                     /locus_tag="Atu0217"
                     /old_locus_tag="AGR_C_372"
                     /codon_start=1
                     /transl_table=11
                     /product="components of type IV pilus"
                     /protein_id="AAK86035.1"
                     /translation="MDPTIVLLAVLVAISAGALAYAFLFQQIEVEKKTTSRFKRVQAA
                     ETDHTNIKAARDRVQELSKRRKSMQDSLRDMEKKQNEKAKKAKNVSLRDKLVQAGLTI
                     SVRQFHLLSAGAAACAAFISLIYGLSLLTALPIAVVAALGLPRWVLAFLLKRRQKKFL
                     EEFPNALDVMCRSIKSGLPLNDAVRLIASDGQEPVKTEFQRVVDAQQVGIGIPQGIER
                     MMLTMPLFEVSFFSIVINIQAQAGGNLSEALSNLSRVLRDRRKMRAKVNALSMEAKAS
                     AVIIGALPFIVMLLVHFTSPDYLSILFTDTRGHLILGASAIWMLIGIFIMRQMINFDI
                     "
     gene            complement(222917..224392)
                     /gene="ctpG"
                     /locus_tag="Atu0218"
                     /old_locus_tag="AGR_C_373"
     CDS             complement(222917..224392)
                     /gene="ctpG"
                     /locus_tag="Atu0218"
                     /old_locus_tag="AGR_C_373"
                     /codon_start=1
                     /transl_table=11
                     /product="component of type IV pilus"
                     /protein_id="AAK86036.2"
                     /translation="MFGKRGPEGPARSTKLEPVAPAVSMQVATASEPRSPATDTLEPG
                     QSPVTRQVTTGAPLSQKKRARTEDYYNTKSQVFSALIDTIDLSQLAKLDAESAREEIR
                     DIVNDIITIKNFAMSIAEQEELLEDICNDVLGYGPLEPLLARDDIADIMVNGSGQTFI
                     EVGGKTIESDIRFRDNAQLLSICQRIVSQVGRRVDESSPICDARLPDGSRVNVIAPPL
                     AIDGPALTIRKFKRDKLTLDQLVRFGAITPEGATLLKIIGRVRCNVVISGGTGSGKTT
                     LLNCLTSFIDKDERVITCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLR
                     MRPERIVVGEVRGPEVFDLLQAMNTGHDGSMGTLHANTPRECLSRIESMIAMGGFTLP
                     AKTVREIISGSIDVVIQAARLRDGSRRITQITEVIGMEGDVIVTQDLMRYEIEGEDAQ
                     GRLIGRHVSTGISKPHFWDRARYYGEDKRLAAALDEMEKSS"
     gene            complement(224426..225709)
                     /gene="ctpF"
                     /locus_tag="Atu0219"
                     /old_locus_tag="AGR_C_376"
     CDS             complement(224426..225709)
                     /gene="ctpF"
                     /locus_tag="Atu0219"
                     /old_locus_tag="AGR_C_376"
                     /codon_start=1
                     /transl_table=11
                     /product="components of type IV pilus"
                     /protein_id="AAK86037.2"
                     /translation="MSAVEYDIKLSGGAEAEPPLRASDMDRLRPLPRISIHAFCVSDT
                     MQAVMEALSSDRRLSRVTLRVTKGDINAAATMFSASPTPNLIILETASATASLLNDLA
                     PLAEVCDPSTRVIIIGRHNDITLYRDLIRNGISEYLVAPVNMADLLGSIAAIFVDPEA
                     EPLGRNIAFIGAKGGVGSSTIAHNCAFGISSLFSTETILADMDLAYGTANIDFDQDPA
                     QGMAEAVFSPERLDEVFLDRLLTKCSDHLSLLAAPSLLDRTYDLDRQAFLPILEVLQR
                     SAPVAVLDLPHQWCDWTRAVLAEADEVVITAVPDLANLRNTKNLFDALIKLRPNDKLP
                     HLVLNQVGMPKRPEITPADFLEPLEIEPIAIIPFDAQLFGNAANSGRMISEMDEKSQT
                     AETFSQIAHTITGRSVLRKNRRGGLEKLKNILKRK"
     gene            complement(225744..226325)
                     /gene="ctpE"
                     /locus_tag="Atu0220"
                     /old_locus_tag="AGR_C_378"
     CDS             complement(225744..226325)
                     /gene="ctpE"
                     /locus_tag="Atu0220"
                     /old_locus_tag="AGR_C_378"
                     /codon_start=1
                     /transl_table=11
                     /product="components of type IV pilus"
                     /protein_id="AAK86038.2"
                     /translation="MTTNAIPDDYRTRHPITLSEAEHSLDIPVSAGDSRLTTAMADNV
                     RGFAQNYASMSTGIVNIQMPSGSPNSATAARMAKQIRSTLSGAGVAQGKIMETRYAAS
                     PNGDSAPIRLSYVAVTAMTGQCGQWPEDLSDNTFANKNWYNFGCASQSNLAAQIANPM
                     DLVGPRGMSPIDAERRAVVIDTYRSGTATAPTN"
     gene            complement(226493..228076)
                     /gene="ctpD"
                     /locus_tag="Atu0221"
                     /old_locus_tag="AGR_C_379"
     CDS             complement(226493..228076)
                     /gene="ctpD"
                     /locus_tag="Atu0221"
                     /old_locus_tag="AGR_C_379"
                     /codon_start=1
                     /transl_table=11
                     /product="component of type IV pilus"
                     /protein_id="AAK86039.1"
                     /translation="MTGGLMTKRFKHHLRSSMAGGLAFCLTFSGVPGRHSPDFLRTSE
                     AEAQSASIVRITESGTGIRKRLKLGLNKALVIDLPEDAHDILVADPSLADAVTRTSRR
                     IYLFGKMVGQTNIFIFGDGGREIVSLDLEVERDISGLEANIRRFIPESDIKVEIVSDN
                     IVLTGSVRTPQDSARAVQLADAFLKGGEATTRNISLTGGNNGGDAAIFAERRQVSQIV
                     NMLTIEGEDQVTLKVTVAEVSRQVLKQLGFNGSISSSTSGNGFEFANPSNLGNAIDGA
                     SRIASGAIGSGSLRFASYLNAMEQAGVMRTLAEPSLTAISGEQAKFYVGGDFRLAAEQ
                     EVDIDKETGRPTITRTTNTVDYGITLNFKPVVLSPGRISLKIETNVSEPTYEGNVVTG
                     NGGRTIPGSTYMSVRKRETSTTVELPSGGSIVIAGLVQDNVRQAMSGLPGMSKIPIFG
                     TLFRSKEFLRNETELVIIATPYLVRPVARNQIARPDDNFNPENDAAMYFMNRVNKVYG
                     RKDQVQAAPYQGSVGFIYK"
     gene            complement(228073..228879)
                     /gene="ctpC"
                     /locus_tag="Atu0222"
                     /old_locus_tag="AGR_C_380"
     CDS             complement(228073..228879)
                     /gene="ctpC"
                     /locus_tag="Atu0222"
                     /old_locus_tag="AGR_C_380"
                     /codon_start=1
                     /transl_table=11
                     /product="components of type IV pilus"
                     /protein_id="AAK86040.1"
                     /translation="MKPSRIVILSVALVAAGLAGLVAMQISGAKQVIEKAETIIQKEP
                     TVNVLISSVNLPVGSRLNDSSMRWTPWPQGNVVDSFITQAKRPDAITELAGTVVRLPL
                     FEGEPIRPEKVVDSSTRIMSSLLPAGKRAVATEISVSTGAGGFVLPNDRVDVIMVRKG
                     ENGNFLTENVLNNVRVLAIDQQIKEGEDGIAAVVGATATLELTPEQAKIITVAQQMAD
                     RLTLALRSVADAQENDTLSAGHLLSGSSGQPEIQVIKSGSIVKSGQGASQ"
     gene            complement(229013..229525)
                     /gene="ctpB"
                     /locus_tag="Atu0223"
                     /old_locus_tag="AGR_C_382"
     CDS             complement(229013..229525)
                     /gene="ctpB"
                     /locus_tag="Atu0223"
                     /old_locus_tag="AGR_C_382"
                     /codon_start=1
                     /transl_table=11
                     /product="components of type IV pilus, prepilin peptidase"
                     /protein_id="AAK86041.1"
                     /translation="MIVAAIFLILPLCLCFAALNDLFSMTIPNVITVVLLLSFAFIAP
                     FAGMDFQTFGLSLAGGLIVFLGCFALFAANVMGGGDAKLLTGAAVWYGFNISLVEFLL
                     AVTLVGGALTVGILLLRSRSQEIMAFGIPIPDSLMVAQKIPYGIGIAIAGLLTYGEAP
                     LVKAAIASIL"
     gene            complement(229627..229818)
                     /gene="ctpA"
                     /locus_tag="Atu0224"
                     /old_locus_tag="AGR_C_383"
     CDS             complement(229627..229818)
                     /gene="ctpA"
                     /locus_tag="Atu0224"
                     /old_locus_tag="AGR_C_383"
                     /codon_start=1
                     /transl_table=11
                     /product="components of type IV pilus, pilin subunit"
                     /protein_id="AAK86042.2"
                     /translation="MTKIFARFLKDESGATAIEYGLIAALISVAIIGGASTLGGKLKD
                     TFTFIGKSFTDSKASTGGV"
     gene            complement(229889..230143)
                     /locus_tag="Atu0225"
     CDS             complement(229889..230143)
                     /locus_tag="Atu0225"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAL41248.1"
                     /translation="MRMIVTCNEMVFSSLFNRLKTEHVRLHETALLKKRKVIRLKIHL
                     FIRKYKNAENTFNFYLPRGTHPSVYFELIVFFKRLEIARL"
     gene            230262..230645
                     /locus_tag="Atu0226"
                     /old_locus_tag="AGR_C_384"
     CDS             230262..230645
                     /locus_tag="Atu0226"
                     /old_locus_tag="AGR_C_384"
                     /codon_start=1
                     /transl_table=11
                     /product="PilQ"
                     /protein_id="AAK86043.2"
                     /translation="MVGLSVFLGAAAQPVFAQDDILRVSMNHARVLRLDRPVSKVIVG
                     NSKVADATVADATTIVLTGRSFGTTNLVLLDAEGNPIVDERILVSIDEGNTVRVFRQT
                     ERTVLSCTPNCEQHSQNSGDKDAQP"
     gene            complement(230832..230918)
                     /locus_tag="Atu0227"
     tRNA            complement(230832..230918)
                     /locus_tag="Atu0227"
                     /product="tRNA-Leu"
     gene            complement(231038..231343)
                     /locus_tag="Atu0228"
                     /old_locus_tag="AGR_C_387"
     CDS             complement(231038..231343)
                     /locus_tag="Atu0228"
                     /old_locus_tag="AGR_C_387"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86045.1"
                     /translation="MTETKPRIAIRYCTQCNWLLRAGWMAQEILQTFASDIGEVSLIP
                     STGGLFEITVDGTIIWERKRDGGFPGPKELKQRIRDLIDPERDLGHVDRTKHEGLDT"
     gene            231481..231930
                     /locus_tag="Atu0229"
                     /old_locus_tag="AGR_C_388"
     CDS             231481..231930
                     /locus_tag="Atu0229"
                     /old_locus_tag="AGR_C_388"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86046.2"
                     /translation="MAQFENNRQRLFVPAVAPLYNSTHDLVETILRVAAGLLLVTHGF
                     GKIVNPFGAVGMVESLGFHPGVFWSPLLAATEFFGGILVAIGLFTRPASFAAMIVLLV
                     TVYFHGIVKAEGLGGAEKSILWAAIFLFFAVRGGNRHSVDAKLTREF"
     gene            complement(231934..232092)
                     /locus_tag="Atu0230"
     CDS             complement(231934..232092)
                     /locus_tag="Atu0230"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAL41252.2"
                     /translation="MFSMIATRIRPLGDDDGLNRQKLPIESSFTTGKNDFQERGIVFE
                     AVADGAAF"
     gene            232091..232765
                     /gene="guaA"
                     /locus_tag="Atu0231"
                     /old_locus_tag="AGR_C_389"
     CDS             232091..232765
                     /gene="guaA"
                     /locus_tag="Atu0231"
                     /old_locus_tag="AGR_C_389"
                     /codon_start=1
                     /transl_table=11
                     /product="GMP synthase"
                     /protein_id="AAK86047.2"
                     /translation="MAGTPHGQIGVALREAAADIHIIRAYAGDPLPEDADDHDALVVL
                     GGEQNAVDDVLYPYLPDLALLMKAFGDAGKAVMGVCLGSQLLARAYGGENILSGPPEF
                     GWQDVSLTPEGLSDPLLAGQQQNFPIFQWHCDTFTLPPDATRLATNAATQNQAFRIGR
                     AAYGTQFHFEASTEVVDEWCRRFPGSVERMSPGWLENYGDHRGTRAQMADMTGLEIAR
                     AWIRLI"
     gene            232853..233041
                     /locus_tag="Atu0232"
                     /old_locus_tag="AGR_C_390"
     CDS             232853..233041
                     /locus_tag="Atu0232"
                     /old_locus_tag="AGR_C_390"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86048.1"
                     /translation="MYKFEIYQDKAGEYRFRFKASNGETMFSSEGYKAKASAIHAIES
                     IKRNSAGADTVDLTTMTA"
     gene            233224..234321
                     /locus_tag="Atu0233"
                     /old_locus_tag="AGR_C_393"
     CDS             233224..234321
                     /locus_tag="Atu0233"
                     /old_locus_tag="AGR_C_393"
                     /codon_start=1
                     /transl_table=11
                     /product="lysozyme"
                     /protein_id="AAK86049.2"
                     /translation="MRSSAVPALLFGCLLLGGCTSSSGPESLMAGLPSKETTSSVKPS
                     APVPQASVGTQPITAQPRQEVLAWGGPVPDEPKAFSAVTPKASLPQNAPEIRLPVPSQ
                     TGMVRPAERPMERPVQLAMAAAPAASAGAQIRSRIFRSSFSDAKPINFGRVQPRHFQV
                     HGVDVSRWQANIDWPQLRTRGANFAFIKATDGGDHLDPMFRTNWQRAKEAGIRRGAYH
                     FFYWCRNASEQADWFIRNVPRDPDALPPVIDVEYNGESSCKMRHSRERVLEKMRVFMD
                     KLERHYGQRPIIYTAPDFYKDNLQGEFHDYPFWLRAVAQHPSAVYPGRKWLFWQYSGS
                     GLSHGVDGRIDLNVFNGSEESWHRWVDRRSS"
     gene            complement(234325..235200)
                     /locus_tag="Atu0234"
                     /old_locus_tag="AGR_C_394"
     CDS             complement(234325..235200)
                     /locus_tag="Atu0234"
                     /old_locus_tag="AGR_C_394"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein, membrane
                     protein"
                     /protein_id="AAK86050.1"
                     /translation="MDKTTSGWLNGLTGVVIFSGSLPATRLAVTGFDPVFLTAARASI
                     AGLLALALLFLFRQKRPARGDLTSLIIVSIGVVVGFPLLTALALRHVTSAHSIIFVGL
                     LPLATAIFAVMRGGERPRPVFWLFSCLGSALVAGFSLSNSFAARIEASLAGDLLMLGA
                     IIVCGLGYAEGAALSRKLGGWQVISWALVLSLPVMLPLAFFTGPETLGGIDPQAWGGL
                     AYVSLFSMLIGFIFWYRGLALGGIAAVGQLQLLQPFFGLALAATLLHEEVSPAMIGVT
                     LVVVLCVAGARKFAR"
     gene            235332..236705
                     /locus_tag="Atu0235"
                     /old_locus_tag="AGR_C_398"
     CDS             235332..236705
                     /locus_tag="Atu0235"
                     /old_locus_tag="AGR_C_398"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, GntR family"
                     /protein_id="AAK86051.2"
                     /translation="MAGTRIEKVMANIRQRITSRSLVPGARLPSVRALAKTMQLSTST
                     IVEAYDRLVADGTISSRPGSGFFVAGPLAPLSLADIEPRLDRAVDPLWVSRQALDDGS
                     ALAKPGCGWLPASWMPQEALRRAMRGLARADDALLTDYGSPMGLLPLRQLLSRRLAEH
                     GVQAGASQIMLTDSGTQAIDLLCRFLLQPGDTVVVDDPCYFNFHALLRAHRVKIVGVP
                     YTPAGPDLPLFEQALKEHQPRLYITNSAIHNPTGARLSAVSAHRLLMLAEQPGLTIIE
                     DDIFADFETQAAPRLAAFDGLNRVVQIGSFSKTLSASVRCGFIAAPRAWVEALTDLKI
                     ATAFGGTHFSAALVLSLLTDGSYRKHVEALRQRLAAAVPEAATRLRSIGCMPWIEPQA
                     GMFLWCRLPEGTDAADVAQRALARQVVLAPGNVFSSSQNASGFMRFNVSQMVGPQVMT
                     VLADALR"
     gene            236801..237118
                     /locus_tag="Atu0236"
                     /old_locus_tag="AGR_C_401"
     CDS             236801..237118
                     /locus_tag="Atu0236"
                     /old_locus_tag="AGR_C_401"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86052.1"
                     /translation="MTFDPNNPRPDRDLRPELNISNEPQARTSSSWVPWLAIIVVVLV
                     GVFAWSQMSGPTTDPATTSSTTPPAATDQAPAPMAPTTPATPPVNNTAPASPNTGGTQ
                     TQP"
     gene            complement(237190..237648)
                     /locus_tag="Atu0237"
                     /old_locus_tag="AGR_C_402"
     CDS             complement(237190..237648)
                     /locus_tag="Atu0237"
                     /old_locus_tag="AGR_C_402"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86053.1"
                     /translation="MRHDTRLSRVLHILIHMEKHEGAATSENIAAMLQTNPVVVRRTM
                     AGLREHGYVSSEKGHGGGWVLAQPLTEITLLDIYRALGAPELFSIGLAGDNPNCVIEQ
                     AVNAALFDAMNEAENILLSRFGSITLSTLAEESIDRWSKLSNCPSAMEQL"
     gene            237803..238696
                     /locus_tag="Atu0238"
                     /old_locus_tag="AGR_C_405"
     CDS             237803..238696
                     /locus_tag="Atu0238"
                     /old_locus_tag="AGR_C_405"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="AAK86054.1"
                     /translation="MKFDVIIIGGSYAGLSAALQLGRARKNILLVDAGERRNRFASHS
                     HGFLGQDGKAPGEIIAEARRQIERYPTIHWVEGRVTDAKGSFGEFIVEIDGGRRETAG
                     RLILAMGVTDELPEIAGLRERWGSAVFHCPYCHGYELDQGKIGVIAASPMAIHHALML
                     PDWGETTFFTNGIVEPDADQHALLAARGVRVETTRIREIAGHADVVLADGRSIALAGL
                     FTQPKLRITVDWIEKLGCAVEEGPMGSTIVTDPMKQTTARGIFACGDVARPAGSVALA
                     VGDGAMAGAAAHRSILFPEMR"
     gene            complement(238693..239589)
                     /locus_tag="Atu0239"
                     /old_locus_tag="AGR_C_407"
     CDS             complement(238693..239589)
                     /locus_tag="Atu0239"
                     /old_locus_tag="AGR_C_407"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, AraC family"
                     /protein_id="AAK86055.2"
                     /translation="MTAILVSNMRTQSGCGYEREAILAPRGSNDLERSCKFEGIVQAR
                     SSEGIERIDARFHGNAYAPHRHDTYALGVTLSGVQTFSYRGTSHFSMPGNVIVLHPDE
                     IHDGGAGTDEGLHYRMLYLPPEKTTEAGYNTLPFARSAVIEDEEFRQCLTEALGNLDG
                     EPDSLLLTDWQSRLSDLLWKHSNGSARSIKWIDRAAVLLCRDYLLENSADTVVSQELE
                     QISGLDRFTLFRHFRCVFGTSPHRYLIMRRLQKCKDMMRAGASLAETAFACGFADQAH
                     FTRHFKNAFGMPPGRWLSLVSH"
     gene            239564..239971
                     /locus_tag="Atu0240"
                     /old_locus_tag="AGR_C_408"
     CDS             239564..239971
                     /locus_tag="Atu0240"
                     /old_locus_tag="AGR_C_408"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86056.1"
                     /translation="MFDTKIAVILRDDLAVWQKLNVTAFLMSGIVAQTGEIIGEPYRD
                     GAGNVYNPLSIQPIVVMATDQEALRKIHQRSLERDITTSLYIEEMFATGHDAANRQVF
                     SHFSPDTAKVVGMALRADRKIVDKITKGAKLHA"
     gene            complement(240039..241865)
                     /gene="lepA"
                     /locus_tag="Atu0241"
                     /old_locus_tag="AGR_C_411"
     CDS             complement(240039..241865)
                     /gene="lepA"
                     /locus_tag="Atu0241"
                     /old_locus_tag="AGR_C_411"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein LepA"
                     /protein_id="AAK86057.1"
                     /translation="MSTNSTRTPLDHIRNFSIVAHIDHGKSTLADRLIQSTGGLAERD
                     MSEQVLDSMDIERERGITIKAQTVRLHYKANNGETYVLNLIDTPGHVDFAYEVSRSLS
                     ACEGSLLVVDASQGVEAQTLANVYQAIDNNHELVTVLNKIDLPAAEPERIKEQIEEVI
                     GIDASDAVMISAKTGLGIPDVLEAIVNRLPPPKSDVGENGPLKALLVDSWYDTYLGVM
                     VLVRVIDGVLTKGQQIRMMGSGAKYGVERVGVLTPKMVNVDSLGPGEIGFITASIKEV
                     ADTRVGDTITDDKRPTAQALPGFKPAQPVVFCGLFPVDAADFEDLRAAVGKLRLNDAS
                     FSFEMESSAALGFGFRCGFLGLLHLEIIQERLEREFNLDLVATAPSVVYEMTLTDGTE
                     KELHNPADMPDVVKIKEIREPWIKATILTPDEYLGGILKLCQDRRGLQTELTYVGNRA
                     MITYELPLNEVVFDFYDRLKSISKGYASFDYNIIDYREGDLVKMSILVNGDPVDALSM
                     LVHRSAADRRGRGMCEKLKELIPPHMFQIPIQAAIGGKVIARETVRALRKDVTAKCYG
                     GDATRKRKLLDKQKEGKKRMRQFGKVEIPQEAFIAALKMNDE"
     gene            complement(241938..242807)
                     /locus_tag="Atu0242"
                     /old_locus_tag="AGR_C_413"
     CDS             complement(241938..242807)
                     /locus_tag="Atu0242"
                     /old_locus_tag="AGR_C_413"
                     /codon_start=1
                     /transl_table=11
                     /product="carbon-nitrogen hydrolase"
                     /protein_id="AAK86058.1"
                     /translation="MTRLAASQYAIELIETWEAYAAHLSAIVREAKEKGAELLLLPEY
                     SAMALTGQLPPDARSDLHRSIEEIQPLIPSWVELCEELARQHQILFQPGSAPVKDPDG
                     RFRNRAWLFGPDGLIGYQDKQIMTRFEREQWNIHAGVEGLKAFETSIGRLGILICYDN
                     EFPMLGRKLAELGVELVLAPSCTDTLAGAYRVRIGAQARALENQYAVLSSPTAGEAPW
                     SPAVDENRGRAALYVPSDYGMPASGILAESESDAVTESLMLIADIDLATVARLRTEGQ
                     VATRRDWPEQFAV"
     gene            complement(242804..243415)
                     /locus_tag="Atu0243"
                     /old_locus_tag="AGR_C_414"
     CDS             complement(242804..243415)
                     /locus_tag="Atu0243"
                     /old_locus_tag="AGR_C_414"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86059.2"
                     /translation="MPMTVEIKSLSGIDAEPYFDDLARLRIEVFRAFPYLYDGSLDYE
                     RKYLATYADTDGAVFVLALDDGRVVGMSTGMPMIAETDEVKTPFLKTGYDPNRIFYFG
                     ESVLLHDYRGHGIGVRFFEEREAHAKRLGFDWCTFCAVERPADHPRRPADYVPLNEFW
                     EKRGYRHHPELRTSFTWQDLDESSESAKPLSFWMKTIAGDVNE"
     gene            243482..243883
                     /locus_tag="Atu8117"
                     /old_locus_tag="AGR_C_416"
     CDS             243482..243883
                     /locus_tag="Atu8117"
                     /old_locus_tag="AGR_C_416"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86060.1"
                     /translation="MTAAETIRAYYDAFNRQDMDAFLALLHDEVVHDINQGERQTGKA
                     AFASFMDHMNRCYRENLTDMVIMASEDGKRASAEFVVNGEYLKTDEGLPEANGQKYVL
                     PAGAFFDLKDGKVSRVTNYYNLNDWIAQVGA"
     gene            243980..244561
                     /locus_tag="Atu0245"
                     /old_locus_tag="AGR_C_418"
     CDS             243980..244561
                     /locus_tag="Atu0245"
                     /old_locus_tag="AGR_C_418"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="AAK86061.2"
                     /translation="MMETEDRILERSIGERIKVLRAESGLTLERLASESGVSRAMISR
                     IERGEASPTASLLARICAALGLSLSGFFAENEEAVSPLVKKRDQQLWKDPETGYVRRA
                     ISPPRVGSDVDIVEVEFPAGARVGFPPHAASRGMTQYVWLFEGVLEMTSGGVVHLMDP
                     GDCLFMPVGEGHVFHNPSQKPARYAVVLDQRQR"
     gene            244579..245097
                     /locus_tag="Atu0246"
                     /old_locus_tag="AGR_C_420"
     CDS             244579..245097
                     /locus_tag="Atu0246"
                     /old_locus_tag="AGR_C_420"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="AAK86062.1"
                     /translation="MATIRVLNGQETIDALPELCDVLAECVKGGASVGFMLPFSPRDA
                     EPYWRSVAENVGEGGTIHVVAEVDGRVVGTVQVGLASKPNQPHRGDLMKLLVHPEARG
                     LGLARKLMEKAEQEAAARGRTLLVLDTATGSDAEAIYPRLGWQRVGVIPDYALFPDGR
                     YCGTTLFYKRIG"
     gene            complement(245112..246185)
                     /locus_tag="Atu0247"
                     /old_locus_tag="AGR_C_423"
     CDS             complement(245112..246185)
                     /locus_tag="Atu0247"
                     /old_locus_tag="AGR_C_423"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86063.2"
                     /translation="MRTFTTITTFLFSALAIQPLFAGEAVGVSDIAIHSPDRGKDLAV
                     TIWYPSDGKGTQVLSGEDRIFQGTPAFKDAAVQPGRLPLVLLSHGSGSRVSGMAWIAE
                     KLASEGFIVAGTNHPGTTSGDSTPADTPKIWERTSDLSAIVTALTTQGKWSASIDAGR
                     IGVLGFSLGGSAAMEISGARADLEAYARYCEKEAAMMDCQWFDGGQAYVNNEPVSVPK
                     LDLRTLDKARFEQQNRDPRIRSAVLVDPGLALAFQPESLRKIDIPLTFINLGSKGKIP
                     PAVLADRLAAEVPGATYRQVDEADHFSFLPLCKEGASAFLKSVGERDPICEPTGPRDR
                     SDIHAELEKMIVAAFNRTLKPGQ"
     gene            246323..247420
                     /locus_tag="Atu0248"
                     /old_locus_tag="AGR_C_425"
     CDS             246323..247420
                     /locus_tag="Atu0248"
                     /old_locus_tag="AGR_C_425"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, AraC family"
                     /protein_id="AAK86064.1"
                     /translation="MFVLFIPLPFVVGLLLVVMFIVFLRSGDDVRTNRAFLASIALCA
                     VQSVLVGLRWGYGISEMRYALPILAACLPPLIYIAFRGLMGAGVESRRVMLASLALSP
                     LLIVVLEFAFPAAIDIALITIFVGHAVALLLLGRKGPDGLDEAQFASVASAHRALIIA
                     AVALCVSALFDLLVFFDFEWAQGQNVAALVSNANLFGLLLIGLMAALAGKSKAPQTAA
                     EPISDLSSPAEPSEQDRDIVARVDRLMEVQALYRDENLNLSRLARRLGLPSRQISGAI
                     NRSLGVNVSQYVNQLRIREACRLLEETEQSVTAIMLSAGFQTKSNFNREFRRVTGMSP
                     VDWREREVWKLVSNTKTATWQMPDGRLRILK"
     gene            complement(247424..248527)
                     /locus_tag="Atu0249"
                     /old_locus_tag="AGR_C_426"
     CDS             complement(247424..248527)
                     /locus_tag="Atu0249"
                     /old_locus_tag="AGR_C_426"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, substrate binding protein
                     (sugar)"
                     /protein_id="AAK86065.1"
                     /translation="MDRRSFIRKAGAVGAGVTATALAAPAIAQENPKITWRMTSSFTK
                     GLDILFGAGQIVADHVKEASGGNFVIQHFAGGEIVPALQAADAVTAGTVEMAHTCSYY
                     YVGKDPTFALGTSVPFGLNARQTNAWFNQAGGNELLNEFLAQHNIYSILLGNTGAQMG
                     GWFRKEINTIDDLKGLKMRIAGLTGQVMQKVGVTPQQIAGGDVYAALEKGTIDATEFV
                     GPYDDQKLGFYKVAKYYYYPAWWEGGPAVHAFVNLQKFNDLPENYKRILKDACAAGSA
                     SMLERYDARNPKALKELVAQGAILRPFSQEILDVCHKAAQDTYAEISAKNESFKKIYE
                     SQQAFKKDAYLWAQIAEYTYDTYMMIQQRNGTL"
     gene            complement(248655..249062)
                     /locus_tag="Atu0250"
                     /old_locus_tag="AGR_C_428"
     CDS             complement(248655..249062)
                     /locus_tag="Atu0250"
                     /old_locus_tag="AGR_C_428"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86066.2"
                     /translation="MAEIGVDAAFIDLLVETFYGRVLEHQTLGPVFDARLAGRWPEHM
                     ARMKQFWTAIAFKNGSYGGKPVQAHLGVQGMSAELFPQWLALFSVTLDDIAPSRKAHD
                     WFMETAERIARSLTLSLFYNPAMDDPAVKRSRS"
     gene            249269..250252
                     /locus_tag="Atu0251"
                     /old_locus_tag="AGR_C_430"
     CDS             249269..250252
                     /locus_tag="Atu0251"
                     /old_locus_tag="AGR_C_430"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86067.1"
                     /translation="MFRSLFSLSKRPFSSLGEQEILALAISSEEDDSRIYRSYADHLR
                     AQYPQSAKVFEDMAEVEQQHRNVLIDMHRRRFGETIPLIRREHVRGFYERTPDWLVKN
                     LSLEKIRAQAELMEAQAIRFYDEAVKRTTDASTRKLLGDLAEAERGHEDIAQMLEEKH
                     LDEGGRTEEEETAKRQFLLTYVQPGLAGLMDGSVSTLAPIFAAAFATQDTWQTFLIGL
                     SASVGAGISMGFTEAAHDDGKLSGRGSPLKRGLASGIMTAVGGLGHALPYLIPHFWTA
                     TAIAAIVVFVELWAIAFIQNRFMETPFLRAVFQVVLGGSLVLAAGIIIGNA"
     gene            complement(250317..250832)
                     /locus_tag="Atu0252"
                     /old_locus_tag="AGR_C_433"
     CDS             complement(250317..250832)
                     /locus_tag="Atu0252"
                     /old_locus_tag="AGR_C_433"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86068.2"
                     /translation="MVTGGITSQPIGHYEFCQKYADECNIRSKVTPPPRVTDYGWGVI
                     REINTSVNTTIVAMTDQEIYGKDEVWEYPTTAGDCEDFVLLKRKKLIERGFSVADLLI
                     TVVRKPDGEGHAVLTLRTTDGDYILDNLTDDVKLWTDTNYTYLKRQASFNTGRWISIE
                     DGRDVLVGALR"
     gene            complement(251051..251839)
                     /locus_tag="Atu0253"
                     /old_locus_tag="AGR_C_435"
     CDS             complement(251051..251839)
                     /locus_tag="Atu0253"
                     /old_locus_tag="AGR_C_435"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86069.2"
                     /translation="MTEQAAEFLHIGMGEDARNIAFLHRPATSQPDAPTLVWLGGYRS
                     DMTGTKAVELDRFAAENGLACLRLDYSGHGASGGDFNKGTISRWLEEALAVVRAKASS
                     RVVLVGSSMGGWIALRMIEELRKSGGAPSVAGLVLIAPAPDFTQELIEPSLSDAEKTS
                     LAERGYFEEHSDYSPEPNIFTRALMEDGKQNRVLTGIITTGCPVHVLQGMRDPDVPYQ
                     HALKLIEHLPSDDVVLTLIRDGDHRLSRPQDIERMLAAVKALAI"
     gene            252141..252563
                     /gene="infC"
                     /locus_tag="Atu0254"
                     /old_locus_tag="AGR_C_436"
     CDS             252141..252563
                     /gene="infC"
                     /locus_tag="Atu0254"
                     /old_locus_tag="AGR_C_436"
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor 3"
                     /protein_id="AAK86070.1"
                     /translation="MPTDQALKMAEEAGLDLVEISPNAEPPVCKILDLGKLKYSTQKK
                     AAEARKKQKIVEVKEIKMRPNIDTHDYDVKMKAMNRFFDEGDKVKVTLKFRGREMAHQ
                     ELGMKLLLQVKEDTQAIAKVEAEPKLEGRQMMMVLAPR"
     gene            252753..252956
                     /gene="rpmI"
                     /locus_tag="Atu0255"
                     /old_locus_tag="AGR_C_437"
     CDS             252753..252956
                     /gene="rpmI"
                     /locus_tag="Atu0255"
                     /old_locus_tag="AGR_C_437"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L35"
                     /protein_id="AAK86071.1"
                     /translation="MPKMKTKSAAKKRFKITATGKVVAAAAGKRHGMIKRTNKFIRDA
                     RGTMVLAEADGKKVVKNYLPNGL"
     gene            252997..253401
                     /gene="rplT"
                     /locus_tag="Atu0256"
                     /old_locus_tag="AGR_C_439"
     CDS             252997..253401
                     /gene="rplT"
                     /locus_tag="Atu0256"
                     /old_locus_tag="AGR_C_439"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L20"
                     /protein_id="AAK86072.1"
                     /translation="MARVKRGVTSRAKHTKTLKAAKGFYGRRKNTIRAAKAAVDRSKQ
                     YAYRDRKVNKRNFRALWIQRINAAVRESGLTYGRFIDGLNKAGIEVDRKVLSDMAIHE
                     PAAFGALVEAAKKALEYLKDAGTTNEFETAVK"
     gene            253566..254444
                     /locus_tag="Atu0257"
                     /old_locus_tag="AGR_C_441"
     CDS             253566..254444
                     /locus_tag="Atu0257"
                     /old_locus_tag="AGR_C_441"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86073.2"
                     /translation="MLVNKSEVVETEGFRVHLDDDDIATVMRVLLKSDRRIQKVELSQ
                     LTVWIKRQGTERVTWWMKMQKLLSKLLPYTFLRPSEPLDGAGLMQRELETLQQFQQRG
                     FPVPPLIYSSRTAVVLGDVGPTLMERMDALKSSDPVEHDALLVKSAEALGELHAAGLC
                     HGRPHVRDFFLKDGRVGFMDFEERPQEVMPLETAQARDIWLLFLQVATRACDAPKTRD
                     AAFSRWLENTPPRAVEELSRLTGILGRFLPLARLIGRVRMGSDLRRFIMATDYLMNAV
                     NTDAAVKKSGKAGKDD"
     gene            254470..255519
                     /gene="pheS"
                     /locus_tag="Atu0258"
                     /old_locus_tag="AGR_C_443"
     CDS             254470..255519
                     /gene="pheS"
                     /locus_tag="Atu0258"
                     /old_locus_tag="AGR_C_443"
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanyl-tRNA synthetase, alpha-subunit"
                     /protein_id="AAK86074.2"
                     /translation="MSEIAAAADEPAIEAVRVSALGKKGSVSELLKTLGSMTPEERQT
                     RGAAINQLKTEITDLIGERKNALKDAAIAARLKAETVDVSLPVRQSPTERGRIHPISQ
                     IVDEITAIFADMGFSIAEGPDIETDYYNFTALNFPEGHPAREMHDTFFFQPDEKGERK
                     VLRTHTSPVQIRTMESQKPPIRIVIPGKTYRQDSDATHSPMFHQVEGLVIDKKAHVGN
                     LRWVLEEFCKTFFEVDSVVMRFRPSFFPFTEPSFEVDIQCDRSGPIVKFGEGKDWMEI
                     LGCGMVHPNVLRAGGLDPDEYQGFAWGMGLDRIAMLKYGMPDLRDFFNADVRWMNHYG
                     FRPLDMPTLFGGLSV"
     gene            255544..257967
                     /gene="pheT"
                     /locus_tag="Atu0259"
                     /old_locus_tag="AGR_C_445"
     CDS             255544..257967
                     /gene="pheT"
                     /locus_tag="Atu0259"
                     /old_locus_tag="AGR_C_445"
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanyl-tRNA synthetase beta chain"
                     /protein_id="AAK86075.1"
                     /translation="MKFTLSWLKEHLETDATLDEICERLTAIGLEVEDVDDKAAYKPF
                     VIAKVVSAEKHPEADRLKVLMVDAGDGKPVQIVCGAPNARAGLVGALARPGVYVPGID
                     VTLAVGKIRGVESHGMMCSEKELNISDDHDGIIDLPEDAPVGTSFATYAGLDDPVIEI
                     NLTPNRPDCTSIYGIARDLAASGLGKLKTKAAPSFKVEGATPVDVKLELDDAALCPGF
                     SLRIVRGVKNGPSPKWMQQRLMAIGLRPINALVDITNYMTFDQGRPMHVFDAAKVKGD
                     LTVRRAKDGETILALDQREYKLGPNNVVIADEKGLESIGGVMGGEHSGCDENTIDVLI
                     ESALWDPINIAKTGRSLGIITDARYRFERGVDPEYMVPGLERTTELVLELCGGIAGEA
                     KIVGYKGHQPKVVDFPLSEVKRLTGLEVSSEESLAILKGLGFGVEGTGERVSVTVPSW
                     RPDVDGKADLVEEVMRIHGVDNIKPEPLENFGAVNGRILTTLQIRTRTARRALASRGM
                     LEAVTWSFIPEAQAKLFSGGSPALKLANPIAADMSDMRPSLLPGLLTAAQRNADKGHG
                     DVAIFEVSGTYEGDTPEKQRRVAGGIRRGTASLAGSGRMWSNAAKGGGKPVDVYDAKA
                     DALSVLEACGLPMANVQIEAGAPAWYHPGRSGTIKMGPKVVLGYFGEFHPKTLSELDV
                     SGTYCGFEIYLDAMPEPKKKATRTKPALELSPFQAVKRDFAFVVDKSVEAGAIIKAAT
                     SADRKLITGVNVFDIFEGASLGENRKSVAIEVQIQPVDKTLTDEDFEALTAKIVGNVE
                     KSTGGVLRA"
     gene            complement(258027..259028)
                     /locus_tag="Atu0260"
                     /old_locus_tag="AGR_C_447"
     CDS             complement(258027..259028)
                     /locus_tag="Atu0260"
                     /old_locus_tag="AGR_C_447"
                     /codon_start=1
                     /transl_table=11
                     /product="aldo-keto reductase"
                     /protein_id="AAK86076.2"
                     /translation="MKKRTLGNNLSVSALGLGCMGMTHAYSPTGDENSAIATLHRAVE
                     LGVTFFDTAEVYGPYNNEILVGKGLKPYRDKVVIATKFGFRIDPSKPAGQMMVGTDSR
                     PENVRAVAEASLKRLGVDVIDLFYQHRVDPNVPIEDTLGAMAELVQQGKVKYLGLSEA
                     SAETLRKAHAVHPIAAIQSEYSLWTRDVEENGVLETCRELGIGFVPFSPLGRGALTGA
                     LKSLDGLAADDFRRGLPRFQSENFDANLALIKLLEDMAAEKGVTAGQLALAWVLAQGD
                     FIVPIPGTTKIANLEKNVAATDVSLTADEVASLGALLSPAKVAGERYPERMSQMANR"
     gene            259145..260035
                     /locus_tag="Atu0261"
                     /old_locus_tag="AGR_C_448"
     CDS             259145..260035
                     /locus_tag="Atu0261"
                     /old_locus_tag="AGR_C_448"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LysR family"
                     /protein_id="AAK86077.1"
                     /translation="MNRVQLSQLAVLAAVAEGRSFRKAAAELAIAPSAVSHAVSSLEA
                     SLGLRLLHRTTRSVSPTEEGRQLLETLGPALADIDAVIETLAEHGGRPAGPLRITLPR
                     LAAEDLIVPRLGEFLRLYPDISLEISTDDRFEDIVAKGFDAGLRLGEHLDADMIAVKA
                     SGAWRGAIVGAPAYFAENAPPREPRDLIRHRCIRRRFSSGLIYRWELEKNGKPLVVDV
                     QGPLILSDQSLIRRAAIDGAGLAFVFEQRVEEDIAEGRLIRVLEDWCAPFDGFYIYYP
                     SRRQMRPALRAFVDFFRFRG"
     gene            complement(260036..260479)
                     /locus_tag="Atu0262"
                     /old_locus_tag="AGR_C_449"
     CDS             complement(260036..260479)
                     /locus_tag="Atu0262"
                     /old_locus_tag="AGR_C_449"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="AAK86078.1"
                     /translation="MELTIRDTKPADRAEWLRLWNDYLAFYKVDLAEDVTEHTWARIL
                     DPTSRVSMRVAMLGERMAGFAIHHFHDSTWVKTPDCYLEDLFVDGTIRGKGTGRALMD
                     DLITICKDRGWSRLYWNTDEGNHRAQKLYDNYVKSDGHIRYRITF"
     gene            complement(260481..261431)
                     /locus_tag="Atu0263"
                     /old_locus_tag="AGR_C_452"
     CDS             complement(260481..261431)
                     /locus_tag="Atu0263"
                     /old_locus_tag="AGR_C_452"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="AAK86079.2"
                     /translation="MEKRSLGRTGLSIAPIVFGGNVFGWTADEKTSFALLDAFFDVGF
                     NAIDTADVYSAWVDGHVGGESEAIIGKWLKQSSVKREDAVIVTKVGFDNRGQKTGLSA
                     KWIAEAVEASLKRLQTDYIDLYLAHKPDPEVPLEETLAAFAKLKEQGKIRAIGCSNYS
                     ASQLQEALDVATKNNLPRYDVLQPEYNLYNRADFEGPIADLCVKEEIGVINYYSLAAG
                     FLTGKYRAKADTEGVARSYRVGDYVNTRGLAVLGAMDAVAVQTGAKLADIALAWLLRK
                     KAVTAPIASATSLSQLESFKRAVDLKLTDEMMTLLDKAGA"
     gene            complement(261540..262523)
                     /locus_tag="Atu0264"
                     /old_locus_tag="AGR_C_453"
     CDS             complement(261540..262523)
                     /locus_tag="Atu0264"
                     /old_locus_tag="AGR_C_453"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, AraC family"
                     /protein_id="AAK86080.1"
                     /translation="MDKGGTRVIPFYTLVPPHALLLDIAGPLQVIRYANNEQNDVFFD
                     CRYIAAQEKQQSSIGLGICGLETLPATLPENAFLLISGSTSRSESEPETRRERQALAA
                     WLRRVVGLDTTVISICSGALLAGEAGLFDGRSCTTHSDCIETLRRVAPLSQVAENRLF
                     VEDGNRFSSAGISTGIDLMLHVVSRLTSLAVAARIAQTMVVYLRRNGNDPQISPWLTG
                     RNHMHPAIHRVQDRVMAEPARDWSLERLADIAALSERHLSRLFREHTGISVIDYVNLM
                     RVNLARDILSNSRLDMEAIAERAGFASARHLRRVWQQHNRYPPSHYRGFQA"
     gene            complement(262523..263083)
                     /locus_tag="Atu0265"
                     /old_locus_tag="AGR_C_456"
     CDS             complement(262523..263083)
                     /locus_tag="Atu0265"
                     /old_locus_tag="AGR_C_456"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="AAK86081.2"
                     /translation="MSSSNTALLVIDVQESFRHAPYFEESGLAAYLEKQQALIDGAKA
                     AGIPVVQIFHVDGDRAFSKDSGYIRALEGVRITPDVTFHKSRHSAFAGTGLEIWLTQR
                     GINRLIVSGIRTEQCCETTTRHASDLGYSVDYITEATLTFPMTHPSGTVFSADDIRKR
                     TELVLAGRFARIATVSEALAPLKAAA"
     gene            263264..264247
                     /locus_tag="Atu0266"
                     /old_locus_tag="AGR_C_457"
     CDS             263264..264247
                     /locus_tag="Atu0266"
                     /old_locus_tag="AGR_C_457"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="AAK86082.2"
                     /translation="MLRFGIISTAKIAQDHVIPAIQDAENCVVSAIASRDHARARAVA
                     ERFSVPHAFGSYEEMLASDVIDAVYIPLPTAQHVEWTIKAANAGKHVLCEKPIALKAE
                     EIDTLIAARDRNGVIVSEAFMVTYSPVWAKVKELLASGAIGTLKHVQGAFSYFNRDPG
                     NMRNIPELGGGALPDIGVYPTIVTRFATGAEPRRVQATVERDREFGTDIYSSVRADFG
                     TFELSFYLATQLASRQLMVFHGTDGYIEVKSPFNANRWGAEEIELTNQAHNQSQVFRF
                     QDSRQYKLEAEAFARAVRGEGEVVTLENSRKNQLFIDAIYRAAEKDGWETV"
     gene            complement(264244..264597)
                     /locus_tag="Atu0267"
                     /old_locus_tag="AGR_C_459"
     CDS             complement(264244..264597)
                     /locus_tag="Atu0267"
                     /old_locus_tag="AGR_C_459"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK86083.1"
                     /translation="MRLPHFALTEICGLAVDLAVTCVLIFYLRVDPLVARLPGAAAGL
                     ATSWQLNRSNGAELNGFLKNAVTLISRIVGVGLFALLLWRNPLLQPFIPLALSAIAAL
                     VLALYGYFRLQKQRT"
     gene            complement(264609..264851)
                     /locus_tag="Atu0268"
                     /old_locus_tag="AGR_C_460"
     CDS             complement(264609..264851)
                     /locus_tag="Atu0268"
                     /old_locus_tag="AGR_C_460"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK86084.1"
                     /translation="MIFLTATVLGVTAVALRSVFSIVFICMMIIGAYGVAMVLSSTAV
                     PLMSLLLALAGYNFGVVGVVIGLLVLQRPRSTQPTL"
     gene            265041..266639
                     /gene="xseA"
                     /locus_tag="Atu0269"
                     /old_locus_tag="AGR_C_461"
     CDS             265041..266639
                     /gene="xseA"
                     /locus_tag="Atu0269"
                     /old_locus_tag="AGR_C_461"
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease VII large subunit"
                     /protein_id="AAK86085.2"
                     /translation="MSDIFSHTALSNLAEFSVSELSGSIKRTVETAFEQVRVRGEISG
                     YRGPHSSGHAYFSLKDDRARIDAVIWKGTFSRLKFRPEEGMEVIATGKITTFPGSSKY
                     QIVIESLEPAGAGALMALLEDRRRRLAAEGLFDSARKRPLPFMPRVIGVVTSPTGAVI
                     RDILHRISDRFPVHVVVWPVKVQGEGSGEEVANAIRGFNALKPGGDIARPDVLIVARG
                     GGSLEDLWSFNDEIVVRAAAESEIPLISAVGHETDTTLIDYAADVRAPTPTGAAEMAV
                     PVRAELEAQLSGLAARLSGSVSRQMDNRRQGVRALVRALPSLDQLLALPRRRFDEAAS
                     GLGRGLELTTLNKRRAFERSASGLRPETLLNGLKHHRQRITERMHRAETLVERRLLQG
                     KGRVDSFDSALRSLPARLLGQLERQKERVVTAARRADTAVLHRMAQNRSGLAAHDRIL
                     QSLSYKNVLNRGYAVIRDEENRPLTRAAAIASGAAVSMEFADGRVSAITTGEGTPAPE
                     TAAAPKKKPAKPASSDPGNQGNLF"
     gene            complement(266640..267842)
                     /locus_tag="Atu0270"
                     /old_locus_tag="AGR_C_463"
     CDS             complement(266640..267842)
                     /locus_tag="Atu0270"
                     /old_locus_tag="AGR_C_463"
                     /codon_start=1
                     /transl_table=11
                     /product="mandelate racemase / muconate lactonizing enzyme
                     family protein"
                     /protein_id="AAK86086.2"
                     /translation="MKITKLETVRVAERTNLLWVLVHTDEGITGLGETFFGAETVETY
                     VHEYIAPRVIGRDPLQIDLLAQDLVGYLGFRSSGAEVRGNSAFDIALWDIFGKATNQP
                     IAQLLGGFSRREIRTYNTCAGTEYIKKATGQQTANYGLSGGKDYDDLNGFLHRADELA
                     HSLLEDGITAMKIWPFDAAAEKTRGQYISMPDLKSALEPFEKIRKAVGDKMDIMVEFH
                     SMWQLLPAMQIAKALTPYQTFWHEDPIKMDSLSSLTRYAAVSPAPISASETLGSRWAF
                     RDLLETGAAGVVMLDISWCGGLSEARKIASMAEAWHLPVAPHDCTGPVVLCASTHLSL
                     NAPNALVQESVRAFYKTWYRDLVTALPEVKNGMITVPPGAGLGMELHPDIEKTFTVSR
                     RFSDAASI"
     gene            complement(267893..268600)
                     /locus_tag="Atu0271"
                     /old_locus_tag="AGR_C_464"
     CDS             complement(267893..268600)
                     /locus_tag="Atu0271"
                     /old_locus_tag="AGR_C_464"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, GntR family"
                     /protein_id="AAK86087.1"
                     /translation="MLNAISHDSGLVSSTIGAITRHIRENELAPGAKLPSELSLSQQL
                     GVSRTVVREAFRSLSAMRLIDVNAGKRATVATLDHGAMSLMFEHGIHTEQINIQQIYD
                     VRRTIEVRTVTLAALRRTDAEALTILDHANNMERDFSDNDRVMEHDLAFHLAVARASK
                     NPVFELILGAFQNVTRQTWPIGWKSRTSDAQRLAACELHIAIGQAIAAGDPQTASTLM
                     ARHFDESVHALLAAGIA"
     gene            complement(268711..269196)
                     /gene="pecS"
                     /locus_tag="Atu0272"
                     /old_locus_tag="AGR_C_466"
     CDS             complement(268711..269196)
                     /gene="pecS"
                     /locus_tag="Atu0272"
                     /old_locus_tag="AGR_C_466"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, MarR family"
                     /protein_id="AAK86088.2"
                     /translation="MDHVDHILAQWRKERPDLDVGPMGLLGRLHRLSTYLGREVEAVL
                     LKHGLSSSAFDVLATLRRAGSPYQLSPGDLLAMTMVSSGTMTNRIDQLEKAGLVERIH
                     NPQDRRSVLISLTERGFAIVEEAVGAHVDNQHRLVAHLSEEERDTLDGLLKRFLQDFE
                     E"
     gene            269293..270156
                     /gene="pecM"
                     /locus_tag="Atu0273"
                     /old_locus_tag="AGR_C_468"
     CDS             269293..270156
                     /gene="pecM"
                     /locus_tag="Atu0273"
                     /old_locus_tag="AGR_C_468"
                     /codon_start=1
                     /transl_table=11
                     /product="regulator protein pecM"
                     /protein_id="AAK86089.1"
                     /translation="MKKNMTYAADVLVTALAPAIWGTTYFVTTEFLPQGYPLHVAMLR
                     ALPAGILLLLLVRKLPQGIWWPRSFILGALNFSFFWAMLFVSAYRLPGGVAATVGAVQ
                     PLIVIGLSRLFLSTPVRPLAIGAGFLGIAGVALLVLTPGAALDGIGVAAGLAGAVSMA
                     FGTVLTRKWRPPVSNLTFTAWQLTAGGILLLPVAYALEPALPAPTAVNVMGMAYLGLI
                     GAALTYLLWFRGLARIEPSAAASLGFLSPVVATLLGWLALGQSLAPAQIAGFIAVLFS
                     IWLSQRSQLPR"
     gene            complement(270165..271403)
                     /gene="ampS"
                     /locus_tag="Atu0274"
                     /old_locus_tag="AGR_C_470"
     CDS             complement(270165..271403)
                     /gene="ampS"
                     /locus_tag="Atu0274"
                     /old_locus_tag="AGR_C_470"
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase"
                     /protein_id="AAK86090.1"
                     /translation="MTVSPIDPVKLEKLAEVAIKVGLQLQKDQDLVITAPLAALPLVR
                     LLTKHAYIAGGGLVTTFYSDEETTLSRYRHASDANFDRASGWLYEGMAKAYANGAARL
                     AIAGDNPMLLAEEDPAKVARANKANSTAYKPALEKISNFDINWNIISYPNPSWAKQVF
                     PGLTEDEAVRKLADAIFAASRVDVADPVAAWAQHNANLAKRSAWLNGERFSALHFTGP
                     GTDVKIGLADGHEWHGGASMAKNGVTCNPNIPTEEVFTTPHALRVDGYVSSTKPLSHQ
                     GTLIDDIQVKFEAGRIVEAKASKGEAVLNKVLDTDEGARRLGEVALVPHSSPISASGI
                     LFYNTLFDENASCHIALGQCYSKCFLDGASLSQDQIKAQGGNSSLIHIDWMIGSNKVD
                     IDGVKPDGSTVPVMRKGEWA"
     gene            complement(271492..271968)
                     /locus_tag="Atu0275"
                     /old_locus_tag="AGR_C_472"
     CDS             complement(271492..271968)
                     /locus_tag="Atu0275"
                     /old_locus_tag="AGR_C_472"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86091.1"
                     /translation="MSKTTRATQMLTKAGIAFATVTYDYDPNADRIGLQAAEAIGEAP
                     HLVLKTLMAELDGKPVCVVVPSDREVSMKKLAAAFGGKSANMMKPADAERATGYHVGG
                     ISPFGQKKQVPTAIEADAMVHDYVYMNGGQRGLQVRLSPRDAQKVLDAIVAPLVAE"
     gene            complement(271981..272328)
                     /locus_tag="Atu0276"
                     /old_locus_tag="AGR_C_473"
     CDS             complement(271981..272328)
                     /locus_tag="Atu0276"
                     /old_locus_tag="AGR_C_473"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86092.1"
                     /translation="MTVTIYGIKNCDTMKKARSWLELNGIDYSFHDYKAAGIDRAHLE
                     TWCDAAGWETVLNRAGTTFKKLDDSQKADLTREKAIGLMLDQPSMIKRPVLEAKGKIT
                     VGFKPEIYQTVFA"
     gene            272422..272817
                     /locus_tag="Atu0277"
     CDS             272422..272817
                     /locus_tag="Atu0277"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAL41299.2"
                     /translation="MMPEPCKIEVADIRTSASKAAWLPCYIMSCRTRWKSPLFRHQRW
                     REKCVRLQRHRVTSSVKLSPFSVQRSRFRPLFAHIASPLAPISKLSVSTARLSTRSSS
                     KLVIVCSEATSPRLRLAPESTSVFRRRLG"
     gene            complement(272904..273791)
                     /locus_tag="Atu0278"
                     /old_locus_tag="AGR_C_477"
     CDS             complement(272904..273791)
                     /locus_tag="Atu0278"
                     /old_locus_tag="AGR_C_477"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86093.1"
                     /translation="MRDTYQLVGRLSMVPCHKAIDLSGMRRGHRNSFSFCSFNFSLAM
                     IMSRAWNRPWSIVMGLELTDKEGLRQLFLEGFELEKQRRINPRFSSKVLIVVKPPAAL
                     AERIFTDASSHAAGRTKREAYPAELLHITLLCVGCFDTVPRGLANRLKEALGEIRARP
                     VPITFDGSSLFGNRNCLVLNSRREMLELRALAKVVQRALWRANLPYIAASSFMPHLTM
                     IYGCGKIETMPVEKPYSWLAGSFEVIFSHNGETRHESLGRFALSAKADRYEQPESQLY
                     LPQKVFGPSKRPTHKIAAR"
     gene            273790..274368
                     /locus_tag="Atu0279"
                     /old_locus_tag="AGR_C_478"
     CDS             273790..274368
                     /locus_tag="Atu0279"
                     /old_locus_tag="AGR_C_478"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, TetR family"
                     /protein_id="AAK86094.1"
                     /translation="MKNPQSKADDILQCARTLIIRGGYNSFSYADISQVVGIRNASIH
                     HHFPSKSDLVCKLVSQYRQEAEAGIAELEKNISDPLEQLRAYIGYWEGCIADATHPFC
                     VCALLASEIPVLPETVVLEVRAHFRSLSDWLTAVLERGIAQGRLVLTGTARANAEIFM
                     ATVHGAMLSARAHGDAATFGAITRPMLERITA"
     gene            274510..274998
                     /locus_tag="Atu0280"
                     /old_locus_tag="AGR_C_479"
     CDS             274510..274998
                     /locus_tag="Atu0280"
                     /old_locus_tag="AGR_C_479"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK86095.1"
                     /translation="MFGISPLGWVHTLGSLPAIPVAIYMFARHGRIVPRSTPGAIYFV
                     SMLIGAATAFLVAHQPVSYAIGALTILFLLAGYGIERILGSTRVARYVETICLSVSAF
                     LLMVPTATETLRRVPDGHPFVTDLKSPLLLGVQAGLLAILVVGLAAQIIYLARQNRNA
                     AN"
     gene            complement(275073..276650)
                     /gene="guaA"
                     /locus_tag="Atu0281"
                     /old_locus_tag="AGR_C_480"
     CDS             complement(275073..276650)
                     /gene="guaA"
                     /locus_tag="Atu0281"
                     /old_locus_tag="AGR_C_480"
                     /codon_start=1
                     /transl_table=11
                     /product="GMP synthase"
                     /protein_id="AAK86096.1"
                     /translation="MTQIAHPDSILIIDFGSQVTQLIARRIREAGVYCEIHPFQNAAE
                     AFEKLQPKGVIFSGGPASVTAEGSPRAPQAVFDSKVPILGICYGQQTLCTQLGGVVEG
                     GHAAEFGRADIDIKKASPLFEGFWEQGKSYPVWMSHGDRVTKLPEGFEVIATSENAPF
                     AIAADEKRHYYTTMFHPEVVHTPDGGKLLSNFVHKIVGLKSDWTMAAYRAEMIRKIRE
                     QVGTGRVLCALSGGVDSSVAAILIHEAIGDQLTCVYVDHGLMRLGESEQVVGMFRDHY
                     NIPLVHVDAADLFLGELSGVSDPEVKRKTIGRLFIEVFEAEAAKIAADGKGAPKFLAQ
                     GTLYPDVIESVSFSGGPSVTIKSHHNVGGLPERMNMQLVEPLRELFKDEVRALGRELG
                     LPESFIGRHPFPGPGLAIRCPGAITREKLDILRKADAIYLDEIRKAGLYDTIWQAFAV
                     LLPVQTVGVMGDYRTYDFVCALRAVTSVDGMTADFYPYDMNFLGRAATRIINEVRGIN
                     RVVYDVTSKPPGTIEWE"
     gene            complement(276734..277372)
                     /gene="pfs"
                     /locus_tag="Atu0282"
                     /old_locus_tag="AGR_C_482"
     CDS             complement(276734..277372)
                     /gene="pfs"
                     /locus_tag="Atu0282"
                     /old_locus_tag="AGR_C_482"
                     /codon_start=1
                     /transl_table=11
                     /product="5'-methylthioadenosine/S-adenosylhomocysteine
                     nucleosidase"
                     /protein_id="AAK86097.1"
                     /translation="MSYRLSHVADKSVLFVMAASAEYGPHLQARIAPLMTGVGPVEAA
                     ISVTAILAGLDAADNLPDLVVSLGSAGSRTLQQTGIYQAVSVSYRDMDASAFGFEKGR
                     TPFLDLPAEVALPLRIPDIAEARLSTGGNVVSGEAYGLIDADMVEMETFAVLRACQRF
                     GVPLISLRGISDGKADVNHVDDWTAYLDIIDEKLANAVDRLCRAIEDGVIAL"
     gene            complement(277369..277818)
                     /locus_tag="Atu0283"
                     /old_locus_tag="AGR_C_483"
     CDS             complement(277369..277818)
                     /locus_tag="Atu0283"
                     /old_locus_tag="AGR_C_483"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86098.1"
                     /translation="MEITDPGDFRQRIETSFARQGVVQAINAEISRIEHRLVEIELPF
                     HEKLTQQHGILHAGVIAAGLDTACTYAAYTIIEPEASLLTIEFKVNLMSPGRGERFLF
                     RGEIIKPGNNLIVADGRAYALSDGPAKLIASMTGTMMVVKGREDITG"
     gene            complement(277897..278349)
                     /gene="tspO"
                     /locus_tag="Atu0284"
                     /old_locus_tag="AGR_C_485"
     CDS             complement(277897..278349)
                     /gene="tspO"
                     /locus_tag="Atu0284"
                     /old_locus_tag="AGR_C_485"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan-rich sensory protein"
                     /protein_id="AAK86099.1"
                     /translation="MKNLAVYIIFVVVVVAIGALIGVNNVPGEWYQSLQKPFFNPPNW
                     IFGPVWTALYVLIGIAGARTWIRKPMGTRMRLWFTQMVLNFLWSPIFFGMQSPAGALV
                     IIIPMLICIIAFMALTYRRDRISMWLFAPYALWVAFATVLNASIGMLN"
     gene            complement(278400..279494)
                     /locus_tag="Atu0285"
                     /old_locus_tag="AGR_C_487"
     CDS             complement(278400..279494)
                     /locus_tag="Atu0285"
                     /old_locus_tag="AGR_C_487"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86100.1"
                     /translation="MISGSKRMLIDRRSFIKAAGIPFLAALAPRSLHALERTDAVFAS
                     AFRARDGSYGIATVSERGEIIDRVALPARAHGMATSHATGRTVAFARRPGTFFMAFDP
                     VQRQEPVVMHAPENRHFYGHGQFSPDGAILYASENDFDGNRGVIGLYDARNGFARIGE
                     YDAHGVGTHDMTVSDDGRLIVIANGGIETHPDFGRTKLNIDSMEPSLVLLDAATGQLI
                     QKHVMPEQLRQLSTRHVDLGDNGRIWFACQYEGPRNNLPPLVGHFSKGEDVAFVDLPE
                     ETTVRLANYVGAIAVNRREGLVGLTSPSGNAAVTLDAKTGSVVSEVTVREAAGVATAA
                     GGIAVSSYDGFFEAIRSDVAWDQHIVRLSG"
     gene            complement(279498..280619)
                     /locus_tag="Atu0286"
                     /old_locus_tag="AGR_C_489"
     CDS             complement(279498..280619)
                     /locus_tag="Atu0286"
                     /old_locus_tag="AGR_C_489"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86101.1"
                     /translation="MNFAMRKISGVISVLLLLTTPPARAQDVELLPPPPLDPAQVRGV
                     MEKAVNGFIRPGYDHFRQSAETLEGSMKAFCAAPSKTTEAAAQAAFIETVLNWSTIEI
                     VRVGPVIEKNRFERVLYYPDKKGLGLKQVQRYLSDKDESVTTADGLKGKSVAAQGLGA
                     LEFVLYGTGAEELLDKKGDFRCRFGAAIAGNIANVATELSNSWNAPDGAQKNWTQPGP
                     DNPVFRDEREALVALLGILVHGAEAIRDQRIETFYKGPDKAKFPRTAIYWRSGLTWKS
                     ISTNIKAVQTLLHTADMVELVPPDQRSIVNSIDFIAKSMIRVAATIDTDVEKALDKDD
                     QRAKVDYLLLNGKDLIYRLNDQYGGAIGLSSGFSFADGD"
     gene            complement(280619..282160)
                     /locus_tag="Atu0287"
                     /old_locus_tag="AGR_C_491"
     CDS             complement(280619..282160)
                     /locus_tag="Atu0287"
                     /old_locus_tag="AGR_C_491"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86102.1"
                     /translation="MCLPTPMELSLSPIRKPFFFAGAACLVASVTLAAPLRDDLTEKD
                     RSRVLAVTAPTTDFTKPNPFEAMSGGATTSTGTAGGNAFSQPSATMPFERKQDFKLGN
                     ALFQKLWVSSPSSTQASDGLGPFYNARSCQTCHVKDGRGRPPLAGEDAVSLFLRLARP
                     ARDETERAAIARHEVLNFPDETYGRQLQNLAIPGLAAEGRPVITYTERPVRLSDGEVV
                     SLRKPTYAATALRYGPLGTDTTVSARIAMPTLGLGLIEAIADADILAGADPDDKNGDG
                     IAGRPAWVKDHRTGEIKLGRFGWKAQNASVRDQSASAFSHDIGISTPDAPNAYGDCTD
                     AQKDCLAMPTGVQPRLGPVEAPDPVLDLVTFYTENLAVPQRRNAGDRTVLEGKQLFYT
                     SGCTACHTPKFVTRRDAGDPMHSFQLIWPYSDFLLHDMGEELADGQQVGEASGRHWRT
                     QPLWGIGLTQRVNGNGFYLHDGRARSLTEAILWHGGEGQKARNAFAALQKSDRQALLA
                     FLESL"
     gene            complement(282202..283479)
                     /locus_tag="Atu0288"
                     /old_locus_tag="AGR_C_493"
     CDS             complement(282202..283479)
                     /locus_tag="Atu0288"
                     /old_locus_tag="AGR_C_493"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86103.2"
                     /translation="MIRKTILSASFVLLAASAAFTALPAQAATDAAAVIKHYADVAHA
                     KYEDSLTTAKALDKAIDALIATPSEETLKAAREAWIKARVPYQQSEVYRFGNPLVDAW
                     EGKVNAWPLDEGLIDYVDASYGTESDENELYVANIIANPKIKISGEEVDASKITPELI
                     ESLHEAGDVEANVTTGYHAIEFLLWGQDLNGTGPGAGNRPYTDYDKAKCTNGNCDRRA
                     DYLKSASSLLVKDLQEMVDAWAPEGEATKTVEADPKAGLTAILTGMGSLSYGELAGER
                     MKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIASAYTGDYTRVDGTKMTGASLAELVG
                     AKDKALNDEMTAKLNKTLNAMHAMEKRAQTVEAYDQMIGEGNKEGNAVVQAAIDGLID
                     QTKTVERVIAALDLGKIELEGSASLDNPNAVFK"
     gene            complement(283635..284924)
                     /gene="sun"
                     /locus_tag="Atu0289"
                     /old_locus_tag="AGR_C_495"
     CDS             complement(283635..284924)
                     /gene="sun"
                     /locus_tag="Atu0289"
                     /old_locus_tag="AGR_C_495"
                     /codon_start=1
                     /transl_table=11
                     /product="Sun protein"
                     /protein_id="AAK86104.1"
                     /translation="MRLGGRLAGAIEVLADIEGRRRPVADALKDWGLAHRFAGSGDRA
                     AIGNIVYDALRMKLSHAWLMDDDSAASLAYAVLLRQWGKSFAELTAEFDGDKFAPAAP
                     DAERQQAFLSRSLSDAPAYIQGDVPEWVQSSLETAFGERWLAEAQALNERPTLDLRAN
                     TLKATRDKVLKALEESGAEATRIARQGLRIPAGEGPSRLPNVTAELSFQKGWFEVQDE
                     GSQIVADLAGAREGEQVLDYCAGGGGKTLAMAASMNNKGQVHAFDADRKRLAPIIERL
                     KRAGTRNVQVHDRAAGLAPFQEKFDRVLVDAPCTGTGTWRRRPDTKWRLTARNLEERV
                     QQQGEALSQAKGFVRPGGELLYVTCSVLPEENEQQVRRFCEENPEFAIGSALERWQSI
                     FSGNANKPHSSDGKTVTLTPATTDTDGFFFCLMKRKA"
     gene            complement(284986..285354)
                     /locus_tag="Atu0290"
                     /old_locus_tag="AGR_C_498"
     CDS             complement(284986..285354)
                     /locus_tag="Atu0290"
                     /old_locus_tag="AGR_C_498"
                     /codon_start=1
                     /transl_table=11
                     /product="rare lipoprotein A"
                     /protein_id="AAK86105.1"
                     /translation="MLNIRRITFTAATIAACSIIAPLQANAANGCGGASWYALSSKTA
                     SGERMNAANLTAAHRSLRFGTKVKVTNARNGKAVVVRINDRGPFIKGRVLDLSKAAAK
                     NIGMISSGTAKVCYEIVKAD"
     gene            complement(285781..286653)
                     /locus_tag="Atu0291"
                     /old_locus_tag="AGR_C_499"
     CDS             complement(285781..286653)
                     /locus_tag="Atu0291"
                     /old_locus_tag="AGR_C_499"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86106.1"
                     /translation="MHVMIFGAGYSGKAIANALKTKAASVCGTTRSADKFANLAAAGM
                     TPLLFDGVHLDDDLIAAMRNVTHLVQSIAPGKDGDPLFALLGGDLKKLLPNLKWLAYL
                     STVGVYGDHHGAWVNETTPCRPVSARSVERVAAEAAWTEAAQSADVPLSILRLSGIYG
                     PGRNTFMNFEKGTARRLVKKDQVFNRIRVEDIGAAIAFLALKNERGIFNVTDDEPCPP
                     QDVVSFAADLMGVVPPAEQDFGTADLTPMARSFYGENKRVSNAKIRELGFDFRFPEYR
                     QSLKQLWESSLWRG"
     gene            complement(286657..287637)
                     /locus_tag="Atu0292"
                     /old_locus_tag="AGR_C_502"
     CDS             complement(286657..287637)
                     /locus_tag="Atu0292"
                     /old_locus_tag="AGR_C_502"
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster binding protein"
                     /protein_id="AAK86107.1"
                     /translation="MAWMEETEARRAEPKTLWGDVRSIVMFGLNYGPDEDPRGLLSKP
                     DKAAISVYARNRDYHDIIKGRLKEIATRFAARAGEDVKVFVDTAPVMEKPLAAAAGLG
                     WQGKHTNLVSRSHGSWLFLGSMFTTAELCVDEAERDHCGSCRACLDACPTAAFPAPYQ
                     LDARRCISYLTIEHKGPIPHEFRPMIGNRIYGCDDCLAACPWNKFAASASEMKLKARE
                     DLKEPSIAFLLTLDDAAFRSFFSGSPVKRIGRNRFIRNVLIAAGNSADRHFVEQCKAL
                     AEADPSAEVRGMAAWALSRLMDRDEFRTYSAGRAPETDPEAEMEWQLAEA"
     gene            complement(287938..288630)
                     /locus_tag="Atu0293"
                     /old_locus_tag="AGR_C_503"
     CDS             complement(287938..288630)
                     /locus_tag="Atu0293"
                     /old_locus_tag="AGR_C_503"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="AAK86108.1"
                     /translation="MPTLYHSPMSTASRFVRLILAEYGFQTDLVEEQPWERRREFLAL
                     NPAGTLPVYLDDNMRSLSGPYVLAEFLDETHGVLKRDRRLLAEDPFQRAEIRRLTEWF
                     LQKMENDVTRPLVRERVYKLQMTAAQGGGPPDSKLLRTARNNIRQHIKYLEWLAGSRT
                     WLAGDRLSYADLAAAAGVSVLDYLGEINWLEAPIAKEWYQRVKSRPSFRPFLSERIPR
                     LAPSSHYADLDF"
     gene            288790..289596
                     /gene="bacA"
                     /locus_tag="Atu0294"
                     /old_locus_tag="AGR_C_505"
     CDS             288790..289596
                     /gene="bacA"
                     /locus_tag="Atu0294"
                     /old_locus_tag="AGR_C_505"
                     /codon_start=1
                     /transl_table=11
                     /product="undecaprenyl pyrophosphate phosphatase, possible
                     bacitracin resistance protein"
                     /protein_id="AAK86109.1"
                     /translation="MGDQSIISALLLGIIEGLTEFIPVSSTAHVLLAGHFLGFKSPGN
                     TFAVLIQLGAILAILLVYFQKLVSIAVAMPTSAKARRFVLAVLVAFLPAAVIGALAHD
                     FIKTVLFETPMLICVVLIIGGFILLAVDRMPLKPKYTDIMDYPPSLAFKIGLFQCLAM
                     IPGTSRSGATIVGALLMGTDKRSAAEFSFFLAMPTMLGAFVLDLYKNRDALSFDDSAL
                     IAVGFVAAFVSGLFVVRSLLDFVSRRGFAPFAWWRIVIGALGLVALLVIG"
     gene            289836..290066
                     /locus_tag="Atu0295"
     CDS             289836..290066
                     /locus_tag="Atu0295"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAL41317.1"
                     /translation="MIAFQTFVRADRAAVCELRVRDMFGMWRISIKELAEYRVNAKSF
                     PQLRLCHACPFQRSTVNHAVSVLIFPPHPIWQ"
     gene            complement(290155..291135)
                     /locus_tag="Atu0296"
                     /old_locus_tag="AGR_C_511"
     CDS             complement(290155..291135)
                     /locus_tag="Atu0296"
                     /old_locus_tag="AGR_C_511"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH-ubiquinone oxidoreductase"
                     /protein_id="AAK86111.2"
                     /translation="MTLANLPPLVTVFGGSGFVGRHVVRMLAKRGYRIRVAVRRPDLA
                     GFLQPLGNVGQISFAQANLRYRDSIIKAVEDADHVVNCVGILAESGRNTFDAVQEFGA
                     KAIAEAARDTGATLTHISAIGADANSQTGYGRTKGRAEAAIHSVLPGAVILRPSIIFG
                     PEDDFFNKFAKMARNLPFLPLIGGGKTKFQPVYVEDVAEAVARSVDGKLKPGAIYELG
                     GPDVMTFRDCLEAVLAATYRERSFVNLPFGVASMIGKLASLVPLITPPLTPDQVTMLK
                     KDNVVSAEAEKKGLTLEGIGITPVRVASVLPSYMVQYRQHGQFSNAGKAA"
     gene            complement(291257..291544)
                     /locus_tag="Atu0297"
                     /old_locus_tag="AGR_C_513"
     CDS             complement(291257..291544)
                     /locus_tag="Atu0297"
                     /old_locus_tag="AGR_C_513"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86112.1"
                     /translation="MAKGYWIAQVDVRDSERYKDYVSTAKPAFERFGANFLARGGSVT
                     ELEGTARARNVVIEFPSVQHAIDCYNSPEYQAAAKIRQEVADAEMMIVEGI"
     gene            complement(291565..292272)
                     /gene="pyrF"
                     /locus_tag="Atu0298"
                     /old_locus_tag="AGR_C_515"
     CDS             complement(291565..292272)
                     /gene="pyrF"
                     /locus_tag="Atu0298"
                     /old_locus_tag="AGR_C_515"
                     /codon_start=1
                     /transl_table=11
                     /product="orotidine 5"
                     /protein_id="AAK86113.2"
                     /translation="MTAREKLIVGLDVPTVQQAEDIVSKIGDEVLFYKIGYQLVFAGG
                     LEFARDLVQSGKKVFLDMKLLDIDNTVASGVENIARMGMSMLTLHAYPKAMRAAVKAA
                     EGSGLCLLGVTVLTSMDDSDLVEAGYASDARSLVLRRAEQAREAGMGGIVCSAEESTA
                     VREILGPDLAVVTPGIRPAGADLGDQKRVMTPYDAIKAGSSHLVVARPIVRAEDPKAA
                     ARAILDDMLRASFPANQ"
     gene            complement(292277..292873)
                     /locus_tag="Atu0299"
                     /old_locus_tag="AGR_C_517"
     CDS             complement(292277..292873)
                     /locus_tag="Atu0299"
                     /old_locus_tag="AGR_C_517"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86114.1"
                     /translation="MHALYITHPQVKIDPAVPVPEWGLSERGAERAREASRLPWAKAL
                     RRIVSSAETKAIETAHMLAETSGAAIEIIEAMHENDRSATGFLPPPEFEKAADWFFAH
                     PEESFQGWERAIDAQARIVEAVKAVLDRHDARQPIAFVGHGGVGTLLKCHIEGRGISR
                     SKDQPAGGGNLFRFSIAEFSLAAASPTCDWTAMETWQG"
     gene            complement(292970..293563)
                     /locus_tag="Atu0300"
                     /old_locus_tag="AGR_C_518"
     CDS             complement(292970..293563)
                     /locus_tag="Atu0300"
                     /old_locus_tag="AGR_C_518"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="AAK86115.1"
                     /translation="MALNLKQRLEQKFEEEIRFFKGMVSQPKKVGAIVPTSSITAKKM
                     ASVINPHSGLPVLELGPGTGVITKAILARGIKPESLTAIEYSTDFYNQLLRSYPGVNF
                     VNGDAFDLDATLGEHKGQMFDSVISAVPMLNFPMAARIKLLDELLKRVPHGRPVVQIS
                     YGPISPIVAQPHLYHIRHFDFIVRNIPPAQLWTYTRA"
     gene            complement(293757..294875)
                     /gene="dnaN"
                     /locus_tag="Atu0301"
                     /old_locus_tag="AGR_C_520"
     CDS             complement(293757..294875)
                     /gene="dnaN"
                     /locus_tag="Atu0301"
                     /old_locus_tag="AGR_C_520"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III, beta chain"
                     /protein_id="AAK86116.2"
                     /translation="MRITLERSNLLKSLNHVHRVVERRNTIPILSNVLLRASGANLDM
                     KATDLDLEITEATPAMVEQAGATTVPAHLLYEIVRKLPDGSEVLLATNPDGSSMTVAS
                     GRSKFSLQCLPEADFPDLTAGTFSHTFKLKAADLKMLIDRTQFAISTEETRYYLNGIF
                     FHTIESNGELKLRAVATDGHRLARADVDAPSGSEGMPGIIIPRKTVGELQKLMDNPEL
                     EVTVEVSDAKIRLAIGSVVLTSKLIDGTFPDYQRVIPTGNDKEMRVDCQTFARAVDRV
                     STISSERGRAVKLALTDGQLTLTVNNPDSGSATEEVAVGYDNDSMEIGFNAKYLLDIT
                     SQLSGEDAIFLLADAGSPTLVRDTAGDDALYVLMPMRV"
     gene            295140..296081
                     /locus_tag="Atu0302"
                     /old_locus_tag="AGR_C_523"
     CDS             295140..296081
                     /locus_tag="Atu0302"
                     /old_locus_tag="AGR_C_523"
                     /codon_start=1
                     /transl_table=11
                     /product="tetrapyrrole methylase family protein"
                     /protein_id="AAK86117.2"
                     /translation="MIGSRVTQEISSSDARQAAKEFRIGTATIPARPLEPALYLVATP
                     IGNLGDITIRALETLASADVLACEDTRVTRILLERYGIRTRPLAYHEHNANEAGPKLI
                     AALEAGKSVALVSDAGTPLVSDPGYRLGQLALEAGHRVVPVPGASAPLAALVGSGMPS
                     DAFLFAGFLPVKDRGKRDRFAGLAKIPATLIFFESPRRIGASLKVASEVLGRDRRAVV
                     CRELTKTFEEFRRGTLGELADYYDGDRVVKGEIVLLVEPPSYDEIPDIEDVEKLLKDL
                     VATMSAAKAAGEAAKLTGLPRKELYQRLLDMKDTDGR"
     gene            296071..296439
                     /locus_tag="Atu0303"
                     /old_locus_tag="AGR_C_525"
     CDS             296071..296439
                     /locus_tag="Atu0303"
                     /old_locus_tag="AGR_C_525"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86118.1"
                     /translation="MAVDGQSNKRRKAERRGHAAEYWAALYLLLKGYRILAIRYRTRL
                     GEIDLIARKKDLIAIIEVKARASGGSAVDAVGFHSQQRIRAAADLWLSRRRDAGRFSL
                     RFDIVAVLPRRLPQHFIDAF"
     gene            296456..297016
                     /gene="nodL"
                     /locus_tag="Atu0304"
                     /old_locus_tag="AGR_C_527"
     CDS             296456..297016
                     /gene="nodL"
                     /locus_tag="Atu0304"
                     /old_locus_tag="AGR_C_527"
                     /codon_start=1
                     /transl_table=11
                     /product="nodulation protein L"
                     /protein_id="AAK86119.1"
                     /translation="MSTEREKMAAGEWYSCMGAELDMLRWHSRRAVHQHNTMPPDERG
                     TIGPLLRALFASVGEGAFIEAPFHCAYGFNITLGRNAYLNAGCTILDSAKVAIGDGAM
                     LGPAVQIYCAEHHLDPVPRAQGIEIAKPVTIGRDVWIGGGAIILAGITIGDGAIVGAG
                     SVVTRNVPARATVVGNPARPINRIAG"
     gene            297125..298423
                     /gene="ugpA"
                     /locus_tag="Atu0305"
                     /old_locus_tag="AGR_C_529"
     CDS             297125..298423
                     /gene="ugpA"
                     /locus_tag="Atu0305"
                     /old_locus_tag="AGR_C_529"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, substrate binding protein
                     (sn-glycerol 3-phosphate)"
                     /protein_id="AAK86120.1"
                     /translation="MLKKISMAAVAVSISATSSMAATNITWWHGMGGRNGEVINEVSQ
                     KFNEAQKECALTPVSKGSYEEALASGIAAFRSGEQPNILQVFDAGAATIINAKGAVIP
                     AEDLINKAGYKFDRDAFINGVRYFYAAADGKFVGMPFNSSAPIMYINDEALKKAGVEA
                     PKTWEEFEKVAPKLKEAGYIPLVQSQLTWQFTENFFSRNNIQFATNNNGYDSVTDTKL
                     KVTDPNLVMMFEKLKDWKDKGLFAYYGAGWNDNQKPFEEGKVALWIGSSGSFGGLQKT
                     ATMPFSATFLPYWGSIKGAGTNSFIGGAALFAMSGKSEAENKCVADFFQFLTSPEIQV
                     FYHKATGYVAITKAAYEKAKTEGYYKEKPVAEVGIQQLSLPGGEWSKGYRLGFYPQIR
                     AVMEREYNRIFSGEVTPKAAFEIIEKEGNDLLARFAKTAG"
     gene            298594..299475
                     /gene="ugpA"
                     /locus_tag="Atu0306"
                     /old_locus_tag="AGR_C_531"
     CDS             298594..299475
                     /gene="ugpA"
                     /locus_tag="Atu0306"
                     /old_locus_tag="AGR_C_531"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, membrane spanning protein
                     (sn-Glycerol-3-phosphate)"
                     /protein_id="AAK86122.1"
                     /translation="MKRVQFSSSYVPYLFLAPQLAVIFIFFYWPSVQAVQSSFYIEDP
                     FGFAASFVGFANYSDAIFNPEYLSIAKFTVVFTVLVTFFSLALGLLLAVKADAVIRGS
                     STYKTLLISVYAIAPPVAGLIGMMLFDQHIGPFVKLAAVFGWDMKVGLNYFDTATAMI
                     VVAVWKQIPYNFIFFLSGLQGVSVSVREAAAIDCRSGFRRFWTVIMPLLAPTAFFLLI
                     INITYALFDTFGVIDVMVKDKAADNPITLVYKVFLDGFRGNDIGGSSAQSVILMLVVF
                     VLTVIQFRFIEKRVHYN"
     gene            299487..300329
                     /gene="ugpE"
                     /locus_tag="Atu0307"
                     /old_locus_tag="AGR_C_532"
     CDS             299487..300329
                     /gene="ugpE"
                     /locus_tag="Atu0307"
                     /old_locus_tag="AGR_C_532"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, membrane spanning protein
                     (sn-Glycerol-3-phosphate)"
                     /protein_id="AAK86123.2"
                     /translation="MYKTRPLDHLVLILGALFLILPVVVAFMTSTHTAAEIHRSGLTI
                     VPGDNFVETYEKVLTQKGGFTGQVTGLNMVINSLVLGIGFAVGKIVLSMTAAYAIVYF
                     RFRFATLAFWIIFTTLLLPLEVRIMPSYEVMSKLGLLNSYTGLIVPLLASATGTFYFR
                     QFFKSVPEELLEAARIDGAGPVKFFIDILIPLSRTMMSAIFIIMFVYGWNQYLWPMLM
                     TTDERFFTLMRGIKSILQVWVGSQIPDYNEAFALAVLAMLPPVLIVVIFQRWFIKGLT
                     ESDK"
     gene            300340..301440
                     /gene="ugpC"
                     /locus_tag="Atu0308"
                     /old_locus_tag="AGR_C_533"
     CDS             300340..301440
                     /gene="ugpC"
                     /locus_tag="Atu0308"
                     /old_locus_tag="AGR_C_533"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, nucleotide binding/ATPase
                     protein (sn-Glycerol-3-phosphate)"
                     /protein_id="AAK86124.1"
                     /translation="MAAIEISQVCKDYHGGVRAVHHVDIDIRDGEFIVLVGPSGCGKS
                     TLLRMVAGLEDISEGTVKIGDRVVNQTDPADRDIAMVFQNYALYPHMSVRENLEYGLK
                     NRKTAKTEIDARVAEAARMLQLEPYLERKPRALSGGQRQRVAMGRAIVRKPAAFLFDE
                     PLSNLDAKLRVSMRGEIKRLQKRLGTTSIYVTHDQLEAMTLADRLVVLNGGRIEQIGA
                     PLDVYHTPASTFVASFIGSPAMNLLNAELHGDSLAIGPSLFALNGFAPTSGPVTVGMR
                     AEDFRLAAAGEQGFAFRVDYIEELGSQRLIHGMIGDQNLTIAFPPDVDVPAALSITIA
                     SEKLHFFSSETGKRIAGKAEQLGVQSAQMATA"
     gene            301550..302062
                     /locus_tag="Atu0309"
                     /old_locus_tag="AGR_C_536"
     CDS             301550..302062
                     /locus_tag="Atu0309"
                     /old_locus_tag="AGR_C_536"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86125.1"
                     /translation="MSFKMMFAAAATMAIRTVPILPAYLRRQKDEAVVSASCTDLRLQ
                     PAPINPEWIISGNPQARAADHSRSGDRASSTAMWDCTAGEFRWFFGWDETVYILEGEV
                     HVTAEDGSVSILRVGDVAYFRAGTWATWRVDDYVRKVAFMRRPFPTALALAYRVKNKL
                     FAGRSYKLAA"
     gene            302305..303264
                     /gene="gshB"
                     /locus_tag="Atu0310"
                     /old_locus_tag="AGR_C_538"
     CDS             302305..303264
                     /gene="gshB"
                     /locus_tag="Atu0310"
                     /old_locus_tag="AGR_C_538"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione synthetase"
                     /protein_id="AAK86126.2"
                     /translation="MAKIKNVAIQMDHVSGINIAGDSTFAISLEAQARGYRLFHYTPE
                     RLSMRDGKIYATVEQMELRDIKGDHFSLSEPERVDLSTMDVIHLRQDPPFDMAYITST
                     HLLERIHPKTLVVNDPAWVRNSPEKIFVTEFADLMPKTLITKDVSEIARFRNEMGDII
                     LKPLYGNGGAGVFHSARDDRNFSSLLEMFGQMFREPYIAQEYLPDVRKGDKRILLVDG
                     EPVGAINRVPAENDARSNMHAGGRPEPTELTAREQEICRRIGPALRERGFLFVGIDVI
                     GDYMTEINVTSPTGIREVRKFGGADVASLLWDAIEKKRDAQDF"
     gene            303448..304980
                     /locus_tag="Atu0311"
                     /old_locus_tag="AGR_C_541"
     CDS             303448..304980
                     /locus_tag="Atu0311"
                     /old_locus_tag="AGR_C_541"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86127.2"
                     /translation="MVARVNTVAFQGIEGVPVEVQVMVAPGKIGIQIVGLPDKAVAES
                     RERVQAALHASGLALPAKKVTVNLAPADLPKEGSHFDLPIALGLMAALGAIPAEALSQ
                     YVVLGELNLDGTIGTVSGALPAAIGANALGKGLICPAESGPEAAWAGAGIDILAPRSL
                     IALANHFRGTQLLSRPTPAIRANPVNLPDLADIKGQESARRAMEVAAAGGHNLLMVGP
                     PGSGKSMLAARLPSILPPLEVAELLEVSMVHSIAGQLSGGKLSDRRPFRTPHHSATMA
                     ALIGGGLRARPGEASLAHHGVLFLDEFPEFSPQVLDALRQPLETGECIIARANHRVSY
                     PAEIQLVAAMNPCRCGMAGEPGFTCARGPRCVTDYQSRISGPLLDRIDIRIDVPAVSA
                     TDLIRPVVSEPSAVVAARVARARLAQQERYAAAGFPAIRTNARCTTTLIEKYAEPDAS
                     GLQLLRDAAERLKFSARGYHRILKVARTLADLDGKQTVGRIHVAEAVSYRIAGERLTV
                     AA"
     gene            complement(305093..306061)
                     /gene="cysK"
                     /locus_tag="Atu0312"
                     /old_locus_tag="AGR_C_543"
     CDS             complement(305093..306061)
                     /gene="cysK"
                     /locus_tag="Atu0312"
                     /old_locus_tag="AGR_C_543"
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine synthase"
                     /protein_id="AAK86128.1"
                     /translation="MPEARKPGRGRVYSSITETIGDTPIVRLDKLAKEKGVKANLLAK
                     LEFFNPIGSVKDRIGVAMIEALEAQGKITPGKTTLVEPTSGNTGIALAFAAAAKGYKL
                     ILTMPETMSVERRKMLALLGAELVLTEGPKGMKGAIAKAQELAETLPDAVIPQQFENP
                     ANPDIHRRTTAEEIWNDTDGTVDILVSGIGTGGTITGTGQVLKSRKPEVKVIAVEPAD
                     SPVLSGGNPGPHKIQGIGAGFAPAILDTGVYDEIVTVTNDEAFEIARLAARLEGVPVG
                     ISSGAALAAAIKVGAREENAGKNIVVIIPSFAERYLSTALFEGLGL"
     gene            complement(306202..306819)
                     /locus_tag="Atu0313"
                     /old_locus_tag="AGR_C_546"
     CDS             complement(306202..306819)
                     /locus_tag="Atu0313"
                     /old_locus_tag="AGR_C_546"
                     /codon_start=1
                     /transl_table=11
                     /product="RhtB family transporter"
                     /protein_id="AAK86129.2"
                     /translation="MTLTTLLAYATALFIAAAIPGPGMTAIVARALGSGFRETFFMGL
                     GLVLGDMIYLTGVILGLAFVAQTFQEAFMVLKFAGAAYLLYIAWKLWTAGLLPQDLKA
                     RKSTSIPMSFLSGLLITLGNPKTMLFYVALVPTLIDIRMIGPSEYATLLALTFVVLMA
                     VLLPYILLAAKARNLLKRPSALTILNRTAAGILAGTATMIAIRST"
     gene            complement(306897..307367)
                     /gene="dut"
                     /locus_tag="Atu0314"
                     /old_locus_tag="AGR_C_548"
     CDS             complement(306897..307367)
                     /gene="dut"
                     /locus_tag="Atu0314"
                     /old_locus_tag="AGR_C_548"
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyuridine 5"
                     /protein_id="AAK86130.1"
                     /translation="MTVQNDNRPLLRLVRLANGADLELPSYETRGAAGMDLRAAVPAD
                     EPLNLQPGERALVPTGFIFEVPQGYEAQIRPRSGLAIKNGITCLNSPGTVDSDYRGEV
                     KVILANLGQDDFTIERGMRIAQMVIAPVTQVTVSEVTETSETARGAGGFGSTGV"
     gene            307457..309040
                     /gene="prfC"
                     /locus_tag="Atu0315"
                     /old_locus_tag="AGR_C_549"
     CDS             307457..309040
                     /gene="prfC"
                     /locus_tag="Atu0315"
                     /old_locus_tag="AGR_C_549"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 3"
                     /protein_id="AAK86131.1"
                     /translation="MAETLAEAVSRRRTFAIIAHPDAGKTTLTEKLLLFGGAIQLAGE
                     VKAKKDRIQTRSDWMKIERERGISVVTSVMTFEYNDRVFNILDTPGHEDFADDTYRTL
                     TAVDAAIMVIDAAKGIEPRTLKLFEVCRMRDIPIITFINKMDRESRDPFEILDEVEEK
                     LALDTAPITWPVGRAKSFCGAYNLAENTFRGNDTQVDGLSVNGPQAVADRLPENERKV
                     FVEETELALEACRPFDRQAFLEGHMTPVFFGSALRNFGVRDLINALGDFAPPPRDQVA
                     DTRVVHAAEDKMTAFVFKIQANMDPNHRDRIAFARICSGKLERGMKARLSRTGKLMGL
                     TAPQFFFASQRQLADTAFAGDVVGIPNHGTLRIGDTLTEGENLVFQGVPNFSPEILRR
                     VRLEDAMKAKKLKEALQQMAEEGVVQLFSPEDGSPAIVGVVGALQLDVLKERLMGEYG
                     LPVSFEMSRFSVCRWISSDQPAEMDKFLNVKRGDIARDLDGDPVFLAQDAFSLRYESE
                     RFPAIKMVAIKEYHVAKAA"
     gene            309110..310315
                     /gene="dfp"
                     /locus_tag="Atu0316"
                     /old_locus_tag="AGR_C_552"
     CDS             309110..310315
                     /gene="dfp"
                     /locus_tag="Atu0316"
                     /old_locus_tag="AGR_C_552"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA/pantothenate metabolism flavoprotein"
                     /protein_id="AAK86132.2"
                     /translation="MTLSGKHILLIISGGIAAYKSLDLIRRLKERGAKVTPVMTKGAQ
                     EFVTPLAVGALSASNVFTEIFSRQDEQDVGHIRLARDCDLVLVAPATADLMAKMANGL
                     ADDLASAVLLATDRKVLVAPAMNPKMWSAKPTMRNVETLKRDGVFFIGPMAGEMAETG
                     EAGLGRMAEPLQIVEAVLSLLDGSSKPLKGKTAIVTSGPTHEPIDPVRYIANRSSGKQ
                     GHAIAAALAALGAEVTLVSGPVTIADPAGVTTIHVERAEEMRDAVISRLPADIAVMVA
                     AVADWRVTGSSEQKIKKQPGDAPPALQLTENPDILKTVGHHEKRPRVVVGFAAETQDV
                     EKNGRAKLERKGADYIIANDVSAETGIMGGDRNSVKIISADGVEAWPDLDKAEVAKRL
                     AALIAEKLA"
     gene            310312..310686
                     /locus_tag="Atu0317"
                     /old_locus_tag="AGR_C_555"
     CDS             310312..310686
                     /locus_tag="Atu0317"
                     /old_locus_tag="AGR_C_555"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86133.1"
                     /translation="MTLFDRKTFDRVLGEWPGVRFVDQWDSHVAKVGDKVFAVLGERE
                     DWRLVVKCSEESFEILTSLEGIAQAPYFAKRKWISIGDHSPLEQEELEHYVRRSYELV
                     AAGLTKKLRGELGIVIDNAPRL"
     gene            complement(310694..311608)
                     /locus_tag="Atu0318"
                     /old_locus_tag="AGR_C_556"
     CDS             complement(310694..311608)
                     /locus_tag="Atu0318"
                     /old_locus_tag="AGR_C_556"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86134.2"
                     /translation="MAKAQVIKQALSYSSWPLVFGGGLAGSYFAFAGSHPIAAFLAVY
                     AGAVLSLFLLERYIPYEVEWLEGDGETMTSIGHTLLTKGLVQLAAAAAAIFPMLAANV
                     LQPLAAMRFDLWPSHLPVIVQVALAVTIAEFGLYWAHRIAHETVFFWRFHALHHSVVR
                     LWVVNTGRFHVADSLFKITLSQIPLYFMGAPLQVFWWLGAVTAFIGILTHCNVDMKTG
                     LLDYIFSTPRLHRWHHSKQLPEGNTNYGENLVIFDILFGSYHNPDRPSSTDIGIKGEI
                     AKGFVPQLLQPFTKEGVRQIIGKDKKVS"
     gene            complement(312080..313654)
                     /gene="aarF"
                     /locus_tag="Atu0319"
                     /old_locus_tag="AGR_C_558"
     CDS             complement(312080..313654)
                     /gene="aarF"
                     /locus_tag="Atu0319"
                     /old_locus_tag="AGR_C_558"
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinone biosynthesis protein"
                     /protein_id="AAK86135.1"
                     /translation="MSTLGAYFRLARVGWVLVREGVVLALPSDDLPAPAQLLKAALKP
                     FARSKAKRAQRSDRLAVAVERLGPSYVKMGQFLATRPDVVGADFADDLASLQDRMAFF
                     PAAAAKANIEGSLGRSISELYREFGDPIAAASIAQVHPAMVDTPKGPRKVAVKVIRPG
                     VRQRFQNDLEAMYLIADLQQRFVRSARRLRPVEVTRTLEQTTKIEMDLRLEAAALSEL
                     AENTRQDPGFRVPEVDWERTGRDVVTMEWIDGVKMSDIEGLKAAGHDLNKLADTLIQS
                     FLRHTLRDGFFHADMHPGNLFVDAKGEIVAVDMGIAGRLGKKERRFLAEILYGFITRD
                     YMRVAEVHFEAGYVPGHHDKASFAQAIRAIGEPIHGQPAETISMGKLLTLLFEVTELF
                     DMETRPELVMLQKTMVVVEGVSRMLNPRFNMWKAADPVVGGWIRDNLGPKRIATDLKD
                     GVKAALKLAEAVPEIAAKTEKLHSELMYMSENGLRFDAQTAEAIGKAEARHTKWGRIA
                     LWVIALTLLYIAIRIS"
     gene            complement(313691..314467)
                     /gene="ubiE"
                     /locus_tag="Atu0320"
                     /old_locus_tag="AGR_C_559"
     CDS             complement(313691..314467)
                     /gene="ubiE"
                     /locus_tag="Atu0320"
                     /old_locus_tag="AGR_C_559"
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinone/menaquinone biosynthesis
                     methyltransferase"
                     /protein_id="AAK86136.2"
                     /translation="MTDARTTAEGGMETSYGFHKVDEGKKQGLVNEVFHKVAKRYDIM
                     NDVMSAGLHRLWKDAMVSALSPRKDPSYKILDVAGGTGDVAFRIIEASNRLAHATVLD
                     INGSMLAVGEERAAKKKLSDNLTFVEANAEELPFEANTFDAYTVAFGIRNVPRIDVAL
                     KEAYRVLKRGGRLLVLEFSEVDMPLLDRVYDAWSFNAIPQFGKMITGDAEPYQYLVES
                     IRKFPNQEDFATMIRTAGFSRVTYTNYTGGIAALHSGWKL"
     gene            314611..315507
                     /gene="mutM"
                     /locus_tag="Atu0321"
                     /old_locus_tag="AGR_C_561"
     CDS             314611..315507
                     /gene="mutM"
                     /locus_tag="Atu0321"
                     /old_locus_tag="AGR_C_561"
                     /codon_start=1
                     /transl_table=11
                     /product="formamidopyrimidine-DNA glycosylase"
                     /protein_id="AAK86137.2"
                     /translation="MPELPEVETVRRGLAPAMEGARVRKLHLGRPDLRFPFPADFAGL
                     IEGKTIISLGRRAKYLLIELEDGLTIVSHLGMSGSFRIEAEKGEGGEAPGAFHYARSK
                     DGKHDHVVFHLDKGEERVCVIYNDPRRFGFMHLVERNKLDLYPAFAELGPEPTGNALS
                     ADYLASRFEGKSQPLKSTLLDQKIIAGLGNIYVCEALWRAHLSPLRAAGTLVTTRGKP
                     KAQLIDLTEKIRDVIADAIAAGGSSLRDHIQTDGTLGYFQHSFSVYDQEGQPCRTPGC
                     GGTVERVVQAGRSTFYCAACQK"
     gene            315554..316315
                     /gene="fadB"
                     /locus_tag="Atu0322"
                     /old_locus_tag="AGR_C_562"
     CDS             315554..316315
                     /gene="fadB"
                     /locus_tag="Atu0322"
                     /old_locus_tag="AGR_C_562"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl CoA hydratase"
                     /protein_id="AAK86138.2"
                     /translation="MILVEKRDEVGVITLNRPKVLNALNSVLLKELRHILSSFSADDS
                     IGAIIITGSEKAFAAGADIKEMQGLDFVDAYVGDFLGGWDEVAATRKPVIAAVSGFAL
                     GGGCELAMMCDFIIASDTAKFGQPEITLGVIPGMGGSQRLTRAVGKAKAMDLVLTGRM
                     MDAAEAERAGLVSRIVPAADLMEVAVEAATRIASLSRASVLMAKESVNRSFEVPLAEG
                     LRYERRAFQSLFATEDQKEGMAAFVEKRKPAFRNR"
     gene            316511..316777
                     /gene="rpsT"
                     /locus_tag="Atu0323"
                     /old_locus_tag="AGR_C_563"
     CDS             316511..316777
                     /gene="rpsT"
                     /locus_tag="Atu0323"
                     /old_locus_tag="AGR_C_563"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S20"
                     /protein_id="AAK86139.1"
                     /translation="MANTTSAKKATRKIARRTAVNKARRSRVRGFIRKVEEAIATGDL
                     AVATEALKAAQPEIQRAATRGVLHGNTASRKVSRLAQRVKALSA"
     gene            317547..319109
                     /gene="dnaA"
                     /locus_tag="Atu0324"
                     /old_locus_tag="AGR_C_566"
     CDS             317547..319109
                     /gene="dnaA"
                     /locus_tag="Atu0324"
                     /old_locus_tag="AGR_C_566"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="AAK86141.2"
                     /translation="MQLNLAMGAVADGDRAPKACDAACSEAAGDKSAMMHDALFERFS
                     ARLKAQVGPEVYASWFARLKLHTVSKSVVRFTVPTTFLKSWINNRYMDLITSLVQSED
                     PDVLKVEILVRSASRPVRPAQTEERAQPVQEVGAAPRNKSFIPSQSATAPAAQPMAAQ
                     ATLRQGGSGPLFGSPLDTRFTFDTFVEGSSNRVALAAAKTIAEAGAGAVRFNPLFIHA
                     GVGLGKTHLLQAIANAAIDSPRNPRVVYLTAEYFMWRFATAIRDNDALTLKDTLRNID
                     LLVIDDMQFLQGKMIQHEFCHLLNMLLDSAKQVVVAADRAPWELESLDPRVRSRLQGG
                     MAIEIEGPDYDMRYEMLNRRMGSARQDDPSFEISDEILTHVAKSVTASGRELEGAFNQ
                     LMFRRSFEPNLSVDRVDELLSHLVGSGEAKRVRIEDIQRIVARHYNVSRQELVSNRRT
                     RVIVKPRQIAMYLAKMLTPRSFPEIGRRFGGRDHTTVLHAVRKIEDLISGDTKLGHEV
                     ELLKRLINENNA"
     gene            complement(319179..320378)
                     /gene="hemN"
                     /locus_tag="Atu0325"
                     /old_locus_tag="AGR_C_568"
     CDS             complement(319179..320378)
                     /gene="hemN"
                     /locus_tag="Atu0325"
                     /old_locus_tag="AGR_C_568"
                     /codon_start=1
                     /transl_table=11
                     /product="oxygen-independent coproporphyrinogen III
                     oxidase"
                     /protein_id="AAK86142.2"
                     /translation="MVGEHQLSAPGASLLPDTGDPGFGIYLHWPFCAAKCPYCDFNSH
                     VRHRPVDQERFTAAFLREMEHMRTLSGPRVVTSIFMGGGTPSLMDPQTVGALLDGISR
                     FWHVPDGIEITMEANPSSVEAERFRGYRAAGVNRVSLGVQALNDRDLKFLGRLHDVAD
                     ALKAIRLAREIFPRMSFDLIYARPNQTVAEWDAELKEAVSYAVDHLSLYQLTIEEGTP
                     FYGLHKAGKLIVPDGEHSAVLYEATQEITERYGMPAYEVSNHARPGAESRHNLTYWRY
                     GDYAGIGPGAHGRLTRGASKLATATERHPETWLETVEREGHGMVDQELLGVDEQADEL
                     LLMGLRLREGIDLARWSDLSGRDLDPEKEEFLLQHGFVERLGNSRLRCTPSGMLILDA
                     VVADLAC"
     gene            complement(320384..321028)
                     /gene="ham1"
                     /locus_tag="Atu0326"
                     /old_locus_tag="AGR_C_570"
     CDS             complement(320384..321028)
                     /gene="ham1"
                     /locus_tag="Atu0326"
                     /old_locus_tag="AGR_C_570"
                     /codon_start=1
                     /transl_table=11
                     /product="putative deoxyribonucleotide triphosphate
                     pyrophosphatase"
                     /protein_id="AAK86143.2"
                     /translation="MRKLDTRTIVVASHNKGKIAEIADLIGPFGFSAKSAAELNFSEP
                     EETGTTFEENAAIKALASAKASGLPALSDDSGLVIDALDGAPGVYTANWAETADGTRD
                     FAMAMQKVEDALAERGASKPEDRTARFVSVLCLAWPDGHVEYFRGEVEGTVVWPPRGT
                     SGFGYDPIFKPDGYDTTFGEMSADEKHGWKHGDAFALSHRARAFKKFVETCLEA"
     gene            complement(321046..321762)
                     /gene="rph"
                     /locus_tag="Atu0327"
                     /old_locus_tag="AGR_C_571"
     CDS             complement(321046..321762)
                     /gene="rph"
                     /locus_tag="Atu0327"
                     /old_locus_tag="AGR_C_571"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease PH"
                     /protein_id="AAK86144.2"
                     /translation="MRPSGRKTDQMRKVSFERNFSKHAEGSCLVKFGDTHVLVTASLE
                     EKTPPWLRNSGKGWVTAEYGMLPRSTNERMKREAASGKQGGRTQEIQRLIGRSLRAVV
                     DLQALGERQISIDCDVIQADGGTRTASITGAWIALHDCLKWMETRNMIKVEKVLKDHI
                     AAISCGIFAKQPVIDLDYLEDSSAETDANFVITGSGGIVEVQGTAEGAPFSEEEFLTL
                     LGLAKAGCSELVALQKQAIA"
     gene            321899..322990
                     /gene="hrcA"
                     /locus_tag="Atu0328"
                     /old_locus_tag="AGR_C_572"
     CDS             321899..322990
                     /gene="hrcA"
                     /locus_tag="Atu0328"
                     /old_locus_tag="AGR_C_572"
                     /codon_start=1
                     /transl_table=11
                     /product="heat-inducible transcription repressor"
                     /protein_id="AAK86145.1"
                     /translation="MGFSAPLSKDQASLLDERSREIFRRIVEGYLDTGEPLGSRSLSR
                     LLPMSLSPASVRNVMSDLEELGLIYSPHISAGRLPTQTGLRFFVDAFMQVGDLPADER
                     ANIDRQIGPVAGHEQSLEGLLTEASRMLSGMSRGAGLVLTAKNDVILKHVEFIRLEPT
                     KALAVLVGDHNQVENRIIELPAGISSSQLTEAANFINAHLSGQTLQELRGQFQTQRTE
                     LQSELGMLAQDLVERGLAIWAGDNEEGKLGRLIVRGRSNLLEGLAGEEDIDRVRMLFD
                     DLERKENLIEILNLAESGSGVRIFIGSENKLFSLSGSSLIVAPYRDEENRVVGAVGVI
                     GPTRLNYARIVPMVDYTAQIMARLSRKQR"
     gene            323105..323740
                     /gene="grpE"
                     /locus_tag="Atu0329"
                     /old_locus_tag="AGR_C_573"
     CDS             323105..323740
                     /gene="grpE"
                     /locus_tag="Atu0329"
                     /old_locus_tag="AGR_C_573"
                     /codon_start=1
                     /transl_table=11
                     /product="GRPE protein"
                     /protein_id="AAK86146.1"
                     /translation="MTDDTKKPGPDADVAEEFVDPAQAGEEQAETAEPDPVELLKAEN
                     ADLRDKFLRLAAEMDNLRRRTERDVKDAKAYSLAGFARDMLAVSDNLRRALEAIPDEL
                     KTNGEAGLNGLIEGVEMTERSMLSTLERHGVKKIDAEGQKFDPNFHQAMFEVPNTAVP
                     NNTVLQVIQAGFTIGDRVLRPAMVGVAKGGPKAEPSASAEPGTSSLNEKDA"
     gene            complement(323822..324283)
                     /gene="ptsN"
                     /locus_tag="Atu0330"
                     /old_locus_tag="AGR_C_576"
     CDS             complement(323822..324283)
                     /gene="ptsN"
                     /locus_tag="Atu0330"
                     /old_locus_tag="AGR_C_576"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulatory IIA protein"
                     /protein_id="AAK86147.1"
                     /translation="MALADLLQQDAIIPALKVNSKKQLLQELAAKAARITGVSEREVF
                     DVILQREKLGSTGVGHGIAIPHGKLNSIHQITGVFARLETPVDFEALDDQPVDLVFLL
                     LAPEGAGADHLKALSRIARALRDPELVTKLRATDSDTAIYAFLNQEQATAA"
     gene            complement(324366..324938)
                     /locus_tag="Atu0331"
                     /old_locus_tag="AGR_C_579"
     CDS             complement(324366..324938)
                     /locus_tag="Atu0331"
                     /old_locus_tag="AGR_C_579"
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-54 modulation protein"
                     /protein_id="AAK86148.2"
                     /translation="MSVRVSGKHMEIGESFRQRIEDNIGLAVTKYFDGGYSGQVTVEK
                     SGSRFAADCKLHLDTGVVLHAAGQANDPQASFDAAAERIEKRLRRYKRKLKDHHSGSN
                     GALPEIAYTVMDAVPDEDHEVPEDYAPTIVAESSKQIKTMSVASAVMALDMTDEPVLL
                     FRSPGKEYLNIVYRRHDGNIGWIDAETIKS"
     gene            complement(325172..326716)
                     /gene="rpoN"
                     /locus_tag="Atu0332"
                     /old_locus_tag="AGR_C_581"
     CDS             complement(325172..326716)
                     /gene="rpoN"
                     /locus_tag="Atu0332"
                     /old_locus_tag="AGR_C_581"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma-54 factor"
                     /protein_id="AAK86149.1"
                     /translation="MALSASLLLRQNQSLVMTPQLMQSIQLLQMTHFELTQFIAQEVE
                     RNPLLEIAANDGDLGSDTPVDVDNFGDAEASDAAVRVTPDSDDWYGERAANLGEQLDT
                     SFENVFPDDGEPRKADAPELASQWKSMPGQESGESYDLDDFVAARQSLSDHLNQQLPL
                     AISAAEDRMIADALIGQLDETGYIAADAVDDVAERLGATPSAVEYVLKTLQGFDPPGI
                     FSRSLSECLATQLAQKDRLDPAMRAFVDNLELLAKRDFASLKKLCGVDEEDLLDMLAE
                     IRTLNPRPGAGYDSMVSETIVPDIIVRPSSTGGWLVEINPDTLPRVLINQSYFAEVSK
                     HKARAGEDQDFLSECMQTAHWLTRSLDQRARTIMKVASEIVRQQDAFLINGVDQLRPL
                     NLKTVADAIKMHESTVSRVTSKKYMLTPRGLFELKYFFSVSISAVEGGDSHSAEAVRH
                     RIKAMIAQEAAEAVLSDDDIVDNLKKTGIDIARRTVAKYREAMNIPSSVQRRREKKAM
                     AKLSAF"
     gene            complement(326869..327678)
                     /locus_tag="Atu0333"
                     /old_locus_tag="AGR_C_582"
     CDS             complement(326869..327678)
                     /locus_tag="Atu0333"
                     /old_locus_tag="AGR_C_582"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, nucleotide binding/ATPase
                     protein"
                     /protein_id="AAK86150.1"
                     /translation="MKIPSISKILGGGRNRSADAASPADKTPYQGTLIAHGLTKTYDT
                     RRVVNGVSLVVRRGEAVGLLGPNGAGKTTCFYMITGLVPVDSGKIAINGNDVTGMPMY
                     RRARLGVGYLPQEASIFRGLTVEENIRAVLEVHEPDAAKRNRKLDELLEEFHIAQLRK
                     SPAVALSGGERRRLEIARALATDPTFMLLDEPFAGVDPISVSDIQNLVRHLTARGIGV
                     LVTDHNVRETLGLIDRAYIIHAGEVLTHGRPDDIVNNPDVRRLYLGNNFSL"
     gene            complement(327688..328251)
                     /locus_tag="Atu0334"
                     /old_locus_tag="AGR_C_585"
     CDS             complement(327688..328251)
                     /locus_tag="Atu0334"
                     /old_locus_tag="AGR_C_585"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86151.2"
                     /translation="MMQISRPVSLGRTAGLTAAGLFFSCLATVAFAQNTTSSMQGVKL
                     SGDQPIAIESDQLEIRDQERKAYFTGNVKVVQGTTTLQAGKMTVNYKGQGSSLTSGDA
                     NIEKIFVDNNVYLTSETQKATADHGEFDMAAQTFILTGKQVVLSEGTNVFTGCKLTVL
                     MNTGQAKLESCGGPVRIMLDPKSQKKQ"
     gene            complement(328265..328972)
                     /locus_tag="Atu0335"
                     /old_locus_tag="AGR_C_586"
     CDS             complement(328265..328972)
                     /locus_tag="Atu0335"
                     /old_locus_tag="AGR_C_586"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86152.1"
                     /translation="MRLNGAGEAFGPTPMLERLREPAPAFSLPNDQNGAYDTALRHSA
                     RVKRLKIILPLSAAIISLAFIAVSVIRTWAPEKVSLESARIEDGKIVMEKPAVAGRNE
                     KGIDYSMNADRALQDIANPNLMTLEKVLAAVPVNDSVAQVIAQEGIFDRSTNTLKMTA
                     PFDINLSNGIQAKFQSADVDLKAGKMSSKEPVSIKTNDGSIVAQSIDIADNGKTITFS
                     GQVRARIAASNIKNEGK"
     gene            329164..330117
                     /gene="sppA"
                     /locus_tag="Atu0337"
                     /old_locus_tag="AGR_C_588"
     CDS             329164..330117
                     /gene="sppA"
                     /locus_tag="Atu0337"
                     /old_locus_tag="AGR_C_588"
                     /codon_start=1
                     /transl_table=11
                     /product="proteinase IV"
                     /protein_id="AAK86153.1"
                     /translation="MDNMAIADRRRLRRKLTFWRVAAVLLLVVGAFGLYRFFWQGPQQ
                     SAKPHIARIEVSGLITDNTELLERLDKIAKSDNVKGLIVSISSPGGTTYGGERIFKVI
                     RSVAEKKPVVSDVRTLAASAGYMIASAGDVIVAGETSITGSIGVIFQYPQLGQLMEKL
                     GVSLQEIKSSPMKAEPSPFHEAPEEAKTMIRAMVMDSYGWFVDLVADRRKLPREEVLK
                     LADGSIFTGRQALANKLVDTLGGEKEVRAYFETRGVAKDLPIVEWRAPSSNSPFALFS
                     VAQIAKLLGYDDLIPFAGPSQLGADKLFLDGLVSVWQVEPR"
     gene            330144..330446
                     /gene="ihfB"
                     /locus_tag="Atu0338"
                     /old_locus_tag="AGR_C_589"
     CDS             330144..330446
                     /gene="ihfB"
                     /locus_tag="Atu0338"
                     /old_locus_tag="AGR_C_589"
                     /codon_start=1
                     /transl_table=11
                     /product="integration host factor, beta subunit"
                     /protein_id="AAK86154.1"
                     /translation="MIKSELVQIVAARNPHLYHRDVENIVNAVLDEITDALAAGNRVE
                     LRGFGAFSVKNRPSRSGRNPRTGESVFVEEKWVPFFKTGKELRERLNPGMGDEEDD"
     gene            330498..330854
                     /locus_tag="Atu0339"
                     /old_locus_tag="AGR_C_590"
     CDS             330498..330854
                     /locus_tag="Atu0339"
                     /old_locus_tag="AGR_C_590"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86155.2"
                     /translation="MEYCRMSKKIINLIILLPLAIILVILCVANRQSVTLALNPFRPD
                     DGVLSFTAPFFVFLFLAVIFGVLMGSAATWFAQGKHRKRARIEAKEAVRWHDEANRQK
                     AAATGQLPHAGQLPAK"
     gene            331152..332081
                     /locus_tag="Atu0340"
                     /old_locus_tag="AGR_C_592"
     CDS             331152..332081
                     /locus_tag="Atu0340"
                     /old_locus_tag="AGR_C_592"
                     /codon_start=1
                     /transl_table=11
                     /product="SAM dependent methyltransferase"
                     /protein_id="AAK86156.1"
                     /translation="MQRTGELPAEHVPVILESSGAGDFHLIDSGNGLKLEQYGDYRVV
                     RPEAQALWRPLVPDRVWQNADAIFTGDTDEDGMGRWRFPKEALGETWPLSLLGVEFLG
                     RFTAFRHVGVFPEQIVHWEWLKNAVETADRPLKVLNLFGYTGVASLVAAAAGAEVTHV
                     DASKKAIGWAKENQVLAGLEQAPIRWICEDAMKFIQREERRGSTYDIILTDPPKFGRG
                     THGEVWQLFDHLPLMLDICREILSPKALGLVLTAYSIRASFYSMHELMRETMRGAGGV
                     VASGELVIREAGLDGKTPGRVLSTSLFSRWEPK"
     gene            332078..332938
                     /gene="trmH"
                     /locus_tag="Atu0341"
                     /old_locus_tag="AGR_C_593"
     CDS             332078..332938
                     /gene="trmH"
                     /locus_tag="Atu0341"
                     /old_locus_tag="AGR_C_593"
                     /codon_start=1
                     /transl_table=11
                     /product="rRNA methylase"
                     /protein_id="AAK86157.2"
                     /translation="MTKDMRENITRRVGQVKEVTSLANPIIKDIKALTQKKGREETGT
                     FMAEGLKLVIDALELGWTIKTLVYAKAAKGKPLVEQAAVKTVASGGLVLEVSEKVIAS
                     ITRRDNPQMVVGIFEQKWKPLKDIRPEKGETYIALDRVRDPGNLGTIIRTADAAGASG
                     VILVGDCTDPFSLETVRATMGSVFATPVARASVEEFLSWKKSAHVSVVATHLAGSVDY
                     RKIDYAGKPVVILMGNEQSGLPPELAGKADQLARIPQQGRADSLNLAIATAVMLFEAR
                     RHLLELAPVT"
     gene            332938..333426
                     /gene="lspA"
                     /locus_tag="Atu0342"
                     /old_locus_tag="AGR_C_596"
     CDS             332938..333426
                     /gene="lspA"
                     /locus_tag="Atu0342"
                     /old_locus_tag="AGR_C_596"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein signal peptidase"
                     /protein_id="AAK86158.1"
                     /translation="MAKAALFSKFAPAFTLIAAALVLDQIVKQLVEAYLPLQEMVPVA
                     PFLALYRTYNLGVAFSMLEDMHGWFIVSMRLVIVVFVLWLWRKTAADRTFAHLGFAFI
                     IAGAAGNLLDRFFYGHVIDYILFHTQTWSFAVFNLADSFITIGAACVILDEFLHARAA
                     KK"
     gene            333482..335722
                     /gene="barA"
                     /locus_tag="Atu0343"
                     /old_locus_tag="AGR_C_598"
     CDS             333482..335722
                     /gene="barA"
                     /locus_tag="Atu0343"
                     /old_locus_tag="AGR_C_598"
                     /codon_start=1
                     /transl_table=11
                     /product="two component sensor kinase/response regulator
                     hybrid"
                     /protein_id="AAK86160.2"
                     /translation="MSELARLRQKVSDGLGLATPAADPADKTTRLANEEHASDVRAVA
                     LYVAISLSVGAFAAALIALAVPYAVTVVLACFFGAVLMGALFYALFGKSFPLPGTLPA
                     DYSDVRLRQTQNRSLIAEMQESMGDIVVIRNMNRRIVEANRVFREMTGCTSPEGLSCE
                     EIGIAFRPGDRVHAYDVEIATPFGQRIFSWHDVVTRDLASSRLMISSIARDVTEERLA
                     LAEREDARLRAEKADAEKARLLATVSHEIRLPLSGMLGMNHLLSQTKLNQEQRNYLDG
                     MKQSGQSLVQLVEDLLDYSTMEAGRFRLNPRAENLRRLIESIVEMLAHRAHEKGIEIA
                     SFVTPDVPDYLDFDPARLRQVLFNLIGNAVKFTQVGGVVIRARMVDGELQITVEDTGP
                     GMSEAEQARIFGEFEQAGPLSQRSAGTGLGLAISARIVREFGGNLTVSSRRGEGSTFK
                     LVFRPGRAPAEMPDSGRSHCLQHTNVLLIAPEGVAAAVTMEAIEAFGGKCILIHQPED
                     LDRLRNEPVSRTADLTDIIVDLRISALFRDALRDWPQQTIRRTLLVSPEERASTTHAS
                     FDAWLIRPLREKSLIDVLCGRLRGIERRDAINDNHPDVGFSSRVVERASGVEILVAED
                     DAVNARIIRAVLEKSGYIVRAVDNFQALQQSVASGASRLPNLIVSDLNMPGGEGLDVL
                     PDLLGKLKDERNIPVIILSGDAGAGTAEILLKAGAGAVLAKPADPRRLVEEIRRLLEA
                     KRVLSS"
     gene            335817..336698
                     /locus_tag="Atu0344"
                     /old_locus_tag="AGR_C_599"
     CDS             335817..336698
                     /locus_tag="Atu0344"
                     /old_locus_tag="AGR_C_599"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86161.2"
                     /translation="MVAEIFNHDICENNVVISPRSETAQDNEGLFGRIGTLETRLARN
                     EREIDAAQSVRYRVFVEEMKARLPAEAMRRKRDFDAWDSVCDHLLVLDKSIEGDSEDQ
                     IVGTYRLLRQETALANNGFYSASEFDIAGLVARHPGKRFMELGRSCVLPEYRTKRTVE
                     LLWQGNWAYAVKHRMDAMIGCASFPGVQPEAHALALSFLHHNCLAKGEWEAVALPELY
                     HEMDLVPVEALNTRKALNAMPPLIKGYMRLGAMFGSGAVVDHAFNTTDVLVVLPVSSI
                     AGRYISYYGGEAERING"
     gene            336889..339540
                     /gene="mutS"
                     /locus_tag="Atu0345"
                     /old_locus_tag="AGR_C_602"
     CDS             336889..339540
                     /gene="mutS"
                     /locus_tag="Atu0345"
                     /old_locus_tag="AGR_C_602"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein, MutS family"
                     /protein_id="AAK86162.2"
                     /translation="MMEQYIEIKANNPGSLLFYRMGDFYELFFDDAVEASRALGITLT
                     KRGQHMGHDIPMCGVPVHAADDYLQKLILRGYRVAVCEQIEDPAEAKKRGSKSVVKRD
                     VVRLVTPGTLTEEKLLSPTESNYLMALARIRGSAEAQFALAWIDISTGVFRLAETTLT
                     RLLADIWRIDPRELIVADSLFHDEELRPVFDVLGRVAVPQPAILFDSAVAEGRIARYF
                     NVSTLDGFGTFSRVEMAAAAAAVAYVEKTQIAERPPLGAPERESAASTLFIDPATRAN
                     LELVKTLSGDRDGSLLHALNRTVTGGGARLLAERLMSPLTDPERINARLDAVAYLIDD
                     VSLCDGLRDALKHVADMPRALSRLALERGGPRDLGAIRQGLVSAEKIAVILDGGLLPD
                     ELAKALRDLKALPGALEAMLGSMLADDLPLLKRDGGFLREGANPELDEVRALRDQSRR
                     VIAGLQLQYADETGIKSLKIKHNNVLGYFIEVTAGNADVMMATDEAKARFIHRQTMAG
                     AMRFTTTELADLESRIANAAAEALTMELEAFERMVEAVVQQAEAIKAGALALAVIDVA
                     SSLAYLATEQAYCRPIVDASMTFSIKGGRHPVVEQALRRQSAGPFIANNCDLSAVNGG
                     KNGAIWLLTGPNMGGKSTFLRQNALIAILAQIGSFVPAEAAHIGVVDRLFSRVGASDD
                     LARGRSTFMVEMVETAAILNQATDRSLVILDEIGRGTATFDGLSIAWAAVEHLHEVNR
                     CRGLFATHFHELTVLSEKLGRLSNATMRVKEWEGDVIFLHEVGPGAADRSYGIQVARL
                     AGLPASVVERAREVLTKLEDADRKNPASQLIDDLPLFQIAVRREETRKAGPSKVEEAL
                     KSFNPDEMTPREALDALYALKKELGKA"
     gene            339637..342465
                     /gene="glnD"
                     /locus_tag="Atu0346"
                     /old_locus_tag="AGR_C_606"
     CDS             339637..342465
                     /gene="glnD"
                     /locus_tag="Atu0346"
                     /old_locus_tag="AGR_C_606"
                     /codon_start=1
                     /transl_table=11
                     /product="uridylyltransferase/uridylyl-removing enzyme
                     UTase"
                     /protein_id="AAK86163.2"
                     /translation="MAIKDLDFSDILDVSALKRDCDVIFKEDSKRIADIKSDLLPIFR
                     RASTEGREKARELLKADGSGIDCARRISWLQDRLIETLYDLACQHVYPKDAPQIAVAA
                     VGGYGRGTLAPGSDIDLLFLLPAKNTPDMHKAVEFVLYLLWDLGFKVGHATRTVDECI
                     RLSKSDMTIRTAILEVRAICGRKSLTDDLEKRFESEVVTGTGPEFIAAKLAERDQRHR
                     KAGDTRYLVEPNVKEGKGGLRDLHTLFWIAKYYYHVRDTADLVKLGVLSRSELKLFEK
                     ADDFLWAVRCQMHFITGKAEERLSFDIQREIADALNYQPRPGLSAVERFMKHYFLVAK
                     DVGDLTRIVCAALEDRQAKDVPGLSGVLSRFAHRVRKIPGSVEFVEDRGRIALARPDV
                     FKNDPVNLIRLFHIADINNLELHPDALRVVTRSLSLINDELRENEEANRLFLSILTSR
                     RDPALTLRRMNEAGVLGKFIPEFGKIVAMMQFNMYHHYTVDEHLIRSVGVLSEVDKGT
                     AVDAHPLANQLMPGVEEREALYVAVLLHDVAKGRQEDHSIAGARVARKLCQRFRLTGK
                     QTETVVWLIEQHLLMSMVAQTRDLHDRKTITDFADKVQSMERLKMLLILTVCDIRAVG
                     PGVWNGWKGQLLRSLYYETELLLSGGFSEVSRKERAQIARQALYDALEDWGQKARRKY
                     TKLHYEPYLLTVALEDQVRHTRFMREADKQEKALSTMVRTHSFHAITEITVLAPDHPR
                     LLSIITGACAAAGANIADAQIFTTSDGRALDTILINREFPIDEDETRRGANVGKLIEE
                     VLSGKQRLPEMIATRTKSRRKKSAFTIPPSVTISNGLSNKFTVIEVECLDRPGLLADM
                     TAVIADLSLDIHSARITTFGEKVIDTFYVTDLFGQKVTNDNRQASIAQRLKAVMSEQE
                     DELRDRMPNGIIAHPDVAALPAARTAKA"
     gene            342473..344062
                     /gene="mviN"
                     /locus_tag="Atu0347"
                     /old_locus_tag="AGR_C_608"
     CDS             342473..344062
                     /gene="mviN"
                     /locus_tag="Atu0347"
                     /old_locus_tag="AGR_C_608"
                     /codon_start=1
                     /transl_table=11
                     /product="virulence factor MviN"
                     /protein_id="AAK86164.2"
                     /translation="MSLIGKFATVGTATLGSRIFGFLRETLMAAAVGTGPVADAFNAA
                     FRFPNTFRRLFAEGAFNSAFVPLFAKEIEANGMEGARRFSEEVFGVLFTVLLALTILM
                     ELSMPFIVRTVIAPGFLEDPVKFDNTVRLATIMFPYLACMSLAAMMGGMLNSLHRYFA
                     AAIAPVFLNIILIGVLALAWWKNYDPLQVGYALSWGVMAAGLVQLAIVWIAVRNAGMR
                     IGLRRPRLTKNVQRLLVLALPAAITGGITQINLLINTNIASAGEGVISSLAYADRIYQ
                     LPLGVVGIAVATVLLPELARALRGGHMVEAGSLQNRSVEFVLFLTLPAAAALLVMAEP
                     IVRFLYERGNFSPSATITVAQILGIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAV
                     SVVVNVSLALTLFPRLGGPGIAIAEITAGWVNAALLFGMLLWRGHWHVDIPLLTRIPR
                     LLLAAALMAGFVHYALTWLSFELSSASSIFVRAGTIMGLVFTAMLVYFVLAFVSGGAD
                     IGMVKRAVRKRGKKTAETEVG"
     gene            344062..344466
                     /locus_tag="Atu0348"
                     /old_locus_tag="AGR_C_609"
     CDS             344062..344466
                     /locus_tag="Atu0348"
                     /old_locus_tag="AGR_C_609"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86165.1"
                     /translation="MSFSENRRIALVTLVVDNYDRAKAFYCDVLGFECLSDKPLDDGK
                     RWVVVKPQGAEGGALLLAEADGEQQRLAIGNQTGGRVGFFLHTDDFARDYETMIARGV
                     HFLEEPRHEVYGSVAVFADPYGNRWDLLQPRG"
     gene            344570..345634
                     /gene="trpS"
                     /locus_tag="Atu0349"
                     /old_locus_tag="AGR_C_611"
     CDS             344570..345634
                     /gene="trpS"
                     /locus_tag="Atu0349"
                     /old_locus_tag="AGR_C_611"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan-tRNA ligase"
                     /protein_id="AAK86166.2"
                     /translation="MNAFKPLVFSGVQPTGNLHLGNYLGAIRKFVALQEDNDCIYCVV
                     DMHAITAQLVHSDLKAQTRSIAAAFIAAGIDPVKHIVFNQSAVPQHAELAWVFNCVAR
                     IGWMERMTQFKDKSGKNAEQVSLGLLAYPSLMAADILVYRATHVPVGDDQKQHLELAR
                     DIAQKFNIDFGGHIRNAGLGVNITVGDEPVHAYFPMVEPLIGGPAPRVMSLKDGTKKM
                     SKSDPSDLSRINLMDDVDAISKKIKKAKTDPDALPSEVEGLKGRPEAENLVGIYAALS
                     DKTKADVLAEFGGQQFSTFKPALVELAVNVLAPVNNEMRRLLDDPTHIDAILSQGGER
                     ARTIAEKTMNEVRDIIGFLR"
     gene            345749..346240
                     /locus_tag="Atu8118"
                     /old_locus_tag="AGR_C_613"
     CDS             345749..346240
                     /locus_tag="Atu8118"
                     /old_locus_tag="AGR_C_613"
                     /codon_start=1
                     /transl_table=11
                     /product="putative universal stress protein"
                     /protein_id="AAK86167.1"
                     /translation="MVSTRLSRLEGHRRKFLAVIDDTPECERAVHYAGRRAKNSNGGL
                     VLLYMIPEGDFQQWLGVEQIMRAEAREEAEATLAKVAQKVRETIGIEPESVIREGSAT
                     EQIHGLIEEDRDIAILVLAAGSTKEGPGPLVSSIAGRGAAFPIPVTVLPDTLTDEEID
                     ALC"
     gene            346383..346946
                     /locus_tag="Atu0351"
                     /old_locus_tag="AGR_C_616"
     CDS             346383..346946
                     /locus_tag="Atu0351"
                     /old_locus_tag="AGR_C_616"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86168.1"
                     /translation="MFIQTEATPNPATLKFLPGKVVLESGTVEFLNASQAQASPLAER
                     LFTIPGVTGVYFGFDFITVTKDDAEWQHLKPAILGSIMEHFMSGRPIMGTAIAAEVSD
                     EEGEFFEEGDETIVATIKELLDTRVRPAVAQDGGDITFRGFRDGTVFLNMKGACSGCP
                     SSTATLKHGVQNLLRHFVPEVREVEAV"
     gene            346963..347631
                     /locus_tag="Atu0352"
                     /old_locus_tag="AGR_C_617"
     CDS             346963..347631
                     /locus_tag="Atu0352"
                     /old_locus_tag="AGR_C_617"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86169.1"
                     /translation="MIVLALDTSGVDCSACIYDNASDTVLGEVCETIGKGHAERLMAV
                     IDGALQQAQLPLQKVERIAVTIGPGSFTGIRVGVAAARGFALSLGVEAVGVTTLETLA
                     LHHLAENPGRPVAVGLDAKRGETYLQIFGTDGSPLNEAALLSLDDAKDALSGFDGAVI
                     GSAAPLFAGEETGSGPDHFPIAFVARAGARKSAGQPKPAPLYLRGPDARPQTGFALAR
                     QDVA"
     gene            347675..348169
                     /locus_tag="Atu0353"
                     /old_locus_tag="AGR_C_619"
     CDS             347675..348169
                     /locus_tag="Atu0353"
                     /old_locus_tag="AGR_C_619"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="AAK86170.1"
                     /translation="MFDDYLSWKPYFEIVPMQHEDCAAVADLHALRFPRPWNDGEFSG
                     LLTQGSVFGAVARQTNAFFSKPLGGFVLAREVAGEAEILTVAVSDKFSRAGLGWRLMQ
                     SAIREAMMRGAETMFLEVDNNNASALGLYKKLGFKTVAERKAYYTAKNGSKSTALVMR
                     RDLR"
     gene            348239..348667
                     /gene="fur"
                     /locus_tag="Atu0354"
                     /old_locus_tag="AGR_C_620"
     CDS             348239..348667
                     /gene="fur"
                     /locus_tag="Atu0354"
                     /old_locus_tag="AGR_C_620"
                     /codon_start=1
                     /transl_table=11
                     /product="ferric uptake regulator"
                     /protein_id="AAK86171.1"
                     /translation="MIDLSKTLEELCAERGMRMTDQRRVIARVLQESADHPDVEELYR
                     RSSAVDPRISISTVYRTVKLFEDAGIIERHDFRDGRSRYETVPEEHHDHLIDLKNSVV
                     IEFHSPEIEALQEKIAREHGFKLVDHRLELYGVPLKPEER"
     gene            348698..349492
                     /gene="plsC"
                     /locus_tag="Atu0355"
                     /old_locus_tag="AGR_C_621"
     CDS             348698..349492
                     /gene="plsC"
                     /locus_tag="Atu0355"
                     /old_locus_tag="AGR_C_621"
                     /codon_start=1
                     /transl_table=11
                     /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
                     /protein_id="AAK86172.1"
                     /translation="MMWLRTAYIAIVLLIVTLILLPLQLLGLAFDWRLRRRIPRIWHR
                     IACHVLGIRVHVHGEVERAKPLMLAVNHASWKDILVLGSIADVVFIAKTEVRDWPVFG
                     WLARLQKSIFVQREQKRSTGQQVGEIASRMADGEIVVLFPEGTTSDGNRMLAVKSSLF
                     GAASTAAEQVPGKLVYVQPVAIAYTRVQGMAMGRYHRIIAAWPGSITLVPHLLGVIKA
                     GAIDVDVTFGDSVPFHSADNRKRLATDIAAAIRSMLAFSLRGGWRK"
     gene            349679..351046
                     /gene="miaB"
                     /locus_tag="Atu0356"
                     /old_locus_tag="AGR_C_623"
     CDS             349679..351046
                     /gene="miaB"
                     /locus_tag="Atu0356"
                     /old_locus_tag="AGR_C_623"
                     /codon_start=1
                     /transl_table=11
                     /product="miaB protein"
                     /protein_id="AAK86173.2"
                     /translation="MIAREGSNSRKVFIKTYGCQMNVYDSVRMSDALAKDGYVQTEDM
                     GEADLVLLNTCHIREKAAEKVYSALGRLRDMKKSREEQGREFMIGVAGCVAQAEGEEI
                     LRRAPAVDVVIGPQTYHRLPDALKRVRRGERVIETEYAVEDKFEHLPVAEKATLRSRG
                     VTAFLTVQEGCDKFCTFCVVPYTRGSEVSRPVRQIVDEAMKLVDAGVREITLLGQNVN
                     AWQGEGPKGEKWGLAELLYRLAEIPGLARLRYTTSHPRDMDDRLIGAHRDLRILMPYL
                     HLPVQSGSDRILKAMNRRHTGEEYIQLIEKIRSARPDIAMSGDFIVGFPGETDRDFED
                     TMAMVETVKYAQAFSFKYSTRPGTPGADLTDQVAEDVKAERLERLQALLLRQQKEFAE
                     SLVGKTMDVLLEKPGRMPEQLIGRSPWLQSVNLDAKTLKIGDIVNVRITATGPNSLFA
                     EVAGS"
     gene            351087..352142
                     /gene="phoH"
                     /locus_tag="Atu0357"
                     /old_locus_tag="AGR_C_625"
     CDS             351087..352142
                     /gene="phoH"
                     /locus_tag="Atu0357"
                     /old_locus_tag="AGR_C_625"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate starvation inducible protein"
                     /protein_id="AAK86174.2"
                     /translation="MNAHELVSNPSRQPRQAATDANHFVLTFENNRIAGELFGQFDQN
                     LKLLEQRLNIDARPRGNSVAITGDVVATNQARRALDFLYERLLKGGTAEASDVEGAIR
                     MAMAADDQLTLPTMERKAKISMAQISTRKKTIAARTPTQDVYMRALEQSELVFGVGPA
                     GTGKTYLAVAHAAQLLERGAVDRIILSRPAVEAGERLGFLPGDMKEKVDPYLRPLYDA
                     LYDMMPGDKVERAIQAGVIEIAPLAFMRGRTLANAAVILDEAQNTTTMQMKMFLTRLG
                     ENGRMIVTGDPSQVDLPRGVKSGLVEALQILPEVEGVSVVRFKDVDVVRHPMVARIVR
                     AYESHTAVPDESLPKGN"
     gene            352153..352659
                     /locus_tag="Atu0358"
                     /old_locus_tag="AGR_C_626"
     CDS             352153..352659
                     /locus_tag="Atu0358"
                     /old_locus_tag="AGR_C_626"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86175.2"
                     /translation="MAALDIQISVEAEGWSSEENLAAFATKVLNAAVDFLKREEEQPF
                     PKMPVELSLVFTDDENIREINAEWRDKDKATNVLSFPAFPLEPGGMPGPMLGDIVIAR
                     ETVEREALELDKSFEDHLTHLLVHGFLHLFGYDHMDEEEAEEMESLETRILAVLGLSD
                     PYAGQEPL"
     gene            352675..353817
                     /locus_tag="Atu0359"
                     /old_locus_tag="AGR_C_627"
     CDS             352675..353817
                     /locus_tag="Atu0359"
                     /old_locus_tag="AGR_C_627"
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin"
                     /protein_id="AAK86176.2"
                     /translation="MNEHSARPANEGRENGEQSSSEEGSSHLRNDSHAKPRSTIWSRI
                     GRLLKPSQGERLREDLTDALMADTEIGAAFSPEERAMLNNILRFREVRVEDIMIPRVD
                     IDGLDQNMTIGEALILFEETGRSRMPVYDETLDNPKGMIHIRDLLAYVAKQARNKRRA
                     GSRSVAYGEVKATTRSPRPNFDLARVDLEQTVADAGLVRKILFAPPSMLASDLLKTMQ
                     AQRTQLALVIDEYGGTDGLVSHEDIVEMVVGDIDDEHDKDEAMFSRLSADVLVADARA
                     ELTELAEVIGPEFDVREHLEEIDTLGGLIFFALGRIPAKGEVVRAVPGFEFQILDADS
                     RRIKGVRIVRDHGSEGQDDQAPGEADGVIALPAPDVRLITHQQNAD"
     gene            354024..355613
                     /gene="lnt"
                     /locus_tag="Atu0360"
                     /old_locus_tag="AGR_C_629"
     CDS             354024..355613
                     /gene="lnt"
                     /locus_tag="Atu0360"
                     /old_locus_tag="AGR_C_629"
                     /codon_start=1
                     /transl_table=11
                     /product="apolipoprotein N-acyltransferase"
                     /protein_id="AAK86177.1"
                     /translation="MERLAGRVMLAGGMSRAVMAIAAGAVGALALPPFGFFAALFFSF
                     TLLVWLVDGCTGKPGGGLFSRILPAFGIGWCFGFGYFVAGLWWLGNALLLEADEFAWA
                     LPLAILGLPALLALFYGFAVAAANLLWSDGLGRIAALAAAFGVSEWLRSFLATGFPWN
                     AIGYGIMPIPIMMQSAHLLGLLSITTLAVFIFASPALIGTKKGMGPGLALAGLLLAAH
                     FGYGFYRLQTPAETPADALTVRIVQPAIDQSRKMLNTDRAEIFAEHLRLSALPPGEGK
                     KRPDIIVWPETSVPFILTQNPDALAEIASTLEDGQVLFTGAVRMEDQGAGRPPRYYNS
                     VYAIDSQGEIIGATDKVHLTPFGEYVPFEGILREFGIDNVIALPGGFSAASSRTPLTL
                     PSGKTFYPLICYEIIFPGEMTPGLQGAAAILNVTNDGWFGDTPGPYQHFLQARVRAVE
                     TGVPVIRGANTGISAVIDPYGRIIAGLDYGRVGILDATLSGGSNDAFTYDTHRTYFWL
                     IFSILMIVAVFPALSFARRQN"
     gene            355747..356166
                     /locus_tag="Atu0361"
                     /old_locus_tag="AGR_C_630"
     CDS             355747..356166
                     /locus_tag="Atu0361"
                     /old_locus_tag="AGR_C_630"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="AAK86178.2"
                     /translation="MTENKKKPNPIDIHVGSRIRLRRTMLGMSQEKLGESLGITFQQI
                     QKYEKGTNRVGASRLQNISGILNVPVSFFFEDAPGDQVGGTSGMAEASSSNYVVDFLS
                     SAEGLQLNRAFVKIADPKVRRRLVDLVKALAAEGDAE"
     gene            356353..357615
                     /gene="metK"
                     /locus_tag="Atu0362"
                     /old_locus_tag="AGR_C_632"
     CDS             356353..357615
                     /gene="metK"
                     /locus_tag="Atu0362"
                     /old_locus_tag="AGR_C_632"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine synthetase"
                     /protein_id="AAK86179.1"
                     /translation="MRANYLFTSESVAEGHPDKVCDRISDEIVDLIYREAAKTGVDPW
                     TVRIACETLATTNRVVIAGEVRVPDTLLKKDKDGKVVKDAAGHPVINPSKFKSAARKA
                     IRDIGYEQDGFHWKTAKIDVLLHPQSADIAQGVDNASDKQGDEGAGDQGIMFGYACKE
                     TPDLMPAPIYYSHRILQLLATARKSGEGEAAKLGPDAKSQVTVRYVDGKASEAVSIVL
                     STQHLDASWDSKKVREVVEPYIREALGELKIADDCQWYINPTGKFVIGGPDGDAGLTG
                     RKIIVDTYGGAAPHGGGAFSGKDTTKVDRSAAYAARYLAKNVVAAGLAERCTIQIAYA
                     IGVAQPLSIYVDLHGTGKVSEDQVEAAIRKVMDLSPSGIRRHLDLNKPIYAKTSSYGH
                     FGRKAGRDGSFSWEKLDLVKPLKEALSA"
     gene            357787..358485
                     /locus_tag="Atu0363"
                     /old_locus_tag="AGR_C_634"
     CDS             357787..358485
                     /locus_tag="Atu0363"
                     /old_locus_tag="AGR_C_634"
                     /codon_start=1
                     /transl_table=11
                     /product="putative tRNA (guanine-N(7)-)-methyltransferase"
                     /protein_id="AAK86180.1"
                     /translation="MTEERRSRATEAFFGRRKGKPLRNQQVDTIENLLPLLKIDLESV
                     PPQNLVALFPADVRSIRLEIGFGGGEHLAHRAVENPETGFIGVEPFVNSMAKLLATVR
                     ERELMNIRLYDDDATQLLDWLPEGSIDHIDLLYPDPWPKKKHWKRRFVSDVNLARFHR
                     VLKPGGKFCFASDIDTYVNWTLQHCARHGGFEWTATSADDWRTPYANWPGTRYENKAK
                     REGRSSAYLTFIRR"
     gene            complement(358549..359448)
                     /gene="rbsK"
                     /locus_tag="Atu0364"
                     /old_locus_tag="AGR_C_637"
     CDS             complement(358549..359448)
                     /gene="rbsK"
                     /locus_tag="Atu0364"
                     /old_locus_tag="AGR_C_637"
                     /codon_start=1
                     /transl_table=11
                     /product="ribokinase"
                     /protein_id="AAK86181.1"
                     /translation="MITVFGSINMDLVATAKRLPKPGETVTGDTFSTAAGGKGANQAL
                     AARRAGVTVKMAGATGDDTFAAPALTLLRDAGTDLSLVKTAPGPTGTAVILIGEGGEN
                     MISVIPAANGEVSAFDATKVVGEMDAGDILMLQFEIPAAAIEAALTAAKAKRITTVIN
                     TAPLTADGPRLAGLADIVIANETEFELLIGKNGLSSGERESELKALHDRTGQTLIVTL
                     GADGVIAMRNGKVFSASGLKIEPVDTVGAGDTFCGYLAASLDQGMDFEKALKRAAVAG
                     SLACTRAGAQPSIPQAAEVDAAL"
     gene            complement(359503..360735)
                     /locus_tag="Atu0365"
                     /old_locus_tag="AGR_C_639"
     CDS             complement(359503..360735)
                     /locus_tag="Atu0365"
                     /old_locus_tag="AGR_C_639"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86182.1"
                     /translation="MIFRITGNLLDLIMNIDFSVLLNPALRAGSVDISFGALLVALVL
                     GLTITWLVTTNRTRKAGADSEISDLLKTQSELHGRIAAMAETLGTRQTEMSQTLNQRL
                     DGMSQRLGETLTEQTRSTHENLSRLQERLAVIDAAQGNIQDLAKDVVGLQAILSNKQT
                     RGAFGQARMETLIADALPAGAFQLQPTLSNGYRPDCIIKMPNNAPALVIDAKFPLEAW
                     NAIKADETPETKRAAVQQFRRDMEVHIRDVAEKYLIRGETQDTAFIFVPSESIFADIH
                     QHFEYLVQRAHRARVVIVSPSLLMLSVQVIQSVLKDQRMREQAHLIQGEVALLMDDVR
                     RLDDRTRKLQAHFGLAQKDVDMMLISSDKVLARGQKIEGLDFSPTEKEASHGEIEQTR
                     RFAENRAGAAKLRVVDDE"
     gene            360846..361358
                     /gene="def"
                     /locus_tag="Atu0366"
                     /old_locus_tag="AGR_C_640"
     CDS             360846..361358
                     /gene="def"
                     /locus_tag="Atu0366"
                     /old_locus_tag="AGR_C_640"
                     /codon_start=1
                     /transl_table=11
                     /product="polypeptide deformylase"
                     /protein_id="AAK86183.1"
                     /translation="MTIKPLIILPDPVLRQQSKLIEQVDAEVLRLADDMLETMYDAPG
                     IGLAAIQIGVPRRMLVIDVAREGEEKTPVVFINPEILKVSDDISTYEEGCLSIPDYYA
                     EVERPASLTVQYVGRDGKQQTVEADGLLATCLQHEIDHLNGVLFIDHISRLKRDMVIK
                     KFTKAARAKI"
     gene            361403..362338
                     /gene="fmt"
                     /locus_tag="Atu0367"
                     /old_locus_tag="AGR_C_642"
     CDS             361403..362338
                     /gene="fmt"
                     /locus_tag="Atu0367"
                     /old_locus_tag="AGR_C_642"
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA formyl transferase"
                     /protein_id="AAK86184.1"
                     /translation="MSLRIIFMGTPDFSVPTLRALVEAGHEIVAVYTQPPRPGGRRGL
                     DLQKSPVHQVAELLGLPVLTPVNFKAEEDRQQFRDFNADVAVVVAYGLLLPEAILSGT
                     RLGCYNGHASLLPRWRGAAPIQRAIMAGDAETGMMVMKMEKGLDTGPVALTAKVAIDE
                     NMTAGELHDSLMLAGARLMRQAMAKLEADDLPLVTQAEEGVLYAAKIDKGETRIDFSR
                     PAQDVHNHIRGLSPFPGAWLEMDIGGKPERVKVLASELASGMGEAGSALDDALTIACG
                     SDAVRLTRLQKAGGKPMSAADFVRGTPVPATTRLG"
     gene            362338..363138
                     /gene="truA"
                     /locus_tag="Atu0368"
                     /old_locus_tag="AGR_C_644"
     CDS             362338..363138
                     /gene="truA"
                     /locus_tag="Atu0368"
                     /old_locus_tag="AGR_C_644"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase I"
                     /protein_id="AAK86185.1"
                     /translation="MPRFRMTVEYDGTPYYGWQRQENGPSVQGALEAAVRSLTGESVS
                     IRGAGRTDSGVHAVGQVAHIDLSRDWEPYKLRNALNAHLAMAGEAVAVLDAAAVTEDF
                     DARFSALRRHYLYRIICRKSRLALEHKRAWWVSKDLDHERMHEAAQMLVGRHDFTTFR
                     SVHCQANSPVRTLDRLDVTRNGDLIEIRATAQSFLHNQIRSFAGTLKLAGEGGMTPDD
                     VRAALEARDRKACGPVAPPDGLYFMQVDYPDVIPPRRRPEIEMTEDAD"
     gene            complement(363158..363754)
                     /locus_tag="Atu0369"
                     /old_locus_tag="AGR_C_646"
     CDS             complement(363158..363754)
                     /locus_tag="Atu0369"
                     /old_locus_tag="AGR_C_646"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86186.1"
                     /translation="MPTASEVRLYLTGLWLLLLGDHNGARYLDLSERGMWRSFYSALW
                     CLPAMLVSWLWLRAAFLASVPPGAETGFLFFFRLAMVEAICWIVPLLLIGMLLYAFGA
                     REKFAPLVTTVNWLSLPFSYAYAVLILIAFFLPPLQGLIAILWLALLLSLVFAFSRIV
                     RFFIRDQSLLVSAVVMTLLVPAMLLSEALQRFLGVYPA"
     gene            complement(363738..364934)
                     /gene="dapE"
                     /locus_tag="Atu0370"
                     /old_locus_tag="AGR_C_647"
     CDS             complement(363738..364934)
                     /gene="dapE"
                     /locus_tag="Atu0370"
                     /old_locus_tag="AGR_C_647"
                     /codon_start=1
                     /transl_table=11
                     /product="succinyl-diaminopimelate desuccinylase"
                     /protein_id="AAK86187.1"
                     /translation="MTTTDPVANLAALIRCPSVTPAEGGALSLLDTLLSPLGFAVERV
                     MATEDGTPDVENLYARLGTEGPHLMFAGHTDVVPVGDEAAWSHPPFSADIAGGEMYGR
                     GAVDMKGGIACFVAAIARHIGKHGKPQGSVSFLITGDEEGPSINGTSKLLEWAAAKGE
                     TWDACVVGEPTNPDQLGDMIKIGRRGSLSGRITVQGVQGHAAYPHLADNPIRGLLQLT
                     HALMHPAFDHGTDDFQPSNLEVTTVDTGNAATNVIPARATAAFNIRFNDSWTAESLRA
                     EIIRRLDAAANEGELRPDRAPVKYEIVWADRPSHVFLTRNNALISSLSGAIETVTGKE
                     PKLSTTGGTSDARFIKDYCPVVEFGLVGQTMHMVDERVAVADLETLTRIYETFIERWF
                     AHADGK"
     gene            complement(364949..365803)
                     /gene="dapD"
                     /locus_tag="Atu0371"
                     /old_locus_tag="AGR_C_648"
     CDS             complement(364949..365803)
                     /gene="dapD"
                     /locus_tag="Atu0371"
                     /old_locus_tag="AGR_C_648"
                     /codon_start=1
                     /transl_table=11
                     /product="2,3,4,5-tetrahydropyridine-2-carboxylate
                     N-succinyltransferase"
                     /protein_id="AAK86188.2"
                     /translation="MSLTDLTSLETIIETAFDNRDGVNVSTKGEVRDAVNTSLQLLDS
                     GKVRVAEKQADGNWKVNQWLKKAVLLSFRLNDMEIVTGGPGESTWWDKVPSKFENWGE
                     NQFRAAGFRAVPNAVVRRSAYVAKNVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIG
                     KNVHLSGGVGIGGVLEPLQAGPTIIEDNCFIGARSEVVEGCIVREGAVLGMGVFIGKS
                     TKIVDRATGEITYGEVPPYSVVVAGTMPGKPFPNGEPGPSLYCAVIVKRVDEKTRSKT
                     GINELLRD"
     gene            365886..366806
                     /locus_tag="Atu0372"
                     /old_locus_tag="AGR_C_649"
     CDS             365886..366806
                     /locus_tag="Atu0372"
                     /old_locus_tag="AGR_C_649"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86189.1"
                     /translation="MLERRQCDLGDLARQTKGMEMTRLKNGKLRRKDGAWDPLKRSAV
                     DKQQAEVVVKTPQSDSPSYRLAYVDTDFLCREELRPIRLQLELLKTEMALTERGINST
                     VVMFGGARIPEPGGDAWAARNETQKRNLEQSSIYYEEARKFARLCTDYGAKSGHLEYV
                     VVTGGGPGVMEAGNRGAADVGGPSIGLNIVLPHEQAPNPYVTPELSFNFHYFAIRKMH
                     FLMRAKAVVVFPGGFGTLDELFEALTLIQTKRMAPIPLILFGENFWRSVVNFEFLANF
                     GTIAPEDMDLLHFAETADDAWKIISEYYEH"
     gene            366973..369300
                     /locus_tag="Atu0373"
                     /old_locus_tag="AGR_C_652"
     CDS             366973..369300
                     /locus_tag="Atu0373"
                     /old_locus_tag="AGR_C_652"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="AAK86190.2"
                     /translation="MFNFKVKSLATKLILVTGCAITTVLIASNSFLISQTSERVHALT
                     MDQANTEARAIANVIAADVGELGSAARSMAGVIGRAHQAKSMDRPGIVNILKANVEQN
                     TFAFGSWFCEQLGLFDGQSTEIANRLDLGTNKSGAFAPYWSKTQKGDIQFSTFDNDYA
                     AEWYALASKSGKGAITQPYLAQGTEVPTTMTSLAYPVMSDGKMIGVAGVDISLASLTQ
                     KLQALHPFETGRVTLVSQGGQWLVPPTPEQNMKAYDGEGASTVQAAITSGKQGLIENL
                     GLDTDAPYNRLVYPFAVPGLNATWVVLVDIPHQALNAPVQEQTFMMIIGAIVILAAVI
                     AALYFAVRYFVRNPLASLVADVRTLSEGRYDVPVSGQERQDETGAVASALEGFRAKLA
                     GIREMEAEAAAQRGHAETERQRSEFERSENSRMQQHIVGVLGAGLNALSQGNLTYRIE
                     DEFPGEYAKLRADFNSALESLEETVSTVNATVVSIGNGTGEITRAASDLSHRTEQQAA
                     SLEETAAALNELTAQVNSSAENAAEAAGAVSHACDDAGKSGEVVQQAVNSMQGIAQSS
                     AEISRIIGVIDEIAFQTNLLALNAGVEAARAGDAGKGFAVVAQEVRELAQRSATAAKE
                     IKGLINTSATQVGEGVQLVGKAGETMKKIADQVLQINQLIRQISASASEQAVGLKEIN
                     SAVTQMDQVTQQNAAMVEETTAASVTLNSEAETLKSLVAGFAVSGGHASQQLRATAAT
                     MRAPAAPARAQAAAPRARPRTSGANALAQDDWTEF"
     gene            complement(369370..370314)
                     /gene="iunH"
                     /locus_tag="Atu0374"
                     /old_locus_tag="AGR_C_654"
     CDS             complement(369370..370314)
                     /gene="iunH"
                     /locus_tag="Atu0374"
                     /old_locus_tag="AGR_C_654"
                     /codon_start=1
                     /transl_table=11
                     /product="inosine-uridine preferring nucleoside hydrolase"
                     /protein_id="AAK86191.2"
                     /translation="MAERRKIIIDTDPGQDDAAAIMLAFGSPEEIDILGLCAVAGNVP
                     LKLTSRNIRIICELCGRTDIPVYEGAEKPLVRKPITAEHVHGSTGLNGPVLDEPTMEA
                     QKQHAVDFIIETLMREPAGTVTLCTLGALTNVALALLKAPEIADRVKELVMMGGGFFE
                     GGNITPAAEFNIYVDPQAADIVFRSGMPVVMMPLDVTHKLLTTKARVNRIRDIGTRPA
                     IAMAEMLEFFERFDIEKYGSDGGPLHDPSVIAYLLKPELFEGRECNVEIEVISELTMG
                     MTVVDWWRVTDRPANARVMRNVDADGFFELLTERFARL"
     gene            370520..370945
                     /gene="hspC"
                     /locus_tag="Atu0375"
                     /old_locus_tag="AGR_C_657"
     CDS             370520..370945
                     /gene="hspC"
                     /locus_tag="Atu0375"
                     /old_locus_tag="AGR_C_657"
                     /codon_start=1
                     /transl_table=11
                     /product="small heat shock protein"
                     /protein_id="AAK86192.1"
                     /translation="MSRMTPFTHPLLLGFDAMEKTLERMAKANDGYPPYNIERLPGGE
                     DVPERLRITIAVAGFSQDDLDVTTADNQLVIRGRQQEQEKRDFLYRGIAARQFQRVFV
                     LADGMQVREARLRNGLLSIDLVRPEISNVVKKINISVSE"
     gene            371002..371259
                     /locus_tag="Atu0376"
                     /old_locus_tag="AGR_C_659"
     CDS             371002..371259
                     /locus_tag="Atu0376"
                     /old_locus_tag="AGR_C_659"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86193.1"
                     /translation="MLLKEAHARLTQSQLAHIGEGEVGYIRKIRAEEVSRCFPEAPDL
                     DPQLDLWALFGADGTPILLTDNRSSTFFKAAEDDLKTVSLH"
     gene            complement(371302..371898)
                     /locus_tag="Atu0377"
                     /old_locus_tag="AGR_C_660"
     CDS             complement(371302..371898)
                     /locus_tag="Atu0377"
                     /old_locus_tag="AGR_C_660"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86194.2"
                     /translation="MTMTTRKIALSALGAALVLSTAATASFAAPGKGHKDRMPIRPEA
                     AFVHLLKVADTNKDGKISKEEFTARQDALFTEIDMDKDGSITPKEMREYRKAKMEAFR
                     AANPRPEREDAKADEAKGPEGKRAERDHGGRSGHQGWGRHGGKGGGLGMIRWADTDEN
                     GQVSKAEFTAAGEKMFERLDRNKDGVISIDDMPDRPFL"
     gene            complement(372000..372713)
                     /locus_tag="Atu0378"
                     /old_locus_tag="AGR_C_662"
     CDS             complement(372000..372713)
                     /locus_tag="Atu0378"
                     /old_locus_tag="AGR_C_662"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="AAK86195.2"
                     /translation="MDTKPKNLPDAADFAHVSEWVFDLDNTLYPHHVNLFSQIDRNMT
                     AYVAELLKLDPEEARVLQKRYYHDHGTTLQGLMINYGISPDEFLERAHAIDYSALKPH
                     PELGEAIKALPGRKFILTNGSVKHAQAAAGALGILDHFEDIFDIVAANYLPKPASATY
                     EKFAALAKLDTKKAAMFEDLPRNLAAPKALGMKTVLLVPSNLEGVIMERWEIPDVTDE
                     HIDYITDDLTGFLAKTIAR"
     gene            372820..373737
                     /locus_tag="Atu0379"
                     /old_locus_tag="AGR_C_664"
     CDS             372820..373737
                     /locus_tag="Atu0379"
                     /old_locus_tag="AGR_C_664"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86196.1"
                     /translation="MELWIGITFASAFLQNLRSTLQKHLKGMMGTTGATFVRFVFGMP
                     FALAYLAFLHLGLGRPLPVPNMSFAGWATVGAMAQIAATFLLVHLFSFRNFAVGTAYS
                     RTEPAQAALFALIFIGESITGGTLAAIAISVAGVMLISVARTQVTPASFLTSIFSRTA
                     GIGLASGAFFGLSSVAYRSASLALAPSLPAPDAMMQAGFTLVVVIVMQTVSMFLWIIW
                     REREELPRIAKVWKPSLAVGFVGATASFGWFTAMTLQQAAVVKALAQVEMLFAFASTV
                     LFFKEKINRLELSGCMLIVVGVLSLLAFG"
     gene            complement(373783..374667)
                     /gene="argB"
                     /locus_tag="Atu0380"
                     /old_locus_tag="AGR_C_666"
     CDS             complement(373783..374667)
                     /gene="argB"
                     /locus_tag="Atu0380"
                     /old_locus_tag="AGR_C_666"
                     /codon_start=1
                     /transl_table=11
                     /product="acetylglutamate kinase"
                     /protein_id="AAK86197.1"
                     /translation="MTSSESEIQARLLAQALPFMQKYENKTIVVKYGGHAMGDSTLGK
                     AFAEDIALLKQSGINPIVVHGGGPQIGAMLSKMGIESKFEGGLRVTDAKTVEIVEMVL
                     AGSINKEIVALINQTGEWAIGLCGKDGNMVFAEKAKKTVIDPDSNIERVLDLGFVGEV
                     VEVDRTLLDLLAKSEMIPVIAPVAPGRDGATYNINADTFAGAIAGALHATRLLFLTDV
                     PGVLDKNKELIKELTVSEARALIKDGTISGGMIPKVETCIDAIKAGVQGVVILNGKTP
                     HSVLLEIFTEGAGTLIVP"
     gene            complement(374715..374855)
                     /locus_tag="Atu0381"
     CDS             complement(374715..374855)
                     /locus_tag="Atu0381"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAL41403.1"
                     /translation="MGRHNKARRLFHSSKAEIRLSLQTRRHVESMHPAPQKSIPIFAP
                     ML"
     gene            375023..375400
                     /locus_tag="Atu0382"
                     /old_locus_tag="AGR_C_669"
     CDS             375023..375400
                     /locus_tag="Atu0382"
                     /old_locus_tag="AGR_C_669"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86198.1"
                     /translation="MTAPDRDKQSGLRDEVLAGEYVLGALPPESMAELTKRVKRDRQF
                     AAMVRRWRENLAETEYREKATMAVLLERDPARPGLPFRSQPLRGGSVFAAMFSEVWNS
                     VRFWRLLALTAMLWTAVLLFTIA"
     gene            complement(375413..376066)
                     /gene="cgpA"
                     /locus_tag="Atu0383"
                     /old_locus_tag="AGR_C_672"
     CDS             complement(375413..376066)
                     /gene="cgpA"
                     /locus_tag="Atu0383"
                     /old_locus_tag="AGR_C_672"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="AAK86199.1"
                     /translation="MSETGTATEKPLFGRPWIFIRGVPAMKFLPPEGPPEIAFAGRSN
                     VGKSSLINALVGHKGLARTSNTPGRTQELNYFVPEGYSGEPGDLPPMALVDMPGYGYA
                     QAPKDHVDAWTKLVFDYLRGRATLKRVYVLIDSRHGIKKNDEEVLSLLDKAAVSYQVV
                     LTKTDKIKDVGVPRLIGETLEKIRKRPAAYPEVLATSSEKSFGLDDLRAEIVRTVLL"
     gene            complement(376063..377862)
                     /gene="yidC"
                     /locus_tag="Atu0384"
                     /old_locus_tag="AGR_C_674"
     CDS             complement(376063..377862)
                     /gene="yidC"
                     /locus_tag="Atu0384"
                     /old_locus_tag="AGR_C_674"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase 60 kD membrane subunit"
                     /protein_id="AAK86200.2"
                     /translation="MEKNRNYFIAIALSVVIVLAWQFLYMNPRIEQQRRAEEARQAQQ
                     QTTQQQPAPGAAPGATVEGAPPASSTQAAATATREEAIARTQRVAIDTNAIAGSINLT
                     GARFDDIRLKGYHETVDDSSPIITLFSPADTKDGYFTELGYVAAQEVGGVPGPTTVWT
                     LASGDKLTETTPVTLTYTNSKGVVFSRTVSIDEHYMLSIADKVENPGQAAISFATYGR
                     VTRNNKPVIPPVFVIHEGFLGVSGKDGSLTEKKYKDVEEEPVTVAKATGGWLGITDKY
                     WAAAIVPPQTTPFETRYSHITGNQPSYQADFKSDSMTVEAGQSIELKSLVFAGAKEVP
                     LVDRYETEYSVPKFDLLIDWGWFYFITKPMFKMMDFFFRYFGNFGVAILLTTIVVKAL
                     FFPLASKQYASMANMKRMQPKMEELKAKHGDDRMAMQQAMMQLYKEEKINPVAGCWPM
                     LLQIPVFFALYKVIYVTIEMRHAPFFGWIHDLSAPDPTSLFNLFGLLPYDVPHFLMIG
                     VWPLVMGITMFLQMRMNPTPPDPTQAMIFTWMPLIFTFMLASFPAGLVIYWAWNNTLS
                     ISQQALIMKRHGAKIELFDNIKGLFKRKPVQSK"
     gene            complement(377862..378245)
                     /gene="rnpA"
                     /locus_tag="Atu0385"
                     /old_locus_tag="AGR_C_677"
     CDS             complement(377862..378245)
                     /gene="rnpA"
                     /locus_tag="Atu0385"
                     /old_locus_tag="AGR_C_677"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease P protein component"
                     /protein_id="AAK86201.2"
                     /translation="MSETKKQPGRLKNRSEFLAVQAGEKRRGSTFLVEVLDRRAPETE
                     PRVGFTVTKRQGNAVERNRMRRRLKEAVRLSAGVAMKPGHDYVIVARRDVLDTAFPKL
                     QSLLIERIEGTAKPKRSQETRSRKE"
     gene            complement(378282..378419)
                     /gene="rpmH"
                     /locus_tag="Atu8066"
     CDS             complement(378282..378419)
                     /gene="rpmH"
                     /locus_tag="Atu8066"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L34"
                     /protein_id="ABW89718.1"
                     /translation="MSKRTFQPSKLVRKRRHGFRARMATAGGRKVLAARRARGRARLS
                     A"
     gene            complement(378461..378733)
                     /locus_tag="Atu0386"
     CDS             complement(378461..378733)
                     /locus_tag="Atu0386"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAL41408.1"
                     /translation="MGRWHNFSRHKIYQCRVKKEFRILSVTHGNACARPAEEANLMRF
                     SAKGEVLKPLRQLTLLGLCPYKPRTLGHRKLAQAGLAVQKTKRCCK"
     gene            378771..380819
                     /gene="mcpA"
                     /locus_tag="Atu0387"
                     /old_locus_tag="AGR_C_678"
     CDS             378771..380819
                     /gene="mcpA"
                     /locus_tag="Atu0387"
                     /old_locus_tag="AGR_C_678"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="AAK86202.2"
                     /translation="MRIRGRINLLVGLMSLVACTIGGLSIYAVSEFRVRTVEYEKAAE
                     RAYKGEALNRLVTAVVMEARGVYAAADIEKAAPFADGIVKNLDAMEKLIATWTPLVPA
                     EQKATFDNLSSRFKEFKTFRLETARLAREAGPQAANQQGNNEANRANRKAYQAEIDAV
                     VKNDIAELEAVKAGIDGFVTTTFWLVITVTGSGILAGAAFGLYIGARQLSAPIRRVSE
                     VMNAVADGNLDADVPYLGQNDEIGEMAAAVEVFKKNGREVRRMNAQETAMRAKSDDLQ
                     AGMAVVVDAAAGGDFSRRINKDYGDDNLNRFATTINALLIGVDNGVSETSRVIEGLAR
                     GDLTEKMDGDFRGVFAELKENVNQTLTKLRETMREVRGSTEGISGNANELRSAADDLS
                     KRTEQQAAALEETSAALDEITAVVRNSTDRAQEASAMVAETKQKTEESASVVRDAVSA
                     MDRIEHASREISQIINVIDEIAFQTNLLALNAGVEAARAGEAGKGFAVVAQEVRELAQ
                     RSATAAKDIKALITKSGEEVGRGVSLVQRTGSALSEIETRVLAINEHIHSIATAAREQ
                     STGLHEVNTAINQMDEVTQRNAAMVEETSAATHKLSSEADHLVTLVTRFNVGTETAQR
                     SHRIEQSLRPMTASTGPVAVSGRTAAVSSPARKLMNSVSRALNAQPAAAPAHGDWQEF
                     "
     gene            381014..382489
                     /locus_tag="Atu0388"
                     /old_locus_tag="AGR_C_680"
     CDS             381014..382489
                     /locus_tag="Atu0388"
                     /old_locus_tag="AGR_C_680"
                     /codon_start=1
                     /transl_table=11
                     /product="two component sensor kinase"
                     /protein_id="AAK86203.1"
                     /translation="MFSKGVDSLDRTQDDPVHCMPGLTAGLSGRLLLLTVIFVMIAEV
                     LIFVPSVANMRLSWLRDRLNTAAAAGAVIDGLQAELPRSVQNDTLMATGAKLIALRKD
                     GTSRLLAVAETPPGVDEQYDLSDVSQAAAVRDAFSTLLFGGNRVIRVFDVVGDSDTII
                     ELVLGENKLRAAMLAYARNVFLISIVLSLVTAGLIFISINRIMIRPIRRLTLGMQNFS
                     EDPGNPERIFVPEEGTDELSVAGRHLADMQTELQKTLRQQKNLVDLGLAVSKINHDMR
                     NILSSAQLMSDRLVDAKDPMVRSFAPKLLRTIDRAVAYTGEVLAYGQATEGAPKRKIV
                     PLSLLVRDVRDILALDPDSGIEFHDSVPPDLTVDADSEQLFRVIHNLCRNAVQALQSD
                     VANSAPRHLSISAQRAGSVVSIVIDDNGPGMPRKAKENLFSAFRGSARSGGTGLGLVI
                     ARELVLAHGGTIALVEKPGPGTQFRIEIADRAASIQAARTA"
     gene            382568..382669
                     /locus_tag="Atu8009"
                     /old_locus_tag="AGR_C_681"
     CDS             382568..382669
                     /locus_tag="Atu8009"
                     /old_locus_tag="AGR_C_681"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK86204.1"
                     /translation="MDGIYNIINVIRELLRKNDNFETKSLAFGMRTF"
     gene            382707..382783
                     /locus_tag="Atu0389"
     tRNA            382707..382783
                     /locus_tag="Atu0389"
                     /product="tRNA-Arg"
     gene            382964..383776
                     /gene="ubiE"
                     /locus_tag="Atu0390"
                     /old_locus_tag="AGR_C_683"
     CDS             382964..383776
                     /gene="ubiE"
                     /locus_tag="Atu0390"
                     /old_locus_tag="AGR_C_683"
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinone/menaquinone biosynthesis
                     methyltransferase"
                     /protein_id="AAK86205.2"
                     /translation="MLEADKVFAGSIPENYDRYMVPLIFAPFAADLARRAAALMPIDV
                     LEIAAGTGAVTREMIPRLLPAAHYVVTDLNQPMLDFAAAQQAPDNRIKWRQADAQLLP
                     FENAVFDLVFCQFGAMFFNDRLSAYREAKRVLKPGGHYLFNVWDRIEENHFADDVTNA
                     LAGLFPDDPPRFMARTPHGYHDTVLIRRELENAGFSRVTVETVAAQSRAPSPRIPAVA
                     YCQGTVLRTEIEARAPGKLNAATDCAAAAIEARHGKGEVAAKIKAHVILAAV"
     gene            384108..385139
                     /locus_tag="Atu0391"
                     /old_locus_tag="AGR_C_685"
     CDS             384108..385139
                     /locus_tag="Atu0391"
                     /old_locus_tag="AGR_C_685"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, nucleotide binding/ATPase
                     protein"
                     /protein_id="AAK86206.2"
                     /translation="MSGCGKSTLLRIIAGLESPDRGSVSIGGQDVTEIDPSDRNLAMV
                     FQSYALYPHMSVRQNIATPLRMRRLPFAARLPLIGRFAAPAETLKQIDAAVEQAAETL
                     QIAHLLDRKPAQLSGGQRQRVALARALVRSPAAFLMDEPLSNLDAKLRAHMREELAGL
                     HRRLGATFIYVTHDQIEAMTMSDRIALMSEGRIEQLGTPDELYRKPATLTVARFIGTP
                     SINLLPVEIDAQGRITAFGRDLGIEGAGRDAGPATLGLRAEDLRPGEEGFTVRVVRSE
                     THGADRFVSCRLLSDETVSMTLRQGADEVLGADADGMMNLGFAPERAHLFAADGLRRK
                     VTVRERVPA"
     gene            385136..386062
                     /locus_tag="Atu0392"
                     /old_locus_tag="AGR_C_686"
     CDS             385136..386062
                     /locus_tag="Atu0392"
                     /old_locus_tag="AGR_C_686"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, membrane spanning protein"
                     /protein_id="AAK86207.1"
                     /translation="MTVVDISTPLRAKSRLRPPKADRRMMWRGLMFAAPAGLLLLAIY
                     IVPMFVLAGFSVTDYRLGALSTRFIGLGNFVKAFQDPVFLRALANTALYAIIVIPFGV
                     FLALGVALLVYNRKRSRTFWEVAYFLPVTATLVAMATVWQFLLHPSLGPVNAAIKWLG
                     FEPVAFLSNPVLLIPTMALMGIWQVLGFNMVLFLAGLTAISKDLHEAARLDGAKNPVD
                     RFLTVTWPMLGPTTMFVVVTTSISAFKVFETVAVLTKGRSGSETLLFDLYLEGFEYSN
                     TGYAAALTIIFLVIVLILSIGQTLHMDRKVHY"
     gene            386062..386883
                     /locus_tag="Atu0393"
                     /old_locus_tag="AGR_C_688"
     CDS             386062..386883
                     /locus_tag="Atu0393"
                     /old_locus_tag="AGR_C_688"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, membrane spanning protein"
                     /protein_id="AAK86208.1"
                     /translation="MAVFRKYFPHLVLALGAFVMLLPFYWMALTSIRSPAEIFDVSLW
                     PIPQKFDAADNYARAAGQVPMARFMLNGVIVCVGILVVQILTSVPAAYALAKLRFPGR
                     KLLLGLVIAALCVPIQALALPLFVGLAKTQLLNTYFAMMMPFFLSVFAIFLFNQSFRS
                     YPDEIIEAARMDGFSEMEICWGLVLRGSLPSLAAFSIFSLVAHWNDLYWPMIVISDTN
                     LAPPPLGMMLFADVESGANYGALMAGATLITAPMVLCFLLARRHFIAGITMTGVK"
     gene            386926..388218
                     /locus_tag="Atu0394"
                     /old_locus_tag="AGR_C_689"
     CDS             386926..388218
                     /locus_tag="Atu0394"
                     /old_locus_tag="AGR_C_689"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, substrate binding protein
                     (sugar)"
                     /protein_id="AAK86209.1"
                     /translation="MKLNRRAVMGGLALGMAFAGLAQPVLANEITLNVLYNLPGFTKF
                     HQPLADEFMKKNPDVKINFLAPAAGYNEGQQQVLRSAVTGNLPDVYFSGYNLTAELVH
                     TLAPRNQITDLGPFIQAEGGQAFLDKNYSPKMAALGQIDGKQYGLPVNASSPIIYINS
                     DLVTKAGGDPDKMPTTFPELIALAKKIKALDPKFAGMSYDINGWPDDWLWQALVVEQG
                     GKLVDDKTKTVAFDNEIGLNALKMTRQFVTEGGQNLLDWDQSRQQFGAGLTGFIFSTP
                     AHVQTIQGLVGDRFKLKTATFPLDNKEKGGVPTGGNSAVILTQEKAKQDAAWKYLKWI
                     TGPEAQNTIVRITGYLPTNKLATGPDFLAPYYVENPNVKTASLQADRSLPWAGYPGGD
                     SVRIWRTQRDIIGTVMRGEVTPEAGLKQIVEQTNALLK"
     gene            388283..389083
                     /locus_tag="Atu0395"
                     /old_locus_tag="AGR_C_691"
     CDS             388283..389083
                     /locus_tag="Atu0395"
                     /old_locus_tag="AGR_C_691"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86210.2"
                     /translation="MKIIQITDTHLLPPGIAINGVDPENQLRAAVADIVEKHADADLL
                     VMTGDLCNYGEPEAYELLRDILAPVSIPTRLMLGNHDRRPEFVAAFPEQPRDDNGYIQ
                     SFIDTEFGRLLFLDSHEADVIGGIYGADRLTWLENALESAGDLPITVFVHHPPMDCGI
                     RHFEHIGMHDDGAIMRRLAAHPAGIRHIVFGHIHVPMAGTTAEGIAYSSGQACAHRFI
                     TDIDVVDPLWTGGNPCYRVISLGAFGLRAYDAEVGQPVLGQTPVCEGP"
     gene            389381..390877
                     /locus_tag="Atu0396"
                     /old_locus_tag="AGR_C_695"
     CDS             389381..390877
                     /locus_tag="Atu0396"
                     /old_locus_tag="AGR_C_695"
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme A transferase"
                     /protein_id="AAK86211.2"
                     /translation="MLEKRIRNASLLNRIVSAEEAASLIQDGMTVGMSGFTRAGEAKA
                     VPLALAERAKTNPMKITLMTGASLGNDLDKTMVEAGMLARRMPFQSDPALRKAINDGR
                     VMFIDQHLSETVEQLRGGQIHGVDIAIVEAVAITAEGGIVPTTSVGNSASFAILADKV
                     IVEINLSQPEVLEGLHDIFIPAKRPTRMPIPVVATDSRVGLPFIPVPPEKIAAIVLSD
                     KSDSFSTVLPPDDETKAIAGHLTEFLLNEVRHGRMTHELQPLQAGIGTIANAVMHGFI
                     DTPFHDLKMYSEVLQDSTFELFDAGKLTFASGSSITLSSAMNEQVMPRLSEYKSRLIL
                     RPQEVSNHPEVIRRLGIIGINTALEFDIYGNVNSTHVGGTHMMNGIGGSGDFARNAYM
                     SIFVTKSIAKGGAISSVVPMVSHVDHTEHDVDILVTETGLADLRGLAPRERAAVIIAN
                     CVHPSYRDALTDYYQRAAARGGHTPHLIEEALSWHNALRERGTMLPQR"
     gene            391047..392369
                     /locus_tag="Atu0397"
                     /old_locus_tag="AGR_C_699"
     CDS             391047..392369
                     /locus_tag="Atu0397"
                     /old_locus_tag="AGR_C_699"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86212.2"
                     /translation="MPIRFVAVIAIVALLAGCGGRPIGVMTPTGQTVAGTTPVNLLVA
                     TTRAPSENAAVLFGGERGTGLKVDAVTISIPPKANRKVGQVQWPKKLPPNPLKDFTTV
                     AVEPIRSEAETKSWISKHIKKDRRVLVFVHGFNNRYEESVYRFAQIVYDSGSDVVPVV
                     FTWPSRASIFDYNYDKESTNYSRDALEEMLTRLARDKSIGEVTVMAHSMGTWLAVEAL
                     RQMAIRNGRVDPKIGNVILAAPDLDVDVFSRQFTSLGKTPPKFTLFVSQDDRALSLSR
                     RISGNVDRLGQIDPSVEPYRSQLEKAGITVLDLTKLQSGDRLNHGKFAESPEVVRLIG
                     DRLIAGQTVTDSDVGLGEALGAVSIGAAQTVGTAASVVVSAPIAVFDPRTRENYGRQV
                     ERLGRSVENTVGSVGDTAGSVVDDQALQSSRVNCDAVANRNRVECRSR"
     gene            392498..393535
                     /locus_tag="Atu0398"
                     /old_locus_tag="AGR_C_701"
     CDS             392498..393535
                     /locus_tag="Atu0398"
                     /old_locus_tag="AGR_C_701"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86213.1"
                     /translation="MRWKRTLQLLDVHCEGEIGRVVTGGAPKIPGNTVAEQLHWMNTD
                     PQGEALRRFLTLEPRGTPMGSVDLLLPPKHPDAHAAFVILQPDQAHASSGSNSICATT
                     ALLESGMVEMQEPETVIILETAAGLVKATATCRDGRCEKVKLTMVPSFVHELDVSIDT
                     PEWGRVTMDISYGGIFYALVDVRQIGLTIEKANAAKLVAAGMTLKDLVNREMTVVHPE
                     IPAISGVAYVMFRDVDADGSIRTCTTMWPGRADRSPCGTGNSANLATLYARGKVKVGD
                     EYKSRSIIGSEFDVGLSAVTEVAGRPAVIPTIAGRGFTFGLHQVGLDPFDPLGDGFAM
                     TDVWGPEAGNI"
     gene            393648..394685
                     /gene="pyrC"
                     /locus_tag="Atu0399"
                     /old_locus_tag="AGR_C_703"
     CDS             393648..394685
                     /gene="pyrC"
                     /locus_tag="Atu0399"
                     /old_locus_tag="AGR_C_703"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotase"
                     /protein_id="AAK86214.2"
                     /translation="MKSLTLRRPDDWHLHLRDGAMLEGVIGDTSRHFARAIIMPNLVP
                     PVVTTADASAYRERILKAIPEGDRFEPLMTLYLTEDTVADDVEEGKKSGLITAVKLYP
                     AGATTNSHGGVRDFNKAMPVLERMAKIGLPLCVHGEVTTPDVDIFDREKAFIDTVLEP
                     LRQRLPELKVTMEHITTRDGVDYIKSSNANLAGSITTHHLIINRNAILVGGIKPHYYC
                     LPVAKREEHRLALRAAATSGDARFFLGTDSAPHVDPLKECACGCAGIYTSINTMSCLA
                     HVFEDENALDKLEAFASLNGPAWYGLAPNDETITLVKREEAVAFPEKIETGAGPVTVF
                     DPMFPLHWDVN"
     gene            394837..395535
                     /gene="pyrE"
                     /locus_tag="Atu0400"
                     /old_locus_tag="AGR_C_704"
     CDS             394837..395535
                     /gene="pyrE"
                     /locus_tag="Atu0400"
                     /old_locus_tag="AGR_C_704"
                     /codon_start=1
                     /transl_table=11
                     /product="orotate phosphoribosyltransferase"
                     /protein_id="AAK86215.2"
                     /translation="MNHFTFTDRTVVAELVAKMLWEIKAVHFNSESPYTFASGMKSPV
                     YIDMRKLISFPRIRSAAMDFAAAAVMREAGFEKFDCVAGGETAGIPFAAFLAERLGLP
                     MIYCRKKPKGHGRNAQIEGHMPDGARVLVIEDLTTAGGSMFTFIDAIRAAGGIVDHGI
                     ALFYYGIFEEAEARFANGNVKLHYLTTWRDVLAVARAEKLFDEKTLSGVEAFLDNPLP
                     WSAKHGGVSELPQS"
     gene            395635..396561
                     /gene="scrK"
                     /locus_tag="Atu0401"
                     /old_locus_tag="AGR_C_706"
     CDS             395635..396561
                     /gene="scrK"
                     /locus_tag="Atu0401"
                     /old_locus_tag="AGR_C_706"
                     /codon_start=1
                     /transl_table=11
                     /product="fructokinase"
                     /protein_id="AAK86216.2"
                     /translation="MILCCGEALIDMLPRQTTLGEAGFAPYAGGAVFNTAIALGRLGV
                     PSAFFTGLSDDMMGDILRETLRASKVDFSYCATLSRPTTIAFVKLVDGHATYAFYDEN
                     TAGRMITEAELPALGADCEALHFGAISLIPEPCGSTYEALMTREHETRVISLDPNIRP
                     GFIQNKQSHMARIRRMAAMSDIVKFSDEDLAWFGLEGDEDTLARHWLHHGAKLVVVTR
                     GAKGAVGYSANLKVEVASERVEVVDTVGAGDTFDAGILASLKMQGLLTKAQVASLSEE
                     QIRKALALGAKAAAVTVSRAGANPPFAHEIGL"
     gene            396686..397651
                     /locus_tag="Atu0402"
                     /old_locus_tag="AGR_C_708"
     CDS             396686..397651
                     /locus_tag="Atu0402"
                     /old_locus_tag="AGR_C_708"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86217.2"
                     /translation="MSIPKTHPFDFDPTYGMQREQLLAITPPEAPPGFDDFWKKRYRR
                     ALATDPRPVLRRSKLTHPRWQVLDVTYTSTDGFRIGGWLLLPREGQVRRGLVVGHGYG
                     GRGEPDFDLPVEETAVLFPCFRGLSLSACPPISSDPTLHVLYNIDRKDDYIIGGCVDD
                     LWVAVSTLVSLYPWLEGQVGYSGISFGGGIGALAIPFDARIDRGHLVVPTFGHRPFWL
                     TLPTVGSADAVQTYQKTHAKVLETLRLFDAACAAARIKVPMLVAPALFDPAVAPPCQF
                     AVANAVPQSKFNEIFILDAGHFEYPDSASQDAVHKDKIRRFLKVP"
     gene            397648..398376
                     /locus_tag="Atu0403"
                     /old_locus_tag="AGR_C_710"
     CDS             397648..398376
                     /locus_tag="Atu0403"
                     /old_locus_tag="AGR_C_710"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86218.1"
                     /translation="MKREYLRWYSHRLHRDMELLIFGHAGAKVLMFPTRDGRFFEYEE
                     LGIVASLSDKLEAGHLQLYCIEGLARESFYAGHHHPADRVRRHAALEAYILNEVLPLM
                     AEKNPDGSTIVQGCSLGAFQAASLVFRHPHLFTKLVAFSGRYDLTMRVESFGDLFDGY
                     YDDDVYFHMPSHFLPGLACPFRLEQLRRIDMVFTIGDADPFLDNNQHLSRLLSDKQVG
                     HQMHVWEGRAHRAGAWRKMAALYI"
     gene            complement(398432..400057)
                     /gene="pgi"
                     /locus_tag="Atu0404"
                     /old_locus_tag="AGR_C_711"
     CDS             complement(398432..400057)
                     /gene="pgi"
                     /locus_tag="Atu0404"
                     /old_locus_tag="AGR_C_711"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate isomerase"
                     /protein_id="AAK86219.1"
                     /translation="MQATIEKLKATASSTAATDLRAAFAADDQRFSRFSVKFDDLLMD
                     YSKCAVNEEIVTLLEQLAREGGVEAKREEMFSGKAINFTEDRAVLHTALRNRSNTPVL
                     VDDKDVMPDVNGVLAAMGKFADAIRSGSLKGATGKKITDVVNIGIGGSDLGPVMATLA
                     LAPFHDGPRAHFVSNIDGAHIADTLKLLDPETSLFIIASKTFTTIETMTNAATARRFI
                     AEKLGEGAVKHHFAAVSTALDKVAAFGIESDRIFGFWDWVGGRYSIWSAIGLPLMIAI
                     GPDNFGKFLDGAHAMDRHFREAPIRENLPMLLGLIGFYNRNVLDYPTRAILPYDQRLS
                     RFPAYLQQLDMESNGKGVTIDGTPVEGQSGPVVWGEPGTNGQHAFYQLIHQGTSVIPA
                     EFMIAANGFEPELRHQHQLLIANCLAQSEALMKGRTLAEAKAQLTSKGMEDSQADFIA
                     PHRVFTGNRPSITFVYDKLTPFALGRLIALYEHRVFVEGVLFRINSFDQWGVELGKEL
                     ATGLLPVVEGKESAAGHDSSTQGLVKALAGLAG"
     gene            complement(400188..401900)
                     /gene="fadD"
                     /locus_tag="Atu0405"
                     /old_locus_tag="AGR_C_713"
     CDS             complement(400188..401900)
                     /gene="fadD"
                     /locus_tag="Atu0405"
                     /old_locus_tag="AGR_C_713"
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain-fatty-acid-CoA-ligase"
                     /protein_id="AAK86220.1"
                     /translation="MSELSLGHPENVSVAKRWLASYPPGVPSEIPASANASLIDLLEK
                     SCKQFADRKAFSSMGKSLTYRELDADTRAVAAWLQSRGLEKGDRVAVMMPNILQNPVA
                     VYGILRAGMVVVNVNPLYTPRELEHQLKDSGAKALFVLENFAHVAQQAVPKTAVRHVV
                     VAAMGDLLGLKGHIVNLVVRKVKKLVPAHAIPGSISFKAMLKEGQGVSLKPVGLTAQD
                     IAFLQYTGGTTGVSKGAVLTHANLLANKAQISLWLDAAFNGRKDRPEVLNFICALPLY
                     HIFALTVNSLMGIALGGHNLLIANPRDIPGFVKELSHYQPHIFPGLTTLFNALMNNEE
                     FRKLDLSSLIFVLGGGMAVQRPVAERWVSVVGCPITEGYGLSETSPVATVNRLDAAEF
                     SGTIGLPISSTEIDIRDEDGNSLPTGEVGEICIRGPQVMAGYWQRPDETAKAITADGF
                     FRSGDMGFMDERGYTKIVDRKKDMILVSGFNVYPNEVEEVAASHPGVLECAAIGVPDE
                     HSGETVKLFVVKKDQSLTEAELKAFCAKNLTNYKRPKIIEFRTDLPKSNVGKILRREL
                     RNLN"
     gene            402258..403307
                     /gene="fbpA1"
                     /locus_tag="Atu0406"
                     /old_locus_tag="AGR_C_714"
     CDS             402258..403307
                     /gene="fbpA1"
                     /locus_tag="Atu0406"
                     /old_locus_tag="AGR_C_714"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, nucleotide binding/ATPase
                     protein"
                     /protein_id="AAK86221.2"
                     /translation="MAGSAALELKSVGKRFGDTDVLSDIDLSVERGEIICLVGRSGCG
                     KSTLLRIVAGVETPDRGSVSLNGNVVAGPAAFVEPEKRNIGFVFQDYALFPHLTVEQN
                     VMFGLRALPKAEARRRAAEMIEHVHLQDLAKRYPHTLSGGEQQRVALARALAPQPGLL
                     LMDEPFSNLDRGLRDNVREETLGLLRQLGTTAIMVTHDPEEALSAGDRVVLMQRGRIV
                     QSGTGYEIHDNPKSRYAADFFCAFNKIEGRVKQGRVETPLGLLGDASDLPDGLAAIAY
                     VRPNAISIIEDGAAREGIAGEISSRVFLGEIEQLGIAVPGLPSDLRVRTMQRTPARTK
                     AVRFGIDPKGVLIFT"
     gene            403461..404477
                     /gene="fbpA"
                     /locus_tag="Atu0407"
                     /old_locus_tag="AGR_C_715"
     CDS             403461..404477
                     /gene="fbpA"
                     /locus_tag="Atu0407"
                     /old_locus_tag="AGR_C_715"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, substrate binding protein
                     (iron)"
                     /protein_id="AAK86222.2"
                     /translation="MTKFTRFALLASTVAFAAGTVSAAELNIYTTREPGLIQPLLESF
                     TASSGVKVNTVFLKDGLAERVLSEGASSPADVLMTVDAGNLVDLAEKGVTQAVESETL
                     TKAVPAELRDAKGHWFALSMRARVLYAAKDLDLASFNYEDLADAKWKGKVCIRAGQHP
                     YNTALFADYIAHYGAADTEKWLAGVKENLARKAGGGDRDVAKDILGGICDIGIANSYY
                     VGLMRSGKGGEEQVKWGDAIKVVLPTFKNGGTQVNISGAAVAKNAPNKAEAVKLLEYL
                     VSDEAQKIYAEANYEYPVKQGAALNEIVASFGTLKIDNKPLTEIVSHRKQASELVDKV
                     GFDK"
     gene            404550..406226
                     /gene="fbpA3"
                     /locus_tag="Atu0408"
                     /old_locus_tag="AGR_C_717"
     CDS             404550..406226
                     /gene="fbpA3"
                     /locus_tag="Atu0408"
                     /old_locus_tag="AGR_C_717"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, membrane spanning protein"
                     /protein_id="AAK86223.1"
                     /translation="MNPDTIQPLPPRTRARFSSTFWWLGLSLLAVCGAMVPVLALVSQ
                     AVQGSEGLWDHLGATVLWTALPDTAILLAGVGLLAGVVGTSAAWLVTAYDFPGRRVLE
                     WALLLPLAMPTYIVAYAYLDILHPIGPVQGAIRWLLGYSSPREFRLPDIRSTVGCIVL
                     LGFVLFPYVYIPVRAMFLTQAGNLLEVARTLGVSRRAAFFKVAVPLARPAIAVGVSLA
                     LMEALNDIGASEFLGVRTLTVSVYTTWVTKSDLPGAAQIALSMLFIVVALVALERWAR
                     RKQRYSVSAQKSRELEPLRLTGPRGWAAFTLGSLPVLIGFVGPASYLVIEAWKRFRFS
                     GLSVRFADEAVNTIVFAGLATLITLILGLAVAYAMRLAPGRLSLWSYRLSTVGYAAPG
                     TVIAIGVLIALGGFDRFVDQTMRDWFGISTGLIFIGSGAALIYAYSARFLTIAAGGVD
                     AGLSRIPHSFDHASRTLGRSATQTFRQIHLPLSKASLAAAALLIFVDCVKELPATLLL
                     RPLNFETFATHLYGEAARGTYEEASIAALAIVVIGMLPVVLLARIGRRKG"
     gene            406406..408595
                     /locus_tag="Atu0409"
                     /old_locus_tag="AGR_C_718"
     CDS             406406..408595
                     /locus_tag="Atu0409"
                     /old_locus_tag="AGR_C_718"
                     /codon_start=1
                     /transl_table=11
                     /product="ferrichrome iron receptor"
                     /protein_id="AAK86224.2"
                     /translation="MKNLHGMFLSRLALGTAAVVLMGPVMGHAQETTVLKQITVEGQG
                     AENATGPVRGYVAKKSATGSKTETETKAIPQSVSVVGRQEMDDRGAVTKIDEVLRYTP
                     GVTAEPFGTDPDTDWFYIRGFQATQTGVFLDGLNLFSYGFGGFQMDAYGLERVEVLKG
                     PASVLYGGANPGGIVQMVSKRAQDTPVRETEIGINNFGNAFFGFDLGDKVDAEGVWKY
                     RVTGKVSGGDNYTDYSEDLRGFIMPQITFEPDAQTSATLYGYFSALDQVHVGNGFLPY
                     VGTVVDAPFGKLDRKAFYGEPDIDNGRVYQSMVGYDVSHEFDNGWKISQNARYGHLYK
                     HETGPYPGGWANADANGQPILDPITNDYMLTRFGYDGLSKVDSFGVDNRIEGQFDTGA
                     VNHSPLFGLDYKYYRLDQVQACCGSNAIGALKPVYGSTQGTNFVYADNIVTQQQIGIY
                     AQDQLRFGDGWLVTLNGRYDYVDTELNNRLPAGVSRRSNDDALSGRAGLAYEFDNGLT
                     PYVSAATFFNPLIDTLADGTPASPEEGHQFEAGIKYEPSFFDGSITASVFKLVKDNAI
                     VSYTAGGVTTSGQFGQVESTGFELEAKANLDENWKALASYSYTDLDITKDANPNLIGK
                     SPWIVPAHTASLWVDYAFTDETFEGLSIGGGVRYQGKSWADAANTLRVSDAAVFDAAI
                     RYEKNDWTASVNVANVFDKEYVKSCAGVSVCGWGDSRTITLKLSKKW"
     gene            408723..409586
                     /locus_tag="Atu0410"
                     /old_locus_tag="AGR_C_720"
     CDS             408723..409586
                     /locus_tag="Atu0410"
                     /old_locus_tag="AGR_C_720"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, AraC family"
                     /protein_id="AAK86225.2"
                     /translation="MENEIEGFAVIGGPRSRVWNGIVADLWDVRCAPKAGGRYVGKDP
                     RFVFLLDMEGTDDGRFMMNRCRRDTCGSSRANRISFVPADIDVHAELSNVSFVRHLDL
                     HFDAGLLGARLVQGFDPHALLDPHLMFEDERLLALARLIAAECDNPDPLHDLYGESLV
                     LALLTDFLKVKREPVRKRSKLAAWQLRAATDYIREHCLRSIRLEELAELTNLSQSHFS
                     HAFKASTGVPPHQWQMQARIDRVKELMMRPDMALTDIAIAAGFSDQAHFSRVFRKMVG
                     VSPSVWQKNRQ"
     gene            409701..410108
                     /locus_tag="Atu8119"
                     /old_locus_tag="AGR_C_723"
     CDS             409701..410108
                     /locus_tag="Atu8119"
                     /old_locus_tag="AGR_C_723"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86226.2"
                     /translation="MEETIMLHQEPRAGQDPYVKDTPSLIASDKVEGTRVYGADGKHI
                     GSIQRIILEKRGGRVAYAVLSFGGFLGIGDDYYPLPWEKLHYDEELDGYRIDLTKEQI
                     ENAPHFTNLDDDDLLYAKDRKVYDYYGVAPYWM"
     gene            complement(410201..410443)
                     /locus_tag="Atu8120"
                     /old_locus_tag="AGR_C_724"
     CDS             complement(410201..410443)
                     /locus_tag="Atu8120"
                     /old_locus_tag="AGR_C_724"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK86227.2"
                     /translation="MKNERWTEPVEVNLEAKGKSVVAGPFEALTLLTEGWPRTGGLSF
                     VKARSACRAALDGRKSPEEARKCFTDAVSEMQKNPH"
     gene            complement(410761..410919)
                     /locus_tag="Atu0413"
                     /old_locus_tag="AGR_C_727"
     CDS             complement(410761..410919)
                     /locus_tag="Atu0413"
                     /old_locus_tag="AGR_C_727"
                     /codon_start=1
                     /transl_table=11
                     /product="stress induced protein"
                     /protein_id="AAK86229.2"
                     /translation="MDVIRILIAIILPPVGVFLQVGLGLQFWLNILLTLCGYVPGIIH
                     AIWVILRR"
     gene            complement(411076..411151)
                     /locus_tag="Atu0414"
     tRNA            complement(411076..411151)
                     /locus_tag="Atu0414"
                     /product="tRNA-Thr"
     gene            complement(411286..412248)
                     /locus_tag="Atu0415"
                     /old_locus_tag="AGR_C_729"
     CDS             complement(411286..412248)
                     /locus_tag="Atu0415"
                     /old_locus_tag="AGR_C_729"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86230.2"
                     /translation="MLPSVLKDNLRLPVIASPLFIISHPQLTLAQCKAGVIGAFPALN
                     ARPESQLDEWLAMITEELAAYNRANPERPAAPFAVNQIVHMSNRRLEHDLGLCVKYKV
                     PVVISSLGAVPEVNAAVHSYGGIVLHDVINDRHARSAIRKGADGLIAVAAGAGGHAGT
                     LSPFALIQEIREWFDGPLLLAGAIANGGSILAAQAMGADMAYIGSPFIATEEARASDG
                     YKQALVDAQAKDIVYSNYFTGVHGNYLKSSIVASGMDPDNLPEADPSKMDFETATGGA
                     KAWKDIWGAGQGIGAIKAVEPVAALVDRLAAEYEAAKGRICAKA"
     gene            412452..413651
                     /locus_tag="Atu8121"
                     /old_locus_tag="AGR_C_731"
     CDS             412452..413651
                     /locus_tag="Atu8121"
                     /old_locus_tag="AGR_C_731"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86231.2"
                     /translation="MAQRRIFLHSAIEQGSVVSGLETAIRNALEKSDRSNAEVRARIY
                     QSSRQALEAGLRKQGIDDPQVVAQQRQRLESLIHLIENEERNRLLDRVEQQLRPPASE
                     SPVEHDHGVDPVSQPAHHDHMAVEPELRGETRDVRPGAAAIAPETSSAGQRNGKPSKR
                     SSSAADASLAFRPEGAVGRRKRRGLFARLFIYVTLLAFIGFGAWWVYSSGLLLSPEQR
                     DTSVPNPPAQVQAEDFNGTEPAPSLSAGRGFSDDWVEVFNAERGSSGVSAGPRANVEN
                     VATPAGKVIRVTSKSVAQDGAVSVEVPVEVMRDMAGKSSTISITLQSSSDRQTQVSVS
                     CDFATLGDCSRHRFTATAERADMLLNTTFERSLAPNAPGKIFINSDIDGSGRPINLYS
                     VRILPGQ"
     gene            complement(413701..414582)
                     /locus_tag="Atu0418"
                     /old_locus_tag="AGR_C_733"
     CDS             complement(413701..414582)
                     /locus_tag="Atu0418"
                     /old_locus_tag="AGR_C_733"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86232.1"
                     /translation="MGEEKKKRTVEITIGGKLRSFDIDDPVLPDWVEEKKLSAGNFPY
                     DKKMKREDYDATLEALQVELVKVQFWLQATGKRVMAVFEGRDAAGKGGAIFATHAYLN
                     PRYARVVALTKPTETERGQWYFQRYISHFPTAGEFVLFDRSWYNRAGVEPVMGFCTPD
                     EHKRFLKETPRLEKMLVHDDIHLFKFWLDIGRETQIERFHDRRQSPLKCWKLSDMDIA
                     ALTKWDDYTQKRDEMLEKTHTDAAPWTVVRANDKRRARVNLIRHILLALDYEGKDRQA
                     IGEIDDKILGSGPDFLK"
     gene            414781..416082
                     /locus_tag="Atu0419"
                     /old_locus_tag="AGR_C_736"
     CDS             414781..416082
                     /locus_tag="Atu0419"
                     /old_locus_tag="AGR_C_736"
                     /codon_start=1
                     /transl_table=11
                     /product="two component sensor kinase"
                     /protein_id="AAK86233.1"
                     /translation="MLSDESGEQAEMAVREGESGLRLLGKKLGRNWLPVLIVSMLAVV
                     AVTELHTPYMPAALWLCAIIAILAVREKPAAPEKDKETAADVDEPDVPGENVISGVRA
                     GLAVLDTPVFILDKNASVLFQNGAAERAFGQLPAGAHISARLRSPGLLDVIRETITTG
                     QPNQVEHSERFPSERVFIVRIARADVGEGASPPFYILSFRDVSELRRIDRMRSDFVAN
                     ASHELRTPLASLRGFIETMQGPARNDPKAQERFLAIMLDQATRMSRLVDDLMSLSRLE
                     LRANIAPDQKVDLVPVIGHVRDALLPLADELDVTITLHLPDRPAEVQGDRDELVQVFQ
                     NLVENACKYGQEGKVVDVWLRAEPGKPVEVSIIDKGPGIPAEHVPRLTERFYRVSVAD
                     SRSKKGTGLGLAIVKHILTRHRARLIIKSEMGSGTDFTVRF"
     gene            416278..417312
                     /locus_tag="Atu0420"
                     /old_locus_tag="AGR_C_738"
     CDS             416278..417312
                     /locus_tag="Atu0420"
                     /old_locus_tag="AGR_C_738"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, substrate binding protein
                     (phosphate)"
                     /protein_id="AAK86234.1"
                     /translation="MNFVKFSAAALVASVAFAGAAAARDQIQVAGSSTVLPYAKIVAE
                     TFAETFPNFKAPVVESGGTGGGLKAFCSGVGEGTIDIANASRPIKSDELAACKAAGVA
                     DVQEVKIGYDGIVFAMDSSNKDIKLEPKDLYLALAAEIVKDGKLVANPYKKWSEINKE
                     LPDVAIAAYIPGSKHGTREVFEEKIMADGCKEAKATDAIKALITDAKQAAAKCVAVRK
                     DGAAVDIDGDYTETLARIDANKTGLGVFGLAFYENNADRLKVATVSGVVPSTETVASG
                     KYPVSRPLFFYVKKAHLGVIPGLKEYVEFFVSDEMIGPDSPLANYGLVAAPDKEREEI
                     RSKFAAGASM"
     gene            417601..419085
                     /gene="pstC"
                     /locus_tag="Atu0421"
                     /old_locus_tag="AGR_C_740"
     CDS             417601..419085
                     /gene="pstC"
                     /locus_tag="Atu0421"
                     /old_locus_tag="AGR_C_740"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, membrane spanning protein"
                     /protein_id="AAK86235.2"
                     /translation="MNTSILLLILALIGIGSYLLGRRRAVVLSGGRPSSMHSRAGYHG
                     SYAVVWAVLPAAFILCAWLVISPLLVTSAVRGDFPEDVRAQSEAQQSLTYGMVTSIAR
                     GLQRLAPEETAQVEADTAAVRPLLASKGVAIAGEPQRFMVDAAQTLNAMTSTSRLGMI
                     ATVLLVAFAGAAYALRSIAPRFRARNRVERVILAALVVASSIAILTTIGIVLSMLTEA
                     IQFFTMVPAHQFFFGTVWDPRFAAAGATDSSGQFGLIPLLAGTLYIGFVAMLVAVPVG
                     LFSAIYMSEYATPRLRSVVKPLLEVLAGIPTIVYGFFALTTVGPFLRDISTQINGLAT
                     GNYANFIQAQSVITAGFVMGIMLIPYVSSLSDDIITAVPRSLRDGSLGLGATRSETIK
                     KVIVPAALPGIVGAVLMTASRAIGETMIVVLAAGVAARLQLNPFEPMTTVTVKIVSQL
                     TGDLEFTSPQTLVAFALGITLFAITLCLNIYALYIVRKYREQYE"
     gene            419082..420404
                     /gene="pstA"
                     /locus_tag="Atu0422"
                     /old_locus_tag="AGR_C_741"
     CDS             419082..420404
                     /gene="pstA"
                     /locus_tag="Atu0422"
                     /old_locus_tag="AGR_C_741"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, membrane spanning protein"
                     /protein_id="AAK86236.1"
                     /translation="MTDIVSPAAGGSAVNKATRRDIGIKRRYAAERRFRAYGMAAISF
                     GLLFLFLLLFSVVSKGYTAFQQTMITVPVEFSEQIIDPKNERATNPAKLMTANYPVVA
                     RDAVAKVLGIAPTDRAGLRAVNLLISDSVRTQLRDIVVADPAVIGTTRTVTLLASGDV
                     DSAFKGQVDLTADEANRRISNQQLGWMNQLAESGQLGKHFNTGIFINGASSRPEAAGV
                     GVALIGSFYMMLIVLVLALPIGVAASIYLEEFAPKNRLTDLIEVNINNLAAVPSIVYG
                     LLGLSVFINFMGFPRSASLVGGLVLTLMTLPTIIIATRAALKAVPPSIRAAALGLGAS
                     KMQTIFHHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVANYPTTPMDPSTAL
                     PVQIYMWANEAERAFVERTSGAIIILLLFLIVMNVGAILLRRRFERRW"
     gene            420419..421234
                     /gene="pstB"
                     /locus_tag="Atu0423"
                     /old_locus_tag="AGR_C_743"
     CDS             420419..421234
                     /gene="pstB"
                     /locus_tag="Atu0423"
                     /old_locus_tag="AGR_C_743"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, nucleotide binding/ATPase
                     protein"
                     /protein_id="AAK86237.1"
                     /translation="MNMLSEAAVEKALDKKMNEVSYKMIGKDVSVYYGEKRALYDVNL
                     NVRENTVTALIGPSGCGKSTFLRTLNRMNDTIDGCRVTGKITLDTDDIYDQQIDVVEL
                     RARVGMVFQKPNPFPKTIYENIAYGPRIHGLARNKADMDQIVEHSLQKAGLWNEVKDR
                     LLESGTGLSGGQQQRLCIARAVAVSPEVILMDEPCSALDPIATAKVEELIHELRTNYT
                     IVIVTHSMQQAARVSQRTAMFHLGHLVEENETDKMFTNPDDQRTQDYIMGRFG"
     gene            421331..422056
                     /gene="phoU"
                     /locus_tag="Atu0424"
                     /old_locus_tag="AGR_C_744"
     CDS             421331..422056
                     /gene="phoU"
                     /locus_tag="Atu0424"
                     /old_locus_tag="AGR_C_744"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate transport system regulatory protein"
                     /protein_id="AAK86238.1"
                     /translation="MTQTTTHSHILSAYDDELKFLTRRIAEMGGLAEQMCGDAVRALV
                     NSDAALAQKVISDDTILDHAEREIGDKAIVTIARRQPMAADLREIIGTLRIAADLERV
                     GDLGKNTAKRVIAVAGTGVPRKLARGIEHLSELALVQLKEVLDVYSTRSAEKANAIRE
                     RDEEIDAMYTSLFRELLTYMMEDPRNITTCTHLLFCAKNIERIGDHATNIAETIYYMA
                     TGSQPEGERPKDDSSNTLGSVTE"
     gene            422089..422772
                     /gene="phoB"
                     /locus_tag="Atu0425"
                     /old_locus_tag="AGR_C_746"
     CDS             422089..422772
                     /gene="phoB"
                     /locus_tag="Atu0425"
                     /old_locus_tag="AGR_C_746"
                     /codon_start=1
                     /transl_table=11
                     /product="two component response regulator"
                     /protein_id="AAK86239.1"
                     /translation="MVPKIAVVEDEEALSVLLRYNLEAEGYDVDTIPRGDEAEIRLQE
                     RIPDLLILDWMLPGVSGIELCRRLRMRPETERLPIIMLTARGEESERVRGLATGADDY
                     VVKPFSTPELMARVKAMLRRARPEVLSSVLKCGDIELDRETHRVHRKSREVRLGPTEF
                     RLLEFLMTSPGRVFSRSQLLDGVWGHDIYVDERTVDVHVGRLRKALNFSHMQDVIRTV
                     RGAGYSMEA"
     gene            423109..423690
                     /locus_tag="Atu0426"
     CDS             423109..423690
                     /locus_tag="Atu0426"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAL41446.1"
                     /translation="MELAIGRRFQRFTTAEMEIIFQGVADRPLAGALRQFRQRQATGN
                     RGDDVSGRNVIENFCSLDADLFLKSRCRVGTRQDPGRCRADTTGEIRRARGRGGGALG
                     RGTRRSDRTAGLDASRQIETVNLADNGITADTAQLRCYLAGAKSLGPQFLEFLDSLVC
                     PVHAASPLFACIVGRIPLRPAGVPQAWFPPDFR"
     gene            423750..423998
                     /locus_tag="Atu0427"
                     /old_locus_tag="AGR_C_751"
     CDS             423750..423998
                     /locus_tag="Atu0427"
                     /old_locus_tag="AGR_C_751"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK86240.1"
                     /translation="MARVGGIIWNRFSGFPQLAGELSLKGNTLGLESFHLLLLETPGK
                     CGLLLTSAGELTIVPVPPQGGIFDFQARDNPQSLLTTV"
     gene            424029..425228
                     /gene="argD"
                     /locus_tag="Atu0428"
                     /old_locus_tag="AGR_C_752"
     CDS             424029..425228
                     /gene="argD"
                     /locus_tag="Atu0428"
                     /old_locus_tag="AGR_C_752"
                     /codon_start=1
                     /transl_table=11
                     /product="acetylornithine aminotransferase"
                     /protein_id="AAK86241.1"
                     /translation="MAEAAAPLFDTFARAPLRFERGEGVWLFTESGERYLDFAAGVAV
                     NSLGHAHPHLVEAIKTQAEKVWHVSNLYEVPGQEKLAKRLTEATFADKVFFTNSGAEA
                     LECAIKTARRYHYSKGHPEKFRIITFEGAFHGRTLATIAAGGQQKYLEGFGPKVEGFD
                     QVPFGDVDALKAAITAETAALLIEPIQGEGGIRAPAKEFLQLLRSLCDEHDLLLIFDE
                     VQTGVGRTGKFFAYEQTGVAPDIMAVAKGIGGGFPLGACLATADAASGMTAGVHGTTY
                     GGNPLAMAVGNAVLDVVLADGFLEKVRDVALVFRQGLASLKDRYPDVIEEIRGEGLLL
                     GIKARVPSGELLQAMRAEHLLGVPAGDNVIRLLPPLVTTAEEAREGLARVEAAAASLT
                     AKQAKIA"
     gene            425285..426202
                     /gene="argF"
                     /locus_tag="Atu0429"
                     /old_locus_tag="AGR_C_755"
     CDS             425285..426202
                     /gene="argF"
                     /locus_tag="Atu0429"
                     /old_locus_tag="AGR_C_755"
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine carbamoyltransferase"
                     /protein_id="AAK86242.1"
                     /translation="MASPKHFLDLSAVGPQDLRTILDDARARKVATKAGTAEKPLAGK
                     MLAMIFEKPSTRTRVSFDVGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAI
                     MIRTTDHSRLLELAEHATVPVINGLTDDTHPCQIMADIMTFEEHRGPVKGKTIAWTGD
                     GNNVLHSFVEGSARFGYRMTMAVPMGSEPHDKFMNWARNNGGEIALYHDADKAVAGAD
                     CVVTDTWVSMNQEHKARGHNIFQPYQVNEALMAKAQKDALFMHCLPAHRGEEVTDAVI
                     DGPQSVVFDEAENRLHAQKSVIAWCMGVI"
     gene            426439..427428
                     /gene="hslO"
                     /locus_tag="Atu0430"
                     /old_locus_tag="AGR_C_757"
     CDS             426439..427428
                     /gene="hslO"
                     /locus_tag="Atu0430"
                     /old_locus_tag="AGR_C_757"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperonin (heat shock protein hsp33)"
                     /protein_id="AAK86243.2"
                     /translation="MADVTVELDDLNFAGDDKVVPFQVEGLDVRGRGVQVGPLLNAIL
                     ERHDYPAVVARLLAEATVLTALIGTSLKFSGKLTVQTKGDGPVDLLVADFSAPDSMRA
                     YARFDEERLAEAVAAGETSPEQLLGNGILAFTIDQGAGMQPYQGIVPLDGSSLEDIAG
                     VYFRQSEQLPTRVRLGVAEFFDRDSEGKPRHGWRAGGLIAQFLPQAPERLRMRDLHGG
                     DGDEGGHEVQEDDAWTEAVTLLNTIDTDELTDPQVPVERLLYRLFHESGVRIYDPQAI
                     FDRCSCSRDKIKGVLSGFTAEEIKASEEDGAIAVTCEFCSTTYRYDVSEFENA"
     gene            complement(427501..427893)
                     /gene="apaG"
                     /locus_tag="Atu0431"
                     /old_locus_tag="AGR_C_759"
     CDS             complement(427501..427893)
                     /gene="apaG"
                     /locus_tag="Atu0431"
                     /old_locus_tag="AGR_C_759"
                     /codon_start=1
                     /transl_table=11
                     /product="apaG protein"
                     /protein_id="AAK86244.2"
                     /translation="MYRALTRDIEVTVDPYYLEEQSDPDDDRYVWGYKVVIANNSDVP
                     VKLVNRYWHITDQNGQVDEVYGPGVVGEQPQLKPGDSYEYSSGCPLDTPSGLMFGHYE
                     METENGEVFNVTIPAFSLDSPGLMRVLN"
     gene            complement(428128..429312)
                     /locus_tag="Atu0432"
                     /old_locus_tag="AGR_C_761"
     CDS             complement(428128..429312)
                     /locus_tag="Atu0432"
                     /old_locus_tag="AGR_C_761"
                     /codon_start=1
                     /transl_table=11
                     /product="O-succinylhomoserine sulfhydrylase"
                     /protein_id="AAK86245.1"
                     /translation="MSNKWRPATQLVHGGTLRSPYGETSEAIYLTQGFVYENSEAAEA
                     RFKGETDGFIYARYASPTNDMFEKRMCLLEGAEDARALASGMAAVTAAIMCQLRAGDH
                     IVAARALFGSCRWVVETLAPKYGIECTLIDGRDLDNWEKAIQPNTKLFFLESPTNPTL
                     EVVDIAGVAKLANQIGAKVVVDNVFATPLFQKPLELGAHIVVYSATKHIDGQGRCLGG
                     VILSDKKWIEEELQDYFRHTGPAMSPFNAWTLLKGIETLPLRVKQQTENAAKIADFLA
                     DSGKVAKVIYPGRADHPQADIIARQMSGGSTLVAFELKGGKDAAFKLQNALEIVKISN
                     NLGDAKSLITHPGTTTHKNLSDEARAELGISGGTLRLSCGIEDTDDLLEDLAKGLAAV
                     SA"
     misc_feature    complement(429356..429434)
                     /note="SAM riboswitch (alpha-proteobacteria); predicted by
                     RFAM"
     gene            429508..430620
                     /gene="dcd"
                     /locus_tag="Atu0434"
                     /old_locus_tag="AGR_C_764"
     CDS             429508..430620
                     /gene="dcd"
                     /locus_tag="Atu0434"
                     /old_locus_tag="AGR_C_764"
                     /codon_start=1
                     /transl_table=11
                     /product="2'-deoxycytidine 5'-triphosphate deaminase"
                     /protein_id="AAK86246.1"
                     /translation="MTRTTGTRTTGILADGAIRALFAGDKLKSEADLDVDQVQPASLD
                     LRLGSKAYRVRASFMPGPGTRVIDKLNRFSLHEVDLSQGAVLETGCVYIVPLMESLAL
                     PADMSASANPKSSTGRLDIFTRVMTDNAQEFDKIPAGYTGPLYLEISPRTFPIVVRRG
                     SRLSQIRFRIGHALLNESEVLKLHETETLVASENPNVTGGGIALSIDLKGFGENGLIG
                     YRGKHHTAVVDVDKKAQHDVLDFWEPLFARGRAELILDPDEFYILVSREAVHVPPLYA
                     AEMTPFDPLVGEFRVHYAGFFDPGFGHAQAGGTGSRAVLEVRSHEVPFILEHGQIVGR
                     LVYEHMLEKPEGLYGTGLGSNYQAQGLKLSKHFRAE"
     gene            430677..430750
                     /locus_tag="Atu0435"
     tRNA            430677..430750
                     /locus_tag="Atu0435"
                     /product="tRNA-Gly"
     gene            430993..433149
                     /locus_tag="Atu0436"
                     /old_locus_tag="AGR_C_765"
     CDS             430993..433149
                     /locus_tag="Atu0436"
                     /old_locus_tag="AGR_C_765"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86247.1"
                     /translation="MQRLESDVAEIIYGDQHVSMAQRQLVEVFGAGNVPGTLYLGYPI
                     LLNAQGNVKVDALYVSPFHGVWAFDLEHGNNDPGKQEEFEEIESSTERLYNALHSKLL
                     EDDGLVKRSKLQVPVNVITLSVDQSFDDEYVRFLTIDQVNSALQQGVEIPRAYYERLC
                     SVIERTATIRPKKQRAAVSKTGSRGAIIKEIEKKIANLDAFQKKAAIEIPSGVQRIRG
                     LAGSGKTIVLALKAAFLHTKNPDWQIVITFQTRTLYQQFRRLVRQFCFEFSKSEPDWS
                     KLLVMHAWGGATTPGLYTSFAEAASLKKMTFSEASSKYGQNGAFRGACSELLQASKAG
                     GEIRPIYDVILIDEAQDFPAEFFELVFLYTKDPKRIVYAYDELQNLSDFDMLPAESLF
                     GVRPDGTPNVELRNEPGRARSDIVLPICYRNSPWNLTAAHGLGFGTAREQAPNEPSNL
                     IQLFDGSELWTDIGYSIVQGPLTAGSHVRLRRDEASTPAFFSELLSPEESLRFIQFDT
                     LGDEVEWVANQIASNVNEDELELDDILVVIPDPYTSRSIGGKLIKSLGARGIGGHLVG
                     VTSSLDEVFTSNSVAITSIYRAKGNEAPFVYVLGAESCSQGFGLARKRNMLFTAMTRS
                     RAWVRVTGTGPSMANLIAEFNRIRQSNFELNFIYPTQEDLKKIRLLHRDRPQDEIDGL
                     RQDQAAVERILLLLKSGQISASSLSPEIQAVFRNIQ"
     gene            433149..433829
                     /locus_tag="Atu0437"
                     /old_locus_tag="AGR_C_766"
     CDS             433149..433829
                     /locus_tag="Atu0437"
                     /old_locus_tag="AGR_C_766"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86248.1"
                     /translation="MNHLALTSYLGTLAEVGFVNEFRQVVPTRTTNITTIEVGDTSKI
                     SGDETGADIAEGSTIHYLACLRQAKYSCILFDGSLVQLKYSTCEGRITNHRYLYFPCP
                     AKLDLRSTADETIYDIVDDACLAGALDAPRLGFMRFDFEPPKREQDRRPPGEHPDAHI
                     HIGIGSCRIPLVSPISVDEFFSFLLKFYYAEFWDHQVHGQSRFREPRTILPLEQGFFH
                     FGWIRPTP"
     gene            complement(433831..434859)
                     /gene="intD"
                     /locus_tag="Atu0438"
                     /old_locus_tag="AGR_C_767"
     CDS             complement(433831..434859)
                     /gene="intD"
                     /locus_tag="Atu0438"
                     /old_locus_tag="AGR_C_767"
                     /codon_start=1
                     /transl_table=11
                     /product="phage-related integrase"
                     /protein_id="AAK86249.2"
                     /translation="MVTVELKGIHTVKAKGNVYYYAWRGGPRLDGHPGTAAFMASYNE
                     AIANRMEPESGRFRSIITHYKATEFKKLADSTKRVWSPWIDRISEHFGNLSIAQFNRT
                     DKIRPRIRQWRGQYSDTPRAADTGMQVLSRILSHGVDPMGKLSANPAEGIKHLYSSDR
                     SEIIWTDADIAQVKAECSDEVKWVIDLAAHTGLRVSDLLKLSWSHVGPDAIIISTGKS
                     RHKREAIIPRYDALNEILERIPKRSPVILTSSKKKPWKPSGLNTMFWRAKEKAKMLER
                     DLHFHDLRGTAATKFYNAGLSVRVIAEIMAWEEETVGKIIRRYVGRNSATLEHINMLN
                     SKSKDKSG"
     gene            complement(435142..436047)
                     /locus_tag="Atu8122"
                     /old_locus_tag="AGR_C_768"
     CDS             complement(435142..436047)
                     /locus_tag="Atu8122"
                     /old_locus_tag="AGR_C_768"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86250.1"
                     /translation="MDQLTQTAVAEIAKLAALTNAAIVQVPAPADAKGIPSTVPALLD
                     PTSGRLADVSAIFAPWRTRPERKQGTAYAETLESFVQLVERHQTENSVIFAVTDWRDP
                     TFTAVIDYHGDDPDNGKHRVHYAFPLSEEWKAWQSINGKALTQNEFAEFIEDHIAELA
                     SPDSDEVKDLELLFKAKVAYPNELVVLSQGLQINAETRVKTAVKLQTGESQIVFEEDH
                     KNANGDPITVPGVFVLNIAPFFQGESIRLPVRLRYRLREGKLSWTCMLYRPDTHITKA
                     VTFALHETAAELGLPKFAGKPEMSA"
     gene            complement(437097..437330)
                     /locus_tag="Atu8123"
                     /old_locus_tag="AGR_C_776"
     CDS             complement(437097..437330)
                     /locus_tag="Atu8123"
                     /old_locus_tag="AGR_C_776"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK86254.1"
                     /translation="MRKKARPTQSGDTGMRINTVNDTELTQAMADAIQRVGEGCTKAD
                     LREWFTADEIHRCGDAAIARFHDMRVQDAREAA"
     gene            complement(437495..437917)
                     /locus_tag="Atu8124"
                     /old_locus_tag="AGR_C_779"
     CDS             complement(437495..437917)
                     /locus_tag="Atu8124"
                     /old_locus_tag="AGR_C_779"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK86255.2"
                     /translation="MLAMFKSLVGDKAKKFSGKTDFLEAVCAASALVATADGELDDKE
                     LLAAVAAVKSNAALSGAFDARAIETTMDKMCSRAVGRVGKAGLFKEIEDIKADHDMSE
                     TVLLVALDVADSGGISDDEKAVLAKIASTVELDLAKYL"
     gene            complement(438416..439111)
                     /locus_tag="Atu0443"
                     /old_locus_tag="AGR_C_784"
     CDS             complement(438416..439111)
                     /locus_tag="Atu0443"
                     /old_locus_tag="AGR_C_784"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phage repressor"
                     /protein_id="AAK86257.1"
                     /translation="MDHIELRKKIGQAIRTARIRRGLVMRDLAEAGGVSTGAVGNWER
                     GANAIAMEHLQAISQKLRIDPVALSNGSLRYLDEEEALADAEQVTDFGPAPTGPMDVE
                     VLGVAVGGDDGDFTLNGEVSGYVRRPPGIAHLRKVFALHVLSDSMIPRYDPGELIYVG
                     GREAVAGDHVVIEMFPDEGATVGKAYVKKLKGRTKGAIVCEQYNPPKELQFDQYAIKN
                     MWRIIPLRELLGY"
     gene            439119..439418
                     /locus_tag="Atu0444"
                     /old_locus_tag="AGR_C_785"
     CDS             439119..439418
                     /locus_tag="Atu0444"
                     /old_locus_tag="AGR_C_785"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86258.1"
                     /translation="MKGELSSFVHLSIACIDFKAVLLIALMETNLNQNGLIAVKGAAG
                     GASAIARAIGVTPQAVAQWKAIPPEHVLKLEKAFGVSRHIQRADVFGPAELEAAE"
     gene            439628..440125
                     /locus_tag="Atu0445"
                     /old_locus_tag="AGR_C_787"
     CDS             439628..440125
                     /locus_tag="Atu0445"
                     /old_locus_tag="AGR_C_787"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK86260.1"
                     /translation="MISNAWFHRIKAAQRDLIRLVGGIERAAEISSISKSHIGRMNNA
                     TDPELMPLHAVYALESECGVPVVTSAMAELNGRRLADPENERAAEQCVVVTYSEMVRK
                     AGDLISGGAVAIADMVVTPAEATKMDRDAAELGAGLAAFRKALASVKAKGGHKVGLSV
                     VGGAE"
     gene            440613..441758
                     /locus_tag="Atu0446"
                     /old_locus_tag="AGR_C_790"
     CDS             440613..441758
                     /locus_tag="Atu0446"
                     /old_locus_tag="AGR_C_790"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86261.2"
                     /translation="MPERETETAVVPVVDASGLVATVERARALLDEGDVMNARIVASV
                     AYNQAKTAAQFAEQIGATEKLVAKARRMQADALLIEARAKILIADKWDEAKAAGTASS
                     GGRPKTTSDGSGFFVADTGLSSKELVEARKLAAAEHREPGIVERAIQARLAAGLEPTK
                     ANLRAAVGTASATKEERGANLYETPPEAMFTLLALEEFSACVLEPACGRGAISRMLEA
                     FHYGVVLADINDYGTADSNGELQAVQDFLTSQPDEPGSYDIVTNPPYGDVLNAFVAHA
                     LRIYQPRKMALLLNLNFLCGFADDDRNFVMDDCPPARVYVFKRRLPMMHRDGWEGNKA
                     SSRMNTAWFVWERDESGNYGSATVVRRVDWKDFQPQETAVTAESEAA"
     gene            441917..442468
                     /locus_tag="Atu8082"
                     /old_locus_tag="AGR_C_792"
     CDS             441917..442468
                     /locus_tag="Atu8082"
                     /old_locus_tag="AGR_C_792"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86262.1"
                     /translation="MNKLVDPARAREQKAVDRLRYLSARIDGDVWAFEPRGNNIAVIA
                     RRSTGDEALICTLHADALPDERDLICGAAENLAFLLGLIGRASDAVRNLKKQLEAQQT
                     AAVRKKYAAQAAILLSDRTFQRFLEIKGAGGPVRDKAQAHTRLKSILAISSKKEIDND
                     PRAQAAFLHFRKDFEAWKRGSSR"
     gene            442525..443106
                     /locus_tag="Atu0447"
                     /old_locus_tag="AGR_C_793"
     CDS             442525..443106
                     /locus_tag="Atu0447"
                     /old_locus_tag="AGR_C_793"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK86263.2"
                     /translation="MQITCACCGAVAYFPHQTGVNRKPPIAATQHFQNKGWVVGGNPR
                     KDFCPIHAAPAKRKGQKAMVDTVATIADKPREMSREDRRIINDKLDEVYAKDAYKSPW
                     TDSAVAKDLGVPRDWVAQVRDQFFGPAGSNPLYDEFLKETKLVEGAFLACEEATARAE
                     KAAADQRRAHGDLCKAMDSYRVLARKVEREISR"
     gene            443103..443396
                     /locus_tag="Atu0448"
                     /old_locus_tag="AGR_C_795"
     CDS             443103..443396
                     /locus_tag="Atu0448"
                     /old_locus_tag="AGR_C_795"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK86264.1"
                     /translation="MTDLMPIVEILADCQTDAARADWLLRAPQGVIYRDHTTIRRVLQ
                     EAHFTLGVDALDVEFAAINATRLPDGGLPHTVVLGVHAVRSFLRDVVRKGGAQ"
     gene            443396..444616
                     /locus_tag="Atu0449"
                     /old_locus_tag="AGR_C_796"
     CDS             443396..444616
                     /locus_tag="Atu0449"
                     /old_locus_tag="AGR_C_796"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK86265.2"
                     /translation="MEPDHGAMSRAWSWRHAVGKSGLPPITRLVLHTLGLKMDATGGS
                     CYPPISELVDLTGLDKKTVLKHLEIAEESGWIVVTQHGFRGQKWKRNEYVARWPGRDL
                     SGNAASTEDNEGGGNPPPRSVAKAVEIVPEGGGNDDRKVVEEFHQDKNLPTNIPENSP
                     AAGAEEGVLKKVDRKKIEHAFTLWFAMWKKGDVEYARNAWFALSPEDRTECVERTPAY
                     LRWAKPADLMAAAVYLKNRHWRDLPEHVLAEPINAHGIAKVCGKLWMGTRFEALSKEP
                     TGLLYVTSFDETRIAKGMISREQLMFEKRRDNGWPLVNTMRDLARRREPFNTSLSLLP
                     LVQGFRQVHRDSDVFAAWKHLHERNGWPFIEHPPEWVYFPPVDDGADDLEAAVDAALS
                     KFLSTISEGRNNDA"
     gene            444726..445292
                     /gene="nusG"
                     /locus_tag="Atu0450"
                     /old_locus_tag="AGR_C_797"
     CDS             444726..445292
                     /gene="nusG"
                     /locus_tag="Atu0450"
                     /old_locus_tag="AGR_C_797"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription antitermination protein"
                     /protein_id="AAK86266.2"
                     /translation="MLSMAAENQPGKHEWFVVETKHKAEKAVEDALRKAGVKVFLPLE
                     TIGETVVRGRIIPAVSRPLLPGYVLVNIVYSPAAVCGIARLEGVAGFVGGMVHPHRVS
                     DEEMNRFKAFGDDETAPDVKHCEQFKRGDKVRFVLGPFASFGGNILKLRKDRAVDGER
                     VATGAVVAVDVFGKVSTIEAPLALLEQL"
     gene            445537..446106
                     /locus_tag="Atu8125"
                     /old_locus_tag="AGR_C_798"
     CDS             445537..446106
                     /locus_tag="Atu8125"
                     /old_locus_tag="AGR_C_798"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86267.1"
                     /translation="MAVLSMKWADRNLAEYGDRIAELKRRFPTVLPRIVNQVGNRTKT
                     VVIRELTKQTGLPRATIVKAIGNPATAKPGRFVYDMTTRGGNIRLKYLRPKETEAGVV
                     ARPFGKPMLYPGAFLRGGQFPDRKLVAQFNGHAYYRLNRSGTKITFARSGVFIPKEMT
                     SGATAAAFQRIAAPLLKERVEAALAKLVP"
     gene            446189..447001
                     /locus_tag="Atu8083"
                     /old_locus_tag="AGR_C_800"
     CDS             446189..447001
                     /locus_tag="Atu8083"
                     /old_locus_tag="AGR_C_800"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86268.2"
                     /translation="MGDCGISLCEENYRGVPPPFQWNRNQMAKSYPDELREQVVAFMD
                     EGHTVREAAAKFNVSPSFAAKSHKKHAEAGESLPLLNETAPAEPEKPSLDIEITASEL
                     AELLKVSKRAVSDFVERGIVVKTERNRFDLRQSIQLYCEHLRGVAAGRGGDGADVLTA
                     ERARLAREQADQTAMKNAAMRGELISMTDVRNEWVSIGRRIRNAVLSVPSRCRQMLPH
                     LTTYDVDLIGEEIRSALTELGDEDDDNGAGDIAASGMGQPVAAAETSAVGLD"
     gene            complement(447142..447747)
                     /locus_tag="Atu0452"
     CDS             complement(447142..447747)
                     /locus_tag="Atu0452"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAL41471.1"
                     /translation="MTICGRSGAALPFDMNDKRTVSPKAPPTFRSTAASSFRQSTILL
                     MQDEVAGRRRIGGDGGGVTDLGICASIIGGGQLGTIPIKDCAFGPCLRVRLGQGENAR
                     AGNIDALTSLGGKLRYAEQLANKNAVAGIDIGGRGDFHRVGGASIVFHGDLPCDQRDE
                     ERESRAAPPTKSGRRLTLGRGCDSRSGNRSHRNRSRVPPTC"
     gene            448012..448758
                     /locus_tag="Atu0453"
                     /old_locus_tag="AGR_C_807"
     CDS             448012..448758
                     /locus_tag="Atu0453"
                     /old_locus_tag="AGR_C_807"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK86271.1"
                     /translation="MSFIRFAARICAVEAIKGNTVVGSNVLDSEIGVLDIAADGSLRT
                     DKDKPFISVYTDGSKLIEGLELRSLASPGQLDIVFEAGVTTAHAVTDTETDESVILGM
                     PATDATFEFHLDMALRQTGDALNDSENEWAEIFRSLCSSFQSASRSRISGDTNGVRLA
                     AHQLKITANMVAEPLCGQPLNPGSPFAKFVAKCESDLAPNDPSMAEKIALIRAQLSGD
                     ANELQTAMRRYGLIYDEADAMLITPYEGSP"
     gene            448758..449309
                     /locus_tag="Atu0454"
                     /old_locus_tag="AGR_C_808"
     CDS             448758..449309
                     /locus_tag="Atu0454"
                     /old_locus_tag="AGR_C_808"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK86272.1"
                     /translation="MASLVDQITDLYVRMAELERRNRNRRRKGTIAEVSDDKSKYRVK
                     LSEQAGKPYLTPWIKARTLAAGGVKVDVLYSVGEQVDVVSENGEMTDAQIDFSTYSDD
                     NARENSDTPFHIKIGDTVIEASAGQAKVTSPKVIVESPNVQLGGDGGKRVARIGDLVH
                     VMSGSSSGKWPIVEGSEHVFAVD"
     gene            449518..450183
                     /locus_tag="Atu8126"
                     /old_locus_tag="AGR_C_810"
     CDS             449518..450183
                     /locus_tag="Atu8126"
                     /old_locus_tag="AGR_C_810"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phage tail protein I"
                     /protein_id="AAK86273.1"
                     /translation="MSDVGVLLPSSAEPFEKALAAGMSDDLPIPYAVLMDPYQTPARF
                     LPWLAVHHSVDLWFDDWTEERKREMIAQCAGVSTLYPASPLGALKGTLAGLKRYLAFV
                     DAEIVDRIAHPNRFTFGRAVIGRTPIAHQPFVAHYLVRVTLTAPKNRFQIGRSAFGRA
                     AMTAIDLEPIRRAKHAMKTAKTPETIYSVSFAWRRGITFNDNIFIDGSHAIGGYMDRK
                     RLD"
     gene            450196..452397
                     /locus_tag="Atu8127"
                     /old_locus_tag="AGR_C_812"
     CDS             450196..452397
                     /locus_tag="Atu8127"
                     /old_locus_tag="AGR_C_812"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86274.1"
                     /translation="MQRTSFAEAEIADHADFEAIGLQAQAATDGLWLDAIGYPAHWAA
                     FTVARKSAQEITVSAGRYVAGEIVFAQEAPTDMNLQLHIPLAASDQRWVAVLLRGKEV
                     TDTANRPFETSDDPETSVIVNRTTPKTIRRVVELIVQPGDANPVPVKPVVASTDACIA
                     FVLLTSSGIDAIEPGNSDRVKTLYEVEGRVTALEVDLDALFMRTETIETQIVNIKAKL
                     TEIPRPVIIRQMQRDIGAARLKVDLPDEARAYVFDNGLIPDRWDMTHVDWLARIEEGI
                     RFGFAAEAQARLEVQAEDDPKIYFRGRRMVPAFDEVTRIANTSLDSTLLISQLVHTEI
                     TAIRKEASRVRVTYGPTQWACENQAGWSALGGDARVGQIFNIGGEEFQIVDIRANGGP
                     GHQTYGVRQIRYESYNEVYWEYVTEQIGLNGSIYGQTFLVAQPMQATSLELSFARVGN
                     DGDVHVLIVETTTGGVPRFDAVLAKGILKHADIKVGWNKVELPITLLESGKRYAFVTV
                     TTGAHALHISASNKYTGGTQFLTTDGAFAQGSMETDICFKLNAARYRSPRTVIPMQAL
                     NLADGMTQIDMLFAGWVPGGCQLGWEIRPSGSAIWTELDDGDPATNPLVGLPASVELR
                     MVMMGTADLQPMIQLDDKAISRVARNRSTMRAVSKSLPFGFPTTHVQTQYTLDSFDPV
                     RHTFTPAIMVGDTVVSPDATVVTVDPQVPSRRTYLSTYTLGAAASAAASRS"
     gene            452511..454250
                     /locus_tag="Atu0457"
                     /old_locus_tag="AGR_C_813"
     CDS             452511..454250
                     /locus_tag="Atu0457"
                     /old_locus_tag="AGR_C_813"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86275.2"
                     /translation="MTTIFNEGGSWCIVNRVPESADAATLQNNLIGDPVARTGLYAAL
                     RAKAITSYQPRVLITAGDTGAWIEGGVVSVSLTSEGDNLTEVPDVTATGGGADPGKVL
                     PTLKAIMGTGPNAKKVVGVEVVAPGKKMSAAPLLTFTGGGADAGKVLPAATANVGDVA
                     NPFVSALNAITPKIRARAYITGPNTTDAEALRFRKTVNGGRILIIDPKTIKNVNGVPV
                     TKPVAPVFAGVRSRVVASAEGFSGSVSNKIIRTIDGVARTIAYTGGMKEFMNDLGDLL
                     LGPVDPNAADRIGAIFMRAKEWGASIRELNDAIKDNPIAKFFAEMSGYGFQLFAWGMG
                     ISMLAGTIRKLAAALFVLSGASTLLGALKTVGSIAAIVGGGAVAGGAAAGAGTGSAGA
                     AAGGAATAGLLGRWGSIITGLARIGTYGTAGAGLWEMGKATYTGDTFYKQGKAWLPGP
                     EDLLHAVGSYFASSPPSTALPASASAQLSLDAARSARAAGFGGSTDNLPGKTMDDLGI
                     RTVRIDSSSLAQMDRPSGTQDVRVVNPQRPDITIHAPITITGVVDPRAAASAAISEIS
                     NALAPNLEGSFSD"
     gene            complement(454247..454615)
                     /locus_tag="Atu0458"
                     /old_locus_tag="AGR_C_814"
     CDS             complement(454247..454615)
                     /locus_tag="Atu0458"
                     /old_locus_tag="AGR_C_814"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK86276.1"
                     /translation="MTESQTETPAANEWPKRIIWVAIIAGAIYAYSNWDSVSVQLFGA
                     TAYTCKSLVPDVVKISAENTNAFQVKVVGVIDPKQVSKTDTRLECEGTGMLANGQKAP
                     ISYRAYEEGEQWWVVYEAKP"
     gene            454649..455113
                     /locus_tag="Atu8128"
                     /old_locus_tag="AGR_C_815"
     CDS             454649..455113
                     /locus_tag="Atu8128"
                     /old_locus_tag="AGR_C_815"
                     /codon_start=1
                     /transl_table=11
                     /product="putative bacteriophage P2 tail protein"
                     /protein_id="AAK86277.1"
                     /translation="MTGVTSMMLGGFAFEGLGFGYQGVKRKVNTPWVDIPVGQTLNQQ
                     QWTGPTSDEVTISGVLFPEEFGGQSQLDGIIAASMAGTEMMLVTGDAAQGVIQGMFTV
                     QSVEEDRSYINRRGEAGRNAYSITLKRSGSGTLPSAGGLVDRAASFLSELFR"
     gene            455118..455330
                     /locus_tag="Atu0460"
     CDS             455118..455330
                     /locus_tag="Atu0460"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAL41479.1"
                     /translation="MATIYTTRQGETVDLACLAFYGRTAKVVEAVIDANPGLAALGPV
                     LPLGTKITMPDIPSTSTAKPLTSLWD"
     gene            455333..456493
                     /locus_tag="Atu0461"
                     /old_locus_tag="AGR_C_819"
     CDS             455333..456493
                     /locus_tag="Atu0461"
                     /old_locus_tag="AGR_C_819"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86278.2"
                     /translation="MKPRVEVSIDGVPVAGHFYERLLSLTVTDEEGMKSDTVDIELND
                     GPPNFLAIPRKGAIISVKMGFGDDLVPKGVFTADKVNLDCLPYKMSISGKAADLRSGK
                     LKERQERSWDKSKLGDILSQIASESGLTPAVDDDLADFEYDWLAQQDESNINFLRRLA
                     ERHNGLFAVKQRRLIFTRLGSGLSASGAPLGSIILTPEKIKVGSLKVEINDRTKYSKV
                     VAYYQDSDKAERVEIDADADADGDSVYRLPEPYASPAEADKAAQAKAKELQRGEGSVS
                     VTVIGDAGIDAGLPLLFADVRPGVDGVPYIIKTAKTSYTKTGALEVAVSGRLYDGKSA
                     TEKSAGTESSGSSATPDASKATGKVAPNSAPGTPATPSSFLTPRRFGRTDEN"
     gene            456537..457178
                     /locus_tag="Atu0462"
                     /old_locus_tag="AGR_C_820"
     CDS             456537..457178
                     /locus_tag="Atu0462"
                     /old_locus_tag="AGR_C_820"
                     /codon_start=1
                     /transl_table=11
                     /product="endolysin"
                     /protein_id="AAK86279.2"
                     /translation="MGYVLSQRSLARLDGVHPDLVRVVRRAIQITEIDFVVTEGVRTL
                     EKQKDMVARGASKTMNSRHLKAANGYSHAVDLAALVGGSVVWDWPLYAKLAKAMKQAA
                     KELGIPLEWGGDWKSFKDGPHFQLPWKQYPSAGPVAGKKYTAETETQAKSKALAILGG
                     GVSTAVPVGQEPLTKAVEVVSAQQGELSSGEWARMAIAVFIVGISVYLAWRKL"
     gene            complement(457154..457471)
                     /locus_tag="Atu0463"
     CDS             complement(457154..457471)
                     /locus_tag="Atu0463"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAL41482.1"
                     /translation="MFVSGRGLIGTSKSQGSIAFTVGLHAAAEKPAQIKIVSLQSAFI
                     DLLSVFENGDTVILESDRDFGFSCPLADKVGGRSHESGTDNDAAPDQCSVKNPHQSFR
                     HAR"
     gene            457559..457882
                     /locus_tag="Atu0464"
                     /old_locus_tag="AGR_C_824"
     CDS             457559..457882
                     /locus_tag="Atu0464"
                     /old_locus_tag="AGR_C_824"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK86280.2"
                     /translation="MPEKYTSFIELMNAWVGGAFTTIIASLLGRFMWHGNEARKGRRK
                     FFGIELFWELPVALGMAVIGESAAAYADLGQPASTGLIALLAYLGPRGVEALFHKWFD
                     RRMAG"
     gene            complement(457933..458391)
                     /locus_tag="Atu0465"
     CDS             complement(457933..458391)
                     /locus_tag="Atu0465"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="AAL41484.1"
                     /translation="MSVVEHHYTECGLMNVFISGIEVQTDDDGDEVIIVPAVNELHHV
                     IATGIVNHPKGISGDELRFLRTEMGLTQSELSGLVHRDKQSIGRWERGEVEIDSPSET
                     LIRRLAIEKLGLQEVAIEELSKRSIPTAETQTISIRKVENNNEPYELIAA"
     gene            complement(458394..458753)
                     /locus_tag="Atu0466"
     CDS             complement(458394..458753)
                     /locus_tag="Atu0466"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAL41485.1"
                     /translation="MKSNDPWLPNVATDKLRAIARDPKFTIAYKLHAKERLAERNLIA
                     SDVLYALKYGFVYEQAIPATRQGFFRYRVECKTPNSGSRAIGVVVIPNHVGCYMKIVT
                     VMWIDEFERRDGSIIGE"
     gene            complement(458882..459028)
                     /locus_tag="Atu0467"
     CDS             complement(458882..459028)
                     /locus_tag="Atu0467"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAL41486.1"
                     /translation="MGKGWQSSINSDLRKLSGLRWRPKRKKPPGAARAAFLIAKNNVS
                     MGRH"
     gene            459236..459649
                     /locus_tag="Atu0468"
                     /old_locus_tag="AGR_C_828"
     CDS             459236..459649
                     /locus_tag="Atu0468"
                     /old_locus_tag="AGR_C_828"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK86281.1"
                     /translation="MSSDSNFSEISPEEMEIIQSVLKSAGYNAALLGDDQRQFNTAAF
                     LVMSLFLAGEKSADALAAQLKRRLGRASFHRPSYQSALAPYAIRGLPRNMRYVLQFSR
                     KGSARSIEAEEQSWENEGGAVRRPLGHPHHRPQLF"
     gene            459731..460009
                     /locus_tag="Atu0469"
     CDS             459731..460009
                     /locus_tag="Atu0469"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAL41488.1"
                     /translation="MIERTTNSEITFAHPFVLSSLVAPLDAGTYRLVVDEELIEGLSF
                     SAYRRVATHLEIPAISAQTVKRQFLQVSSAEIDDALRKDAELGSAATN"
     gene            460159..460419
                     /locus_tag="Atu0470"
     CDS             460159..460419
                     /locus_tag="Atu0470"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAL41489.1"
                     /translation="MTLIFPNRSRSYDDTRNAVRFLGYDGILEVRFFIEAAALVQSSS
                     SNISSECLLAFDAARGSILEAAKKAYARGYQSIYMLNARDFR"
     gene            complement(460517..460756)
                     /locus_tag="Atu0471"
                     /old_locus_tag="AGR_C_832"
     CDS             complement(460517..460756)
                     /locus_tag="Atu0471"
                     /old_locus_tag="AGR_C_832"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK86283.2"
                     /translation="MSDAEKIIVVQFKKGRYGIVPGDMRPATNAASAEKMANAMAPRH
                     IGVAAYAVTVDEESGSMANPRLLVSHGQIADLMPD"
     gene            461200..461757
                     /locus_tag="Atu0472"
                     /old_locus_tag="AGR_C_835"
     CDS             461200..461757
                     /locus_tag="Atu0472"
                     /old_locus_tag="AGR_C_835"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86284.2"
                     /translation="MIKSAIRTLALATIVSAISASAFAANPKVGGAAMYENKNIVENA
                     MNSKDHTTLVAAVKAAGLVETLQGKGPFTVFAPTNEAFAALPKGTVENLLKPENKAQL
                     TKVLTCHVVEADAMSKTIEKMIKDDKGTHDVKTVGGCILKAKESMDKITLTDEMGGVA
                     HVTIADVKQSNGVIHVIDKVLLPKM"
     gene            complement(461846..462760)
                     /locus_tag="Atu0473"
                     /old_locus_tag="AGR_C_837"
     CDS             complement(461846..462760)
                     /locus_tag="Atu0473"
                     /old_locus_tag="AGR_C_837"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK86285.2"
                     /translation="MHKQIFFCCLHPNPPPRVSSLMEASKTKGWTTSKRINAREKDMK
                     TIQITLIASAAFVATASAAVSAPVLGLTGDKTLVMFDTEKPAVSKSMDVTGVDKLVGI
                     DFRPGNKTVIGVTPDHRIVTINLETGAATDVAKMDKMLTLTEAPVVVDFNPMADRLRF
                     MTGTTNHRVHPDTGAVTVDGALAYEDADMHKGETPDIVAAAYTNSIGKPEKTAMYNID
                     ATIGALVQQTKPNDGTLKAIGKLGLKDKPASYAFDIHGEDGGKNTAYLAAGATLYTVN
                     LETGAATEVGPITGADNGLRDITVLPKM"
     gene            462837..463382
                     /locus_tag="Atu0474"
                     /old_locus_tag="AGR_C_838"
     CDS             462837..463382
                     /locus_tag="Atu0474"
                     /old_locus_tag="AGR_C_838"
                     /codon_start=1
                     /transl_table=11
                     /product="putative RNA polymerase sigma-70 factor"
                     /protein_id="AAK86286.2"
                     /translation="MGSAPDDLDRALAACARGDRNALRVIFEREAGRLIAVAERIVKR
                     RELAEEVVQESFVRIWTHAPQYRADHGSARGWIYAIVRNRALNLLRDGSRELTVQDVE
                     TLRDSEQADEVVAAWQKLDRNSRLYECLGALDETKRQGILMAYVAGYSHGEIAGRLRV
                     PLGTTKSWIRRGLSALRECMA"
     gene            463379..464083
                     /locus_tag="Atu0475"
                     /old_locus_tag="AGR_C_840"
     CDS             463379..464083
                     /locus_tag="Atu0475"
                     /old_locus_tag="AGR_C_840"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK86287.2"
                     /translation="MTYDQKDIPAIADDYVLGLLEASEAAAIETATERDGELRAAIAA
                     SRERFLPLDTSVAPAAVNSELWSNIESRLPPQAKFTANKSTRTANDNRKNGWRSIAVS
                     AIAATLVLAAGLTFSLTRTTEPLVIAVLVNEAGEVQAVVEDFGNEKATVRMLADFAVP
                     QDKTIQVWTLPSREVGPVSLGLIEGVRSASLEGPTLPKPRNDQLYEITLEQAGGSPTG
                     RPTGPILAKGLARMPR"
     gene            464352..465077
                     /gene="aqpZ"
                     /locus_tag="Atu0476"
                     /old_locus_tag="AGR_C_841"
     CDS             464352..465077
                     /gene="aqpZ"
                     /locus_tag="Atu0476"
                     /old_locus_tag="AGR_C_841"
                     /codon_start=1
                     /transl_table=11
                     /product="aquaporin"
                     /protein_id="AAK86288.1"
                     /translation="MSRKFISEFLGTFWLVFGGCGSAVFAAAFPELGIGFLGVAFAFG
                     LTVLTMAYAVGGISGGHFNPAVSVGLTVAGKFPAANLVPYIVAQVLGAVVAAAALYVI
                     LTGKAGAEIGGFAANGYGEHSPGGYSLLSALLIEIILTAFFLVVILGSTHGRVPVGFA
                     PVAIGLALTLIHLISIPVTNTSVNPARSTGQALFVGGWALQQLWLFWLAPILGGAIGA
                     VVWKIFGEEEKAGHAGSVQPAKT"
     gene            465100..465423
                     /locus_tag="Atu0477"
                     /old_locus_tag="AGR_C_842"
     CDS             465100..465423
                     /locus_tag="Atu0477"
                     /old_locus_tag="AGR_C_842"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86289.1"
                     /translation="MVGETTEEDGMDLTSILAQIVGGAVGGTAGGKILKDSDLGSLGN
                     LIAGAIGGIGGGTVLGSLLGTAGTAAAGGVDIGALAGQLVGGGVGGLIVQIIVGLIKN
                     KLVAK"
     gene            complement(465635..467182)
                     /locus_tag="Atu0478"
                     /old_locus_tag="AGR_C_847"
     CDS             complement(465635..467182)
                     /locus_tag="Atu0478"
                     /old_locus_tag="AGR_C_847"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="AAK86291.2"
                     /translation="MGLLIVPELARLDLLTNILDELPHLFDELAVTTPQAMRDAIWKA
                     GEARRLAETRQRLFNAAPQHSAKITLHGQQGFYGGVLATLLVLSLLTYSEIALAWLHA
                     TLSMLYLNTLLFRLFALIHIPRETDVETALSLRHENELPVYTILVALYREEAVIEQLV
                     SALERLDWPRSRLDIKLVCEADDGATIEAIRRINPGPHMEIVQVPPSEPRTKPKALTY
                     ALSGARGTFVVVYDAEDRPHPQQLREAYAAFRNQPEDMACVQAPLIISNASSSWLSAC
                     FALEYAGLFRCMLPALATHGLPLPLGGTSNHFRTAALRRAGAWDPYNVTEDADLGLRL
                     HRLGYRCGVIRRQTLEDAPTSLPVWLNQRTRWFKGWLQSWLVMTRTPFATARTMGWFA
                     YMTFQLLIGGMLLSSLTHPLLFVSLVFMAIAIRENGVDLLFRWQGALFFIDALNIVGS
                     YTIFVLMGRSRMIAYERRQVGRRWLAMPLYWLMLSVAAWRAVVELKTRPFVWNKTPHV
                     PVAKDKT"
     gene            467742..468503
                     /locus_tag="Atu0479"
                     /old_locus_tag="AGR_C_849"
     CDS             467742..468503
                     /locus_tag="Atu0479"
                     /old_locus_tag="AGR_C_849"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, substrate binding protein
                     (amino acid)"
                     /protein_id="AAK86292.2"
                     /translation="MPVLFDAQERFPGGDLSSVPRIRFLMSVDFPPFNFTDQEGRLAG
                     FHVDLVREICAQLKVESKCQVQALPFDELEAALEMGEGEAVISGLATTADLRKSFTFS
                     RPYLLLPARLAVNKAGKFTGSGADALSGKKVGVVGNSRHEQMLKAFFPKARVEGFDGY
                     EPMYEALKTGKVDAIFADGLRLPFWVSGGASESCCALFGGPYMSDRFLGEGLSIMAVD
                     PDNILVPAFDQALAALSRNGRLEEIYRRYFPYGLY"
     gene            complement(468531..469733)
                     /locus_tag="Atu0480"
                     /old_locus_tag="AGR_C_851"
     CDS             complement(468531..469733)
                     /locus_tag="Atu0480"
                     /old_locus_tag="AGR_C_851"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide biosynthesis protein"
                     /protein_id="AAK86293.2"
                     /translation="MSSAAQLLTFALLARHLGVEQFALYASITAVTNLGVQICGIGSQ
                     ESLIRRVAQDRSMFPVMLGHSYLLSAATGVVLTIIGMVTIPVFFPTSETLLHTLITTF
                     LILFTNLVLLKVISLSTQSFIAHSNFASANKLEVMFAVTRTIAAVVACLIFKVETVEA
                     WALWNLAAHAVAAVISVKATGRLGRPIFRIVREEIRIGILFSTQFLFKAVRGNADILV
                     LGAIASAEVLGSYSIARRILDSSYLSVEALNRLIYPGSASAALQGITKTIGRAYNVLK
                     AALFIATGSALVIFIIAPFLPLLFGDEYVSLPIITRVLCWVVLPMAVAATALEALGAS
                     GRQDIRAKIWNSGNLLGSVIVAFFTWSFSISGTIGSYFLVETAIAAAVWIALLRLRRD
                     EQVFAPAK"
     gene            470111..471406
                     /gene="exoQ"
                     /locus_tag="Atu0481"
                     /old_locus_tag="AGR_C_854"
     CDS             470111..471406
                     /gene="exoQ"
                     /locus_tag="Atu0481"
                     /old_locus_tag="AGR_C_854"
                     /codon_start=1
                     /transl_table=11
                     /product="exopolysaccharide production protein"
                     /protein_id="AAK86294.2"
                     /translation="MPRLADTQPITAQDSAISLAGGRRDAFFFVATMLYIWISVAPFE
                     NLAAPPVPRAAANQLTGLVIALILAVFALRHRLTGLLLRPRLPILLLFFWLVICSVIG
                     TQPGTSLQRLVFTALLCFITSVLVVMPRDRRQFDRMMAIFALILLALCYLGVIFLRSR
                     SVHQPFDLDEKALAGDWRGIFNHKNAAAPAMIILFMIGLYLRNAWSTLGGIAITLLAG
                     FFLWKTNGKTAAMLLPVTLALVWIMERHAHRTLLMIGGLLAFLNIVAVGSTYFPSIQN
                     FVESLGIDSTFTGRTDIWRLSFDTFAQSPIFGQGFQAFWTSDRLLSQADIAGTWAVTA
                     FHAHNGYVESLLNGGLPAFILTVIWLVIIPANDFHTAVDKGTDPGLTRLFARIWVYAL
                     LSSCLESNFFTGTGPIWSSLLIAVYCLRHQAHDILEQGQ"
     gene            471433..472185
                     /locus_tag="Atu0482"
                     /old_locus_tag="AGR_C_856"
     CDS             471433..472185
                     /locus_tag="Atu0482"
                     /old_locus_tag="AGR_C_856"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide deacetylase"
                     /protein_id="AAK86295.1"
                     /translation="MTQKIGTFVDRINNRLVRYFPGPAVRIEKSEPIVSFTFDDVPAT
                     AWTKGARILENEGVCGTFYIAGTFIDRHDGQQEMISAKGCSELAAAGHELACHTFSHR
                     KLSSFSRRALEEDLERNDSVLGAFDENRHSRNFSVPFGMASPVMQPLLRRRFRTTRGI
                     MPGINRDSVDPHNLAAVELRADQSYLDAADRWLEDVLQKGGWLIIFTHDVSPTPSFYG
                     CPEDRFQGLVRKAASGGAKIMTVDAAARTLGL"
     gene            complement(472247..472897)
                     /gene="c1"
                     /locus_tag="Atu0483"
                     /old_locus_tag="AGR_C_858"
     CDS             complement(472247..472897)
                     /gene="c1"
                     /locus_tag="Atu0483"
                     /old_locus_tag="AGR_C_858"
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriophage repressor protein C1"
                     /protein_id="AAK86296.1"
                     /translation="MLSHETIWSAIDTLAERHQLTPSALAKRAGLDPTSFNKSKRFGP
                     DGRKRWPSTESVSKVLEATGASVDQFFGYAFGRAQTMQPSGADNAIPLLGFAQAGSGG
                     FFDDGGFPAGQGWDVVEFPSSPERKQGVYALEVQGESMMPLYRDGDILIVEPGAPVRR
                     GDRVVLKSRDGEVMAKVLARQSPKNIELLSLNPEHPNRSFDMADVEWIARIIWASQ"
     gene            complement(473010..473660)
                     /locus_tag="Atu0484"
                     /old_locus_tag="AGR_C_859"
     CDS             complement(473010..473660)
                     /locus_tag="Atu0484"
                     /old_locus_tag="AGR_C_859"
                     /codon_start=1
                     /transl_table=11
                     /product="two component response regulator"
                     /protein_id="AAK86297.2"
                     /translation="MSELVIIIADDHPLFRGALKQAVAGLDGQQTIIEAGDFEAARHA
                     ATTRNDADLMLLDLAMPGVSGFSGLMALRAEFSSLPIVIVSATDDATTVRRSIELGAS
                     GFISKSSGIDDIRDGIRAVLEGDVWIPSGHQGEKEQDPDVADLIGRLRTLTPQQSRVL
                     GMLAEGLLNKQIAYELNVSEATIKAHVSAILLKLKVDSRTQAVIQLAKINTSAMVA"
     gene            473913..474266
                     /locus_tag="Atu0485"
                     /old_locus_tag="AGR_C_860"
     CDS             473913..474266
                     /locus_tag="Atu0485"
                     /old_locus_tag="AGR_C_860"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86298.2"
                     /translation="MQETPAIIYKIVPETLWTAARAEGMFEGAAIDLTDGFIHFSTAK
                     QVAETAARHFSGQVDLLLIAVDGAALGDKLVYEPSRGGDLFPHLYAPLPFSAVLWETP
                     LSLDHDGQHQFPEIL"
     gene            474266..475357
                     /gene="pyrD"
                     /locus_tag="Atu0486"
                     /old_locus_tag="AGR_C_861"
     CDS             474266..475357
                     /gene="pyrD"
                     /locus_tag="Atu0486"
                     /old_locus_tag="AGR_C_861"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotate dehydrogenase"
                     /protein_id="AAK86299.2"
                     /translation="MSGLFSSVGRKGLFLIDPEKAHGLSVAALKSGFLPTCMVPHDPR
                     LQQTVAGLVFPNPLGMAAGYDKNAEVPGPLLRLGFGFTEIGTVTPRAQSGNPKPRIFR
                     LVEDEGVINRLGFNNEGHAAALERLTQARLRGIVGVNIGANKDSEDRIADYVQGIEAF
                     YAVASYFTVNISSPNTPGLRDLQARESLAALLTAVLERRKTEAERLGKRIPIFLKIAP
                     DLTEEGLDDVAEEALAHDLDGLIVSNTTLSREGLRPGPHRGEAGGLSGKPLFELSTTV
                     LAKMRRRVGANLPIIGVGGVSSAETALEKVRAGADLVQLYSCMVYEGPGLPSAIVKGM
                     SKLVAREGVETIRDLRDSAVDRWADRKLG"
     gene            complement(475394..475891)
                     /locus_tag="Atu8129"
                     /old_locus_tag="AGR_C_862"
     CDS             complement(475394..475891)
                     /locus_tag="Atu8129"
                     /old_locus_tag="AGR_C_862"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86300.1"
                     /translation="MTDTSLQTLTRRGFVLISAGSVLSACVSMPTNKGLPSGTRDETA
                     AALPMVNDLRRSKGLAPLAINGAASGAAAYQAGRMVKAQKMAHLIGLTDSFLIRMKDG
                     KVPLPAAENVAAGQDSVERVVKAWIGSQHHLENMLGPYNGLGVAVAYDAASRNRPYWA
                     MVLCA"
     gene            complement(475893..476159)
                     /locus_tag="Atu0488"
                     /old_locus_tag="AGR_C_864"
     CDS             complement(475893..476159)
                     /locus_tag="Atu0488"
                     /old_locus_tag="AGR_C_864"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86301.2"
                     /translation="MAGEVNKMLGDTVARTVVKLLVVSLLVGFLMAIFGLTPWNIIYS
                     ARDFVVDLWRSGFHALGAIGDYLLLGATIVIPVFIILRLLSYRR"
     gene            476434..477270
                     /locus_tag="Atu0489"
                     /old_locus_tag="AGR_C_866"
     CDS             476434..477270
                     /locus_tag="Atu0489"
                     /old_locus_tag="AGR_C_866"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="AAK86302.2"
                     /translation="MEQALELAPRWTAGWFRFGEYHEKAGETAKAVAAYEKVAELDAE
                     GLFAAELKLAVLGAAETPEQPPSRYVEGLFDDYADRFETSLVEKLDYSVPQKLAELIG
                     KAATGDAFDTIVDIGCGTGLLGIEIRSLAKRLEGFDISQNMLAKADEKSLYDHLGQAD
                     LSLDAEASGLFTPVLTQHRADLVAAADVMMYLGSLETVMPLVSALLKPSGFFAFSVED
                     AGDEQGFVLRESLRYAHSKSYVIDLLERSGFSPMEIRKTTIRKDAGKPLSGILFLARA
                     KA"
     gene            477406..478017
                     /locus_tag="Atu0490"
                     /old_locus_tag="AGR_C_867"
     CDS             477406..478017
                     /locus_tag="Atu0490"
                     /old_locus_tag="AGR_C_867"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86303.2"
                     /translation="MWSSDPARHAPVEDVQGIVTGAIVSALGFYLLAKVGLLTGGTAG
                     VAFLLHYAFGISFGLLFFLVNLPFYYLSFRRLGLAFSCKTFIAIGLVSVLTEVEARWM
                     VIDSINPLWAALLGGLLLGYGLLALYRHRASLGGIGILAIYIQDRFGIRAGLIQLAFD
                     ACVMLCAFLVIDPATVAYSIVGAFVLNIFLAINHRSDRYIVVR"
     gene            478100..478741
                     /locus_tag="Atu0491"
                     /old_locus_tag="AGR_C_869"
     CDS             478100..478741
                     /locus_tag="Atu0491"
                     /old_locus_tag="AGR_C_869"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86304.2"
                     /translation="MDDTSARRRLNLWTSAPDRHSLLEDAQAILAGSMLISLGVTLFS
                     AAGLLTGGVVGLAFLAHYASGFSFGAVFFLANLPFYYLAFRRLGLAFTVKTFCAIATT
                     ALLSEYMPGFFAFESINPIAAALFGGLTVAAGMLALFRHRTSLGGFGILALYLQDRFG
                     WRAGLVQLAFDGMVLGCSFFVATPFVILCSILGALVMNLTLAVNHRNDRYIAM"
     gene            complement(478768..479229)
                     /locus_tag="Atu0492"
                     /old_locus_tag="AGR_C_871"
     CDS             complement(478768..479229)
                     /locus_tag="Atu0492"
                     /old_locus_tag="AGR_C_871"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86305.2"
                     /translation="MKTRINYAKASPEAFKAVMALENYVQSSGLEHRFIHLIKLRASI
                     INGCAFCVDMHVKESRHDGLSEQWINLMSVWRESPVYTEQERALLGWVDAVTKIAETG
                     APDDAFETLRAHFSDEEIVKITVAIGAINTWNRIAVGFRSQHPVEAAAKAA"
     gene            complement(479337..479840)
                     /locus_tag="Atu0493"
                     /old_locus_tag="AGR_C_872"
     CDS             complement(479337..479840)
                     /locus_tag="Atu0493"
                     /old_locus_tag="AGR_C_872"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86306.2"
                     /translation="MKLGDGVEQAIHSVSMLAGLSEGGVLSAAALAEFHGVSTSYLLK
                     HLQSLSNAGIVTTVPGPKGGYRLARTTDKITLLDIVLAVEGPQPAFRCAEIRQRGPNP
                     LPGRYFTKPCGINAAMLKAEKVYRAELAKTSIADILGDLAANDDGGIAARGCAFLDMN
                     ERKTTTR"
     gene            480100..482478
                     /gene="lhr"
                     /locus_tag="Atu0494"
                     /old_locus_tag="AGR_C_874"
     CDS             480100..482478
                     /gene="lhr"
                     /locus_tag="Atu0494"
                     /old_locus_tag="AGR_C_874"
                     /codon_start=1
                     /transl_table=11
                     /product="large atp-dependant helicase-related protein"
                     /protein_id="AAK86307.2"
                     /translation="MLLIAPTGAGKTLGGFMASLTDLAERGKVPPGSGFVGVHTLYIS
                     PLKALAVDIERNLTRPVSEMGLPIVIETRTGDTPQAKRQRQKVKPPDILLTTPEQVSL
                     LLANKEAERFFRDLKYVVLDELHSLVTSKRGHLLSLALARVRRHAPDVRFIGLSATVA
                     EPMDLRRYLAPQGQGEPPAGLITVEGGAKPDISILHTEERIPWSGHSARYAGKDLYEA
                     LKQHQTTLVFVNTRSQAERVFQELWTVNDDNLPIALHHGSLDAGQRRRVEAAMAENKL
                     RAVVATSTLDLGIDWGDVDLVVHVGAPKGASRLAQRIGRSNHRMDEPSKAILVPANRF
                     EVMECRAALDANYIGAQDTPPIAEGALDVLAQHVLGMACAEPFDADELYREVTSASPY
                     ANLPRATFDRVVDFTATGGYALRTYERYARIRQMKDGRWRVSNPAVAQQYRLNLGTIV
                     EAAELNVRMVKRNAKGTVGRGGMSLGKVEEYFLEQLVQGDTFLFAGKVLRFEGIRENE
                     CLVSQAFSMDPKIPSYAGGKFPLSTYLADQVRSMLADPARWQALPDQVRDWLEIQKEK
                     SIIPKRDELLVETFPFRKRFFMVMYPFEGRLAHQTLGMLLTRRLERAGAKPMGFVATD
                     YSLAIWAMEDIGMRLKSRRLSLADLLDEDMLGDDLEAWLDESFMLKRTFRNCAVISGL
                     IERRHPGKEKTGRQVTVSADLIYDVLRSHEPDHILLEATRRDAAAGLLDIGRLGDMLK
                     RIKGHTTHRALEHVSPLAVPVMLEIGRETVAGEAMDDVLAEAADELIAEAMS"
     gene            482513..483241
                     /locus_tag="Atu0495"
                     /old_locus_tag="AGR_C_876"
     CDS             482513..483241
                     /locus_tag="Atu0495"
                     /old_locus_tag="AGR_C_876"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86308.1"
                     /translation="MLSRLTLSDRFSNGFECLGSETAIHGVAAWCDPLGGLYLPDLSL
                     LVVSDLHLEKGAAFARRGRMLPPYDTIATLKILSSLVSRYDPKIVVSLGDNFHDRVGS
                     QHLPLPLRELIREMARGREWIWINGNHDPDGTVDLPGSSVDEMFYGNLVFRHEPKVGE
                     AAGEIAGHLHPSATVRRREKTVRRPCFATDGSRLLMPAFGVMSGGLDLRHQAMRGLFD
                     HTALVAHLMGRDRIYSVRFSNLLG"
     gene            complement(483264..483701)
                     /locus_tag="Atu0496"
                     /old_locus_tag="AGR_C_878"
     CDS             complement(483264..483701)
                     /locus_tag="Atu0496"
                     /old_locus_tag="AGR_C_878"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86309.2"
                     /translation="MFKHILIPTDGSPLAQIAIDQGFALAREAGAKVTVVTVSEPFHV
                     IASDVEDIAAIAEEEFHRCEEAEHLLRDTQAHAAAMGLDCEALLARAGRPDEAIIEIA
                     DRTGCDLIAMASHRRRSFIEMLLGSVTAKVLKNSKIPVLVYRQ"
     gene            complement(483859..484650)
                     /locus_tag="Atu8130"
                     /old_locus_tag="AGR_C_880"
     CDS             complement(483859..484650)
                     /locus_tag="Atu8130"
                     /old_locus_tag="AGR_C_880"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK86310.2"
                     /translation="MPFLAFGETASAQTPPLALPPGPQQRPLQENIEIGASTTEIPIA
                     SDFRGADFTLFGALNNTDQLLLAIGQYDIVVTLEGPSDYMTVRKKQRVAGIWINTSAI
                     TFTPLPESYSMASTRNINDVASPGTLRAMGLGVDHLSLKSAVFSGVPDNVFDFQEAYR
                     RLKLSSGIYRNDTTGVRLERTGLFWATLRLPANVPNGVHTARAYLFKSGKFIAQRELK
                     LRVVKTGMEQAITDAAHQTPLAYGALCVLLAVVTGWGASIIFRKD"
     gene            complement(484683..485609)
                     /locus_tag="Atu0498"
                     /old_locus_tag="AGR_C_881"
     CDS             complement(484683..485609)
                     /locus_tag="Atu0498"
                     /old_locus_tag="AGR_C_881"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86311.2"
                     /translation="MTVYLPIAELSVNIFIILGMGAAVGFLSGMFGVGGGFLITPLLI
                     FYNIPPVVAVATGANQVVASSVSGSITHFRRGTLDIKLGTVLLVGGLVGATVGVWIFS
                     FLRSIGQLDLIVSLLYVILLGTVGTLMLKESISALRRAARNETVTLRRPGHHNWVHRL
                     PLKMRFKKSKIYLSIIPIVALGFGIGILTSIMGVGGGFIMVPAMIYLLRIPTSVVVGT
                     SLFQIIFVTAYTTVVQAATNYSVDVVLAFILMVAGVIGAQYGVRVGQKLRGEQLRALL
                     ALLVLAVALRLAVSLVVRPEDLFSVAVGGLGY"
     gene            complement(485874..489620)
                     /locus_tag="Atu0499"
                     /old_locus_tag="AGR_C_883"
     CDS             complement(485874..489620)
                     /locus_tag="Atu0499"
                     /old_locus_tag="AGR_C_883"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86312.2"
                     /translation="MNGLRSKTQQPSDRSSLDALNRTIEGLEARIEGLMSQKFPREPR
                     AASSQPEPKNEAYAAPREPRAAVTPPQLDPVNEIRQRQRLLEASFQRPQEPVARPERT
                     ITRPLAPEYGSRDTQQTAAPAPRARAIPPYQEQQRNDAALQEIAQALVNLRHELKHDI
                     AEGVAREAQGLRAEIRNIRAVAEDQQFIGDLRDDIARLAGSIDQLGNLASPDAYGLRN
                     EFEDLRLTIDQLAREDSVHRIESRWNNVEDTLRGFDAASLQDEIVSLAYRLDDIKTQL
                     GGMSNNPAVRVLEEKLITIASAVEQLGKHMQPNEAAFTEQFSGLDQRLDEISRAIAAT
                     GTRANAQATDNALAQRLETRLNGLAEQLGDINRLAAIKPEPAPDLTARLEALSGKIDE
                     LSTARDAAQLHDRLDQLSLLLERSQRPTQQAELTSFLSDISRKIDALDHGAINDGLAE
                     RLDLLSRRIEDLDYRYSQPQPASGLSDSAFSRLEERLGTIAARLDETAHAAPADSRAL
                     ASLENQIAHLSTLISQPVQVQAAGISPELDVRMAAIEDYMASNDEYIIEAARQAAEAV
                     LDAYTRNNLSAGANLADMTMLTDLATDLRSLEALSRNTEERTHRTFEALHETLVQIAG
                     RLDNLDSAPAYRQDAPRNVAQHMVAASREDAAMPAAVFPADGYIAEEQAILDDVSEND
                     ATAIVPPAAAKPAKAERKSLLAGLTKRFKTSTAKPAKAKEEPVSASSARTQVEPAPSL
                     DPIDVLPAGQENELLEPGSGAPDIKKILERVRASQVAGAGKAADAEGRTDFIAAARRA
                     AQAAAMETSPEKLDTGKKSRKADTSALSRYRRPLLLGIGAILLAMMAMPLVKTLIGGA
                     EAPAPVIEQKTDQGPVSALPETDDKAVTIPSGLAIDPEQAASADSIENAAPAQNIIDN
                     RTIGGAPLPDEPPVADVPAVDPAKSDTVAQNEGPKPTEVATTTIPAQDTIVVPAGIEP
                     ASLAEAAAKGDTQALFEIAARYTDGRGVTADRAEAAKWYKMAADRGLAPAQYRLANLY
                     EKANGVERNLVEAKRYYTLAAEQGNAGAMHNLAVLLASDAAGQPDFATSAQWFIKASE
                     LGVRDSQFNLAILYARGSGVKQDIEESYKWFAIAAKDGDADAAQKRDEVAGAMSPQQL
                     QSAKAKVDAWKVKPLSDDANSVNPPEEWAGKEGVKTASVDMEKAIRNIQAILNKNGFD
                     AGQPDGKLGKNTVTAIRDFQKSVGQTPDGRITNDLVTALLARNK"
     gene            489550..489831
                     /locus_tag="Atu0500"
                     /old_locus_tag="AGR_C_884"
     CDS             489550..489831
                     /locus_tag="Atu0500"
                     /old_locus_tag="AGR_C_884"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK86313.1"
                     /translation="MVRLSASRDDLSLGCWVFDRNPFIFSLASLPPAVPGFLSRRCLS
                     RQAVAATCRNSRAGICPLGGKCAAERSSYLLSENSRNVVKKWLTMVGIF"
     gene            489997..491793
                     /gene="acd"
                     /locus_tag="Atu0501"
                     /old_locus_tag="AGR_C_885"
     CDS             489997..491793
                     /gene="acd"
                     /locus_tag="Atu0501"
                     /old_locus_tag="AGR_C_885"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="AAK86314.2"
                     /translation="MPVYKAPVKDTLFILNDVLGLERYNNLPGFEDATPDMIEAITGE
                     AAKLAEERLFPLNLSGDQQGCKRADDGSVSVPDGFKAAYDAYCEGGWIGLAVPSEFGG
                     QGLPYTLHAAIGEYMSSANLSLMMYPGLTQGAIAAVLVHGTQEQKETYLPKMVEGTWS
                     GTMNLTEPHCGTDLGLLRTKAVPQGDGSYKISGQKIFISAGEHSMTDNIVHLVIARIE
                     GAPEGTKGISLFIVPKFLVKEDGTLGERNGVTCGAIEHKMGIHGNATCVMNYDDATGY
                     LLGAENKGLSAMFVMMNEARLGVGLQGLSVGEIAYQNAVEYARDRIQGRSLSGAKFPD
                     KKADPIIVHPDIRRTLMTIKAYNEAGRAFLLWTALQSDIAHRAADEKQRQAADDLLGL
                     VTPILKGVLTDKGFDHAVMAQQVFGGHGYIEEHGMSQYVRDARITMIYEGANGIQALD
                     LVGRKLGMNGGRAVMALFKEIGDFCEENRADEKLSLYTKGLKKGLNDLQAATMWFMQN
                     AMAKPDNAGAGSTDYMHLFGIVVLGYMQALMAKAASEALAAGSTSDEDFLKTKLVTAK
                     FYMERIMPETALRKARIETGADTMMELAAEAF"
     gene            491832..493040
                     /locus_tag="Atu0502"
                     /old_locus_tag="AGR_C_886"
     CDS             491832..493040
                     /locus_tag="Atu0502"
                     /old_locus_tag="AGR_C_886"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="AAK86315.1"
                     /translation="MTDVYIYDHVRTPRGRGKKDGSLHEVPSVRLAAKTLEAIRDRNG
                     LDTSAVDDIIMGCVDPVMDAGAVIPKAAAFEAGYSNRAPGMQISRFCASGLDAINFAA
                     GKVKAGSDDIVIAGGVESMSRVGMGMSGGAWYMDPSVNFPAFFMPQGVSADLIATKYG
                     FSRDDVDAYAVESQKRAAHAWENGYFNKSVIPVKDQNGLTILDRDEHMRPGTDMQALA
                     SLNPSFQMPGEMGGFEAVGIMAHPEVERINYVHHAGNSSGIVDGAAAVLVGSKAGGEA
                     MGVKPRARIKAFANIGSDPALMLTGPVDVTEKLLKKTGMSIADIDLFELNEAFAAVVL
                     RYMQAFDISHDRMNVNGGAIAMGHPLGATGAMILGTVLDELERRDLNTALVTLCIGAG
                     MGTATVIERV"
     gene            493225..495441
                     /gene="fadB"
                     /locus_tag="Atu0503"
                     /old_locus_tag="AGR_C_888"
     CDS             493225..495441
                     /gene="fadB"
                     /locus_tag="Atu0503"
                     /old_locus_tag="AGR_C_888"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="AAK86316.1"
                     /translation="MSTYTNFTIETDADGIALVTWDMPEKSMNVFTAEVLEELNAIVD
                     ATVADGAVKGVVFTSGKSSFSGGADLSMLKSMFALYNDEKAKSPDAAAAKLFELVGRM
                     TGLFRKIETNGKPWVSAINGTCMGGAFELSLACHGRVASSAKSLKIALPEVKVGIFPG
                     AGGTQRVSRLTDAQSALQMMTTGQSLTGARAKAMGLVHQVVEPDQLVATAKQMIKDGL
                     KPVAPWDEKGFKAPGGGIWTPAAAQLWPAAPAILRRESAGNYPAALAILKCVYEGLQL
                     PFDTALKVEQRYFTEILRSKEAFGMIRSLFISMQELNKGARRPAGQPKTEFKKVGVVG
                     AGFMGAAVAYVTAAAGIPVTLVDRDQDAADKGKGHCEESVKAAIGKGRLTQEEGKALL
                     DLVTPTSDYATLADADLVIEAVFEDRDVKKAVIEAVEAVLPEGAIFASNTSTLPITGL
                     AKNSKRPADFIGIHFFSPVEKMMLTEVILGKETGDKALAVALDYVAKIRKTPIVVNDT
                     RGFFVNRCVLRYMAESYDMLIEGVPAAMIENAAKFAGMPVGPLALNDEVAIDLSYKIL
                     KATVADLGEKAVDPRHMELVKKLVEGDGRFGRKNAKGFYDYPPKPAKKSLWPGLKDLY
                     PQQKPEDVDMDVLKQRFLVTVALEAARTVEEGIVTDPREADVGSILGFGFAPYTGGAL
                     SYIDGMGVKNFVALAEKLSEAYGPRFQPTPLLKDMAAKGETFYGRFDPYASAAKAA"
     gene            495598..496029
                     /locus_tag="Atu0504"
                     /old_locus_tag="AGR_C_891"
     CDS             495598..496029
                     /locus_tag="Atu0504"
                     /old_locus_tag="AGR_C_891"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK86317.2"
                     /translation="MKAPLRSHGFDKPSDLDDHLAELDEEAEAIAAEAKTEKTAVKRT
                     RASHAIDPSLRAELEELRKQLDKIRRDVKRLEAAQYPRHRPAQLHHERDRENSRLMTV
                     VRSVAVTSLASRIFASSPVMAALVAVVPFALGLAARRSEGS"
     gene            496071..496277
                     /locus_tag="Atu8010"
                     /old_locus_tag="AGR_C_892"
     CDS             496071..496277
                     /locus_tag="Atu8010"
                     /old_locus_tag="AGR_C_892"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAK86318.1"
                     /translation="MRDPCGDRMCQLRLMPEGGVPCNPAFAGRAFQPSTGAVKKLSKN
                     FAMALAMSEQDVITPLTFGAPKQP"
     gene            496313..496388
                     /locus_tag="Atu0505"
     tRNA            496313..496388
                     /locus_tag="Atu0505"
                     /product="tRNA-Phe"
     gene            496545..497132
                     /locus_tag="Atu0506"
                     /old_locus_tag="AGR_C_894"
     CDS             496545..497132
                     /locus_tag="Atu0506"
                     /old_locus_tag="AGR_C_894"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="AAK86320.2"
                     /translation="MDCVANPTLLPHDIMYFDGFLSSEDEAFVADRLDAGEWSTELKR
                     RVQHFGYRYDYKVRAVTPDAYLGPLPPWLGLFAERLVADGYCRTVPDQVIANEYLLGQ
                     GISAHVDCVPCFDDTIVSISLLSACEMVFRDLRGPGIRSVLHPRSGVLLRGSSRYDWT
                     HEIPARKSDIVNGVKTARSRRISLTFRKVLGLKRP"
     gene            complement(497142..497486)
                     /gene="phaG"
                     /locus_tag="Atu0507"
                     /old_locus_tag="AGR_C_895"
     CDS             complement(497142..497486)
                     /gene="phaG"
                     /locus_tag="Atu0507"
                     /old_locus_tag="AGR_C_895"
                     /codon_start=1
                     /transl_table=11
                     /product="potassium efflux system protein"
                     /protein_id="AAK86321.1"
                     /translation="MNNAAEFPLWAAILVAFFVLLGASLTLTGTIGFAKLNSFYERLH
                     APTLGTSWGTGGIVMASIIYFSVSGDRFAFHEIFIGIFMTVTTPVSLMLLGRAALYRD
                     RAEQNSDNREHL"
     gene            complement(497483..497764)
                     /gene="phaF"
                     /locus_tag="Atu0508"
                     /old_locus_tag="AGR_C_896"
     CDS             complement(497483..497764)
                     /gene="phaF"
                     /locus_tag="Atu0508"
                     /old_locus_tag="AGR_C_896"
                     /codon_start=1
                     /transl_table=11
                     /product="PH Adaption potassium efflux system"
                     /protein_id="AAK86322.1"
                     /translation="MSSIILFWSFSLAQLMLAIAMTISVYRIAIGPRAQDRVLGMDTL
                     YVNAMLLLLTFGLRTGNDIYFEASLLIAILGFVSTVALSKFMMRGEVIE"
     gene            complement(497761..498246)
                     /gene="phaE"
                     /locus_tag="Atu0509"
                     /old_locus_tag="AGR_C_898"
     CDS             complement(497761..498246)
                     /gene="phaE"
                     /locus_tag="Atu0509"
                     /old_locus_tag="AGR_C_898"
                     /codon_start=1
                     /transl_table=11
                     /product="phaE protein"
                     /protein_id="AAK86323.2"
                     /translation="MSRLLPYPLLTVSLIFFWLTINSFSAGHLLLGTGVALIASWAMA
                     SLRPAKPRIRNWHRLVQLILIVLYDIVRSNLSVAKIILFQRERDRKSGFLAVPLEIRD
                     PMALAVLATILTSTPGSAWLEYNSSQGTLLLHVLDDVDEAAWISLIKNRYEKLLMEIF
                     E"
     gene            complement(498246..499889)
                     /gene="phaD"
                     /locus_tag="Atu0510"
                     /old_locus_tag="AGR_C_899"
     CDS             complement(498246..499889)
                     /gene="phaD"
                     /locus_tag="Atu0510"
                     /old_locus_tag="AGR_C_899"
                     /codon_start=1
                     /transl_table=11
                     /product="pH adaption potassium efflux system protein"
                     /protein_id="AAK86324.2"
                     /translation="MSFPFHIVVAPILLPLITAALLLFFDERQRVAKAAISFTSTVLL
                     LIVAILLFREVNSTVNTEIAAVVSSGVYLLGNWPAPFGIVLVADRLSGLMVLLTALLA
                     IPSLIYSMAKWHKSGAHFHSLFQMMLMGVNGAFLTGDLFNLFVFFEVMLAASYGLLLH
                     GSGQQRVKAGLHYIAINLVAALFFLIGVSLIYGVTGTLNMGDLAHRIEGLNPDQRMLL
                     ETGAAILGIAFLVKAGMWPLNFWLPSAYGAASAPVGGLFAIMSKVGIYVIARLSFLLF
                     GQTAGESAGFGHDALLVGGIATIIFGAIGVLASQALGRLAGFSVLVSSGTLLAAMGTG
                     NPTVAAGALYYMVSSTLTISAFFMLIELVERGQDAGANVLAVTMEAYGEGEEEDEEEE
                     VGVTMPATIAVLGACFAACGILLAGLPPLSGFIAKFSMLTAILNPSGLGANDSVSTLS
                     WWLVFLIVFAGFASLVSMTRAGIRTFWASIEGTVPRVLVIEIAPIMLLLGLTLAMTIQ
                     AGPVMRYMQETARILDLPASYIQGVISAPRAGSNPEAEP"
     gene            complement(499889..500224)
                     /gene="phaC"
                     /locus_tag="Atu0511"
                     /old_locus_tag="AGR_C_902"
     CDS             complement(499889..500224)
                     /gene="phaC"
                     /locus_tag="Atu0511"
                     /old_locus_tag="AGR_C_902"
                     /codon_start=1
                     /transl_table=11
                     /product="pH adaption potassium efflux system protein"
                     /