LOCUS       T21E18                 74316 bp    DNA     linear   PLN 29-JUN-2000
DEFINITION  Sequence of BAC T21E18 from Arabidopsis thaliana chromosome 1,
            complete sequence.
ACCESSION   AC024174
VERSION     AC024174.2
KEYWORDS    HTG.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 74316)
  AUTHORS   Sakano,H., Vaysberg,M., Lee,J., Lenz,C., Liu,S.X., Pham,P.,
            Toriumi,M., Yu,G., Chin,C., Chiou,J., Choi,E., Chung,M.,
            Gonzalez,A., Howng,B., Liu,A., Altafi,H., Brooks,S., Buehler,E.,
            Chao,Q., Conn,L., Conway,A.B., Hansen,N.F., Johnson-Hopson,C.,
            Khan,S., Kim,C., Lam,B., Miranda,M., Nguyen,M., Palm,C.J.,
            Shinn,P., Southwick,A., Davis,R.W., Ecker,J.R., Federspiel,N.A. and
            Theologis,A.
  TITLE     The sequence of BAC T21E18 from Arabidopsis thaliana chromosome 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 74316)
  AUTHORS   Theologis,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-FEB-2000) Plant Gene Expression Center, 800 Buchanan
            Street, Albany, CA 94710, USA
REFERENCE   3  (bases 1 to 74316)
  AUTHORS   Theologis,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-MAR-2000) Plant Gene Expression Center, 800 Buchanan
            Street, Albany, CA 94710, USA
REFERENCE   4  (bases 1 to 74316)
  AUTHORS   Theologis,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-JUN-2000) Plant Gene Expression Center, 800 Buchanan
            St., Albany, CA 94710, USA
COMMENT     On Mar 15, 2000 this sequence version replaced AC024174.1.
            The sequence is of BAC T21E18 from Arabidopsis thaliana chromosome
            1.  The sequence does not represent the sequence of the entire
            insert of this clone because BAC T21E18 contains an E.coli
            insertion element 10 (IS10) at position 101153.  The IS10 (1329 bp
            in size) and the target site duplication (TGCATGGTC) have been
            removed from this entry.  The correct Arabidopsis sequence is
            confirmed by sequencing the PCR product from genomic DNA.  The
            sequence is also shorter by 30500 bp because we submit only the
            unique sequence of the clone.  However, in order to facilitate the
            joining of overlapping clones in the future, for creation of larger
            contigs, we provide small overlaps (200 bp) between overlapping
            sumbitted clones.  The 5' end of this sequence overlaps by 200 bp
            to the 3' end of the sequence of the clone T20M3.
FEATURES             Location/Qualifiers
     source          1..74316
                     /organism="Arabidopsis thaliana"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:3702"
                     /chromosome="1"
                     /clone="T21E18"
                     /ecotype="Columbia"
     gene            complement(512..3187)
                     /gene="T21E18.1"
     CDS             complement(join(512..649,726..821,1171..1407,1504..1680,
                     1793..2017,2089..2265,2345..2791,2840..3187))
                     /gene="T21E18.1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Contains similarity to an amino acid transporter
                     cationic 1 (Atrc1) from Mus musculus gi|6671596 and
                     contains an amino acid permease PF|00324 domain. ESTs
                     gb|AI995600, gb|AV566914, gb|AV531134 come from this
                     gene."
                     /codon_start=1
                     /protein_id="AAF80119.1"
                     /translation="MVGPIFIDLDSDYPGGDFSHRLDQSSTLKLKFPWEATKVSATNA
                     SPPPHGSLISVLQLSDLNHCPLRPRRLPFAPPLATLWFVASAFSTSYCWASALPSAPV
                     SSSSPEPSLAMLDLNRLVIIAAVACLGVTISFLLAGASCVLNALCYAELSSRFPAVVG
                     GAYMYSYSAFNEITAFLVFVQLMLDYHIGAASISRSLASYAVALLELFPALKGSIPLW
                     MGSGKELLGGLLSLNILAPILLALLTLVLCQGVRESSAVNSVMTATKVVIVLVVICAG
                     AFEIDVANWSPFAPNGFKAVLTGATVVFFSYVGFDAVANSAEESKNPQRDLPIGIMGS
                     LLVCISLYIGVCLVLTGMVPFSLLSEDAPLAEAFSSKGMKFVSILISIGAVAGLTTTL
                     LVGLYVQSRLYLGLGRDGLLPSIFSRIHPTLHTPLHSQIWCGIVAGVLAGIFNVHSLS
                     HILSVGTLTGYSVVAACVVALRLNDKKDRESSNRWTSSWQEGVICLVIIACSGFGAGV
                     FYRFSASVIFILLSVGVAVVASAVLHYRQAYALPLGSGFSCPGVPIVPSVCIFFNIFL
                     FAQLHYEAWIRFVVVSVLATAVYALYGQYHADPSMLDYQRAPETESDA"
     gene            complement(3720..14207)
                     /gene="T21E18.2"
     CDS             complement(join(3720..3871,3963..4029,4099..4253,
                     4334..4400,4516..4731,4814..5026,5111..5264,5380..5490,
                     5685..5832,5910..6345,6454..6612,7193..7238,7632..7783,
                     7883..8083,8166..8300,8369..8509,8653..8847,8960..9108,
                     9653..9728,10019..10168,10310..10663,10755..10904,
                     11597..11886,11980..12176,12281..12435,12533..12580,
                     13074..13202,13291..13405,13594..13709,13806..13880,
                     14073..14207))
                     /gene="T21E18.2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Contains similarity to an unknown protein T11A7.7
                     gi|2335096 from Arabidopsis thaliana BAC T11A7 gb|AC002339
                     and contains a tropomyosin PF|00261 domain. ESTs
                     gb|AI995205, gb|N37925, gb|F13889, gb|AV523107,
                     gb|AV535948, gb|AV558461, gb|F13888 come from this gene."
                     /codon_start=1
                     /protein_id="AAF80120.1"
                     /translation="MGVMSRRVLPACGNLCFFCPSLRARSRHPVKRYKKMLAEIFPRN
                     QEAEPNDRKIGKLCEYASRNPLRIPKITEYLEQKCYKELRNGNIGSVKVVLCIYKKLL
                     SSCKEQMPLFSCSLLSIVRTLLEQTKEEEVQILGCNTLVDFISLQTVNSHMFNLEGLI
                     PKLCQLAQEMGDDERSLQLRSAGMQALAFMVSFIGEHSQLSMDLDMIISVILENYMDL
                     EKGQEDTKEVDQISDTKIPNMTKKVSFKPNPVTDYKLENMDISKSPSYWSMVCLCNIA
                     KLAKETTTVRRVLEPLLTAFDSGDYWSPQKGVASSVLLFLQSRLEESGENCHVLVSSL
                     IKHLDHKNVIKQQGLQINMVNVATCLALHAKQQASGAMTAVIADLIKHLRKCLQNAAE
                     SDVSVDKTKQNSDLQHALENCIAELSNKVGDAGPILDMFAVVLETISTNVVLSRTTAS
                     AILRAAHIVSVVPNVSYHKKVFPDALFHQLLLAMSHADCTTRVEAHNIFSVVLLGTLR
                     LPWSDQHKETSEAVSGSLSVDGICTVRNQEEEKEKVEKSLNSELCKDVNHISRPSVSG
                     QTSQQLSCQSLDSLKDLDDGIKSLCSLRLSSHQVNMLLSSLWIQATSTDNTPENFEAM
                     ASTYQITLLFSLAKRSNHMALVQCFQLAFSLRNLSLNQDDFWYNVEGGMQHSRRRSIF
                     TFASYMLIFGAKISNILELVPIIKESLTAQMVDPYLVLEGDIRLRAVCSGFPQEETYG
                     SDKDDSAALNSSVIVTDDRRLKEIVITHFTSKLQTLSEEEQLNLRKEIQSDFSLDDAH
                     SLGGQLFTDTPGPSSPLNQTELPAFEEVELSDIAAFEGISPGASGSQSGHRTSLSTNT
                     NPVDVLSVNELLESVSETARQVASLPVSSIPVPYDQMMNQCEALVTGKQQKMSVLRSF
                     KPQATKAITSEDNEKDEQYLLKETEEAGEDDEKAIIVADVQPQGQLGFFSQEVPQNSF
                     RLPPSSPYDKFLKAAGVKNCGRVWSVNVLCLEVDCSLPVTKTTDSCPTEDAIRALLES
                     LVDPLLPSKPTDDLPSTSIRESVAKQVHAVVLLYNYYHRKDNPHLECLSFESFRSLAT
                     VMKPALLQHLKEDGGVSGQTVLLEKVIVDACSLSMSLDASSDLFILNKCPIRRVAVLL
                     VDSEKKSCYLQHSSITQGVWSLLEKPIEKEKAARENQKEEGVFQKVAFAVVKEATGVN
                     HKDIVILERHLVCSLSEEKTAVRFYIMKCTSQDKFSGENPVEEVLSCMQGPLFEKSFS
                     DWTMNSIVEYFHVLPYATLIEDWFSRRGDTEFVIEKEPEAVCDDIESNKVDATKESEV
                     SDIFERREKAALKRRYEIKAKKVAALLSHPGARGKATTRLQNRYLKGSMSGAKEPNVH
                     SETVVALKAKNVGNEMSPCKDNYSNGEKGGFEVASDPKELKERGLQRKKAVPDRLNSI
                     HKLNSTPASAHNSNPNLEELQTSLLSKATSLSETALKVLLCKRDKLTRQQRNIEDEIA
                     KCDKCIQNIKGDWELQLETVLECCNETYPRRNLQESLDKSACQSNKRLKLSETLPSTK
                     SLCQRLDDICLMNNWVLPNYRVAPSDGGYEAEVRITGNHVACTIHGEEKSDAEEARES
                     AAACLLTKLQHDTAANLS"
     gene            complement(15400..16138)
                     /gene="T21E18.3"
     CDS             complement(join(15400..15555,15692..16138))
                     /gene="T21E18.3"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Contains similarity to a hypothetical protein
                     CAA30377.1 gi|5777619 from Oryza sativa BAC q3037-207F1
                     gb|AJ245900."
                     /codon_start=1
                     /protein_id="AAF80121.1"
                     /translation="MATPEEVAYEKFLERVRRTVYVDELTPLATAPVISSAFNQFGTV
                     KKVSFIPNYLGPKELPMGVLVEMENEEMTQAVISTVSQLPFMVAGMPRPVRACAAEPN
                     MFVDKPKKPGRTVRFRWIKPNDPDFDKARRVKRLARKHSAENSFMLKKQLEEAEKLSK
                     QQAETAVTHHKKFEMMDKLLYDGVAQKLAGRYDLKGFPYR"
     tRNA            16547..16618
                     /product="tRNA-Thr"
                     /note="codon recognized: ACA"
     gene            17735..18187
                     /gene="T21E18.4"
     CDS             17735..18187
                     /gene="T21E18.4"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Contains similarity to a calcium-binding protein
                     from Lotus japonicus gi|6580549 and contains a EF hand
                     PF|00036 domain. EST gb|T46471 comes from this gene."
                     /codon_start=1
                     /protein_id="AAF80122.1"
                     /translation="MDPTELKRVFQMFDKNGDGTITGKELSETLRSLGIYIPDKELTQ
                     MIEKIDVNGDGCVDIDEFGELYKTIMDEEDEEEEDMKEAFNVFDQNGDGFITVDELKA
                     VLSSLGLKQGKTLDDCKKMIKKVDVDGDGRVNYKEFRQMMKGGGFNSL"
     gene            complement(19642..20949)
                     /gene="T21E18.5"
     CDS             complement(19642..20949)
                     /gene="T21E18.5"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Contains similarity to UDPG glucosyltransferase
                     from Solanum berthaultii gi|2232354 and contains
                     UDP-glycoronysyl and UDP-glucosyl transferases PF|00201
                     domain. ESTs gb|AV551176, gb|Z46581, gb|AV439781,
                     gb|AV542358, gb|AV525326, gb|AV538963, gb|Z46580,
                     gb|AV547292, gb|AV532314, gb|AV565317, gb|AV542340 come
                     from this gene."
                     /codon_start=1
                     /protein_id="AAF80123.1"
                     /translation="MTTTTTKKPHVLVIPFPQSGHMVPHLDLTHQILLRGATVTVLVT
                     PKNSSYLDALRSLHSPEHFKTLILPFPSHPCIPSGVESLQQLPLEAIVHMFDALSRLH
                     DPLVDFLSRQPPSDLPDAILGSSFLSPWINKVADAFSIKSISFLPINAHSISVMWAQE
                     DRSFFNDLETATTESYGLVINSFYDLEPEFVETVKTRFLNHHRIWTVGPLLPFKAGVD
                     RGGQSSIPPAKVSAWLDSCPEDNSVVYVGFGSQIRLTAEQTAALAAALEKSSVRFIWA
                     VRDAAKKVNSSDNSVEEDVIPAGFEERVKEKGLVIRGWAPQTMILEHRAVGSYLTHLG
                     WGSVLEGMVGGVMLLAWPMQADHFFNTTLIVDKLRAAVRVGENRDSVPDSDKLARILA
                     ESAREDLPERVTLMKLREKAMEAIKEGGSSYKNLDELVAEMCL"
     gene            22494..22817
                     /gene="T21E18.6"
     CDS             join(22494..22605,22645..22817)
                     /gene="T21E18.6"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="EST gb|AV534270 comes from this gene."
                     /codon_start=1
                     /protein_id="AAF80124.1"
                     /translation="MGREKSPGLKILWVWTIGTAASMILFLTFTEFRHEIILLVTSVV
                     RTRMQDMQTMMNQNQEQAPKENQNGSAGDSSVLMDETVLPESDREIAEKL"
     gene            23695..25248
                     /gene="T21E18.7"
     CDS             join(23695..24096,24461..24793,24872..24988,25063..25248)
                     /gene="T21E18.7"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Contains similarity to a fructokinase from
                     Lycopersicon esculentum gi|1915974 and is a member of the
                     pfkB carbohydrate kinase family PF|00294."
                     /codon_start=1
                     /protein_id="AAF80125.1"
                     /translation="MASSTGEKGLIVSFGEMLIDFVPTVSGVSLSESPGFLKAPGGAP
                     ANVAIAVSRLGGRAAFVGKLGDDDFGHMLAGILRKNGVDDQGINFDEGARTALAFVTL
                     RSDGEREFMFYRNPSADMLLRPDELNLELIRSAKVFHYGSISLITEPCRSAHMKAMEV
                     AKEAGALLSYDPNLREPLWPSPEEARTQIMSIWDKADIIKVSDVELEFLTENKTMDDK
                     TAMSLWHPNLKLLLVTLGEKGCTYFTKKFHGSVETFHVDAVDTTGAGDSFVGALLQQI
                     VDDQSVLEDEARLRKVLRFANACGAITTTKKGAIPALPTDIEALSFLKDQKKRQTNLK
                     FSKWCCTASPC"
     gene            26027..27277
                     /gene="T21E18.8"
     CDS             join(26027..26431,26521..26853,26945..27061,27143..27277)
                     /gene="T21E18.8"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Contains similarity to a fructokinase from Solanum
                     tuberosum gi|585973 and is a member of the pfkB
                     carbohydrate kinase family PF|00294."
                     /codon_start=1
                     /protein_id="AAF80126.1"
                     /translation="MTSSNGDNKGLVVSFGEMLIDFVPTESGVSLSESSGFLKAPGGA
                     PANVAIAVSRLGGRAAFVGKLGDDEFGHMLAGILRKNDVDDQGINFDKGARTALAFVT
                     LRSDGEREFMFYRNPSADMLLRPDELNLELIRSAKVFHYGSISLITEPCRSAHMKAME
                     VAKEAGALLSYDPNLREPLWPSPEEARKQIMSIWDKADIIKVSDVELEFLTGNKTIDD
                     ETAMSLWHPNLKLLLVTLGENGCRYYTKDFHGSVETFHVDAVDTTGAGDSFVGALLNQ
                     IVDDQSVLEEEERLRKVLRFANACGAITTTKKGAIPALPTDCEALSFLKIQVE"
     gene            complement(27809..28806)
                     /gene="T21E18.9"
     CDS             complement(join(27809..28051,28134..28454,28624..28806))
                     /gene="T21E18.9"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Identical to salt-tolerance protein from
                     Arabidopsis thaliana gb|X95572 and is a member of the
                     Constans zinc finger family PF|01760. ESTs gb|AV526483,
                     gb|AV527296, gb|BE038943, gb|AI995008, gb|H36917,
                     gb|BE038755, gb|N38572, gb|AV560515, gb|AV559505,
                     gb|AV543507, gb|AV542266, gb|AV558585, gb|AV441406,
                     gb|AV520315, gb|AV519515, gb|AV563886, gb|AV560014,
                     gb|AV521968, gb|N95904, gb|N96557 come from this gene."
                     /codon_start=1
                     /protein_id="AAF80128.1"
                     /translation="MKIQCDVCEKAPATVICCADEAALCPQCDIEIHAANKLASKHQR
                     LHLNSLSTKFPRCDICQEKAAFIFCVEDRALLCRDCDESIHVANSRSANHQRFLATGI
                     KVALTSTICSKEIEKNQPEPSNNQQKANQIPAKSTSQQQQQPSSATPLPWAVDDFFHF
                     SDIESTDKKGQLDLGAGELDWFSDMGFFGDQINDKALPAAEVPELSVSHLGHVHSYKP
                     MKSNVSHKKPRFETRYDDDDEEHFIVPDLG"
     gene            complement(29873..31286)
                     /gene="T21E18.10"
     CDS             complement(join(29873..30827,31285..31286))
                     /gene="T21E18.10"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Contains similarity to an unknown protein T1B3.16
                     gi|4432844 from Arabidopsis thaliana BAC T1B3 gb|AC006283.
                     ESTs gb|AI992784, gb|T45131, gb|AA586122 come from this
                     gene."
                     /codon_start=1
                     /protein_id="AAF80127.1"
                     /translation="MFSQDMAGSVGEETEPEWIKRVKLEGAVPCLKPDDNCKNGWTTP
                     SPDTFMVRGPKYFSDKVKIPAGDFLLKPLGFDWIKGPKKLSEILSYPSSRIRKVIDEE
                     FQKDGTKPFVWAFNLQLPHKDNYSAVAYFVTTEPILEGSLMDRFLKGDDGFKKSRLKL
                     IANIVKGPWIVRKAVGEQAICVIGRALSCKYVSGENFVEIDVDIGSSMVASAIVHLAF
                     GYVTTLTVDLAFLIESQTEAELPEKLLGAVRFSELQTESATSIELSSSTSNDQWDQTT
                     SERSSWWKSIGNGFSNLLNQDTANMNNTSHGDIQKDEHVQKQ"
     gene            32218..33663
                     /gene="T21E18.11"
     CDS             join(32218..32244,32567..32708,32802..32949,33033..33108,
                     33216..33327,33422..33513,33619..33663)
                     /gene="T21E18.11"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Contains similarity to an unknown protein product
                     from Homo sapiens gi|7020818. ESTs gb|T45317, gb|AV561025,
                     gb|AV524849 come from this gene."
                     /codon_start=1
                     /protein_id="AAF80129.1"
                     /translation="MDPRQFEHTVVADNDIHSIVMSYLLHNCFNETADSLASSTGVKQ
                     PAIDRDNMERRKQIIHFILERKALKAFELTEQLAQDLLEKNKDLQFDLLCLHFVELIC
                     AGNCTEALKFGKTRLAPFGKVKKYVEKLEDVMALLAYEDPEKSPMFHLLSSEYRQQVA
                     DNLNRTILEHTNHPSYTPMERIIQQVTVVRQYLTEENGKDAFPPFSLKDSLKG"
     gene            complement(34348..36263)
                     /gene="T21E18.12"
     CDS             complement(join(34348..34754,35092..35176,35261..35393,
                     35617..36263))
                     /gene="T21E18.12"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Contains similarity to a b-Zip binding protein from
                     Arabidopsis thaliana gb|Z86093 and contains a b-Zip
                     transcription factor PF|00170 domain. ESTs gb|AV551499,
                     gb|T04752, gb|AV550784, gb|AV550336, gb|AV545846,
                     gb|AV538486, gb|AV542369, gb|AV538179 come from this
                     gene."
                     /codon_start=1
                     /protein_id="AAF80130.1"
                     /translation="MDKEKSPAPPPSGGLPPPSGRYSAFSPNGSSFAMKAESSFPPLT
                     PSGSNSSDANRFSHDISRMPDNPPKNLGHRRAHSEILTLPDDLSFDSDLGVVGAADGP
                     SFSDDTDEDLLYMYLDMEKFNSSATSTSQMGEPSEPTWRNELASTSNLQSTPGSSSER
                     PRIRHQHSQSMDGSTTIKPEMLMSGNEDVSGVDSKKAISAAKLSELALIDPKRAKRIW
                     ANRQSAARSKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRDTNGLGVENNELKLR
                     VQTMEQQVHLQDALNDALKEEVQHLKVLTGQGPSNGTSMNYGSFGSNQQFYPNNQSMH
                     TILAAQQLQQLQIQSQKQQQQQQQHQQQQQQQQQQFHFQQQQLYQLQQQQRLQQQEQQ
                     SGASELRRPMPSPGQKESVTSPDRETPLTKD"
     gene            42808..45240
                     /gene="T21E18.13"
     CDS             join(42808..43137,43776..43916,43993..44133,44249..44355,
                     45042..45240)
                     /gene="T21E18.13"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Contains a very strong similarity to delta 9
                     desaturase mRNA from Arabidopsis thaliana gb|D88536 and
                     contains a fatty acid desaturase PF|01069 domain. EST
                     gb|Z30750 comes from this gene."
                     /codon_start=1
                     /protein_id="AAF80131.1"
                     /translation="MSLSASEKEENNKKMAADKAEMGRKKRAMWERKWKRLDIVKAFA
                     SLFVHFLCLLAPFNFTWPALRVALIVYTVGGLGITVSYHRNLAHRSFKVPKWLEYFFA
                     YCGLLAIQGDPIDWVSTHRYHHQFTDSDRDPHSPNEGFWFSHLLWLFDTGYLVEKCGR
                     RTNVEDLKRQWYYKFLQRTVLYHILTFGFLLYYFGGLSFLTWGMGIGVAMEHHVTCLI
                     NSLCHVWGSRTWKTNDTSRNVWWLSVFSFGESWHNNHHAFESSARQGLEWWQIDISWY
                     IVRFLEIIGLATDVKLPSESQRRRMAMVR"
     gene            47068..48647
                     /gene="T21E18.14"
     CDS             join(47068..47379,47463..47603,47736..47876,48256..48362,
                     48449..48647)
                     /gene="T21E18.14"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Contains similarity to delta 9 desaturase mRNA from
                     Arabidopsis thaliana gb|D88536 and contains a fatty acid
                     desaturase PF|01069 domain. ESTs gb|AV546954, gb|AI993202,
                     gb|AV554343, gb|T46147 come from this gene."
                     /codon_start=1
                     /protein_id="AAF80132.1"
                     /translation="MGDTTKDDGSSQSKAVRGEKRAFFFRKWTRIDIARASAVGAVHL
                     LCLLAPFNYKWEALRFGVILAIVTSLSITFSYHRNLTHKSFKLPKWLEYPFAYSALFA
                     LQGHPIDWVSTHRFHHQFTDSDRDPHSPIEGFWFSHVFWIFDTSYIREKCGGRDNVMD
                     LKQQWFYRFLRNTIGLHILTFWTLVYLWGGLPYLTCGVGVGGTIGYNGTWLINSACHI
                     WGSRAWNTKDTSRNIWWLGPFTMGESWHNNHHAFEASARHGLEWYQVDLTWYLICFFQ
                     ALGLATDVKLPTDAQKRKLAFAR"
     gene            50677..52166
                     /gene="T21E18.15"
     CDS             join(50677..50988,51104..51244,51370..51510,51759..51865,
                     51968..52166)
                     /gene="T21E18.15"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Contains similarity to delta 9 desaturase mRNA and
                     contains a fatty acid desaturase PF|01069 domain."
                     /codon_start=1
                     /protein_id="AAF80133.1"
                     /translation="MSETTKDDGSSQKKSVRKEKRAYVLRKWTQFDVGRASTVGTVHL
                     LCLLAPFNYKWEAFRFGIILAILTNLCITFSYHRNLTHRSFKLPKWLEYPFAYSALLA
                     LQGDPLDWVSIHRFHHQFTDSDRDPHSPIEGFWFSHVLWIFDTDYIREKCGRRNNVMD
                     LKQQWFYRFLKKTLVLHILAFWTLIYLWGGLPYLTWTVGFGGVIGYHGTWLVNSACHI
                     CGSQAWQTNDTSRNVWWLALLTMGESWHNNHHAFETSARHGLEWYQLDITWYLIWFFQ
                     ALGLATNVKLPTDAQKRKMAIRR"
     gene            complement(52384..54085)
                     /gene="T21E18.16"
     CDS             complement(join(52384..52462,52552..52658,52762..52980,
                     53062..53763,53882..54085))
                     /gene="T21E18.16"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Contains similarity to a F-box protein FBA from Mus
                     musculus gb|AF233226. ESTs gb|AV536237, gb|AV541425,
                     gb|AV542477, gb|AV543534, gb|AV536862, gb|AI100662,
                     gb|Z27285, gb|Z29939, gb|T21404, gb|T44511, gb|H37689 come
                     from this gene."
                     /codon_start=1
                     /protein_id="AAF80134.1"
                     /translation="MGLEDAGDLVLHIVLSKIGPENTARVACVSKRLKVSASEESLWS
                     IFCSNDLNISTPLDPHGDPAPSFKRAYQLWRESFRMYPWNLVKRVRLCWDNLKQWLTL
                     NFPEAKATLRKGVTEDDLQEFETSLKVKLPLPTRLLYRFVDGQELSSPNGLDGSLGLI
                     GGYSAYSHDVNVYLLPLKEVMRETKESFMRDLGFSSRLDLIVMAASVVASLKIFLLDC
                     TTGQLFTGTSNRQLLPCVPDALVRSVHDTNGDQQQDAMLLWLEEHGRRLQTGTINVRQ
                     QNNVKSISLFPEIPPLCSVSVTNGVQVRASSVFIPEISNLRDQPPAYWYAYSIRMSLM
                     PEGCILNGTHHSSCQLYWRHWVIRADNEVIDNVNGEAVIGKYPLLQAGEEEFVYESCS
                     SFPTTAGSIDGSFTFVPGSLRDPKGSQFEVKVVEFPLELPDYIF"
     gene            55110..56663
                     /gene="T21E18.17"
     CDS             join(55110..55421,55502..55642,55770..55910,56272..56378,
                     56465..56555,56592..56663)
                     /gene="T21E18.17"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Contains similarity to delta 9 desaturase mRNA from
                     Arabidopsis thaliana gb|D88536 and contains a fatty acid
                     desaturase PF|01069 domain. ESTs gb|AI993202. gb|T46147,
                     gb|AV554343, gb|AV539469 come from this gene."
                     /codon_start=1
                     /protein_id="AAF80135.1"
                     /translation="MGDKNKDDSSSQSKAVRKEKRAFLFRKWTRVDVMRVSAVGAVHL
                     LCLLAPFNYTWEAFRFAAMVGISTNLSITFSYHRNLTHRSFKLPKWLEYPFAYSALFA
                     LQGHPIDWVSTHRFHHQFTDSDRDPHSPIEGFWFSHVFWIFDTSYIREKCGGRDNVMD
                     LKQQWFYRFLQNTIGLHILTFWILVYLWGGLPYLTWSVGVGGAIGYHATWLINSACHI
                     WGSRAWNTKDTSRNIWWLGPFTMGESWHNNHHAFEASARHGLEWYQVLGLATDVKLPT
                     DAQKRKMSLAR"
     gene            complement(57181..62897)
                     /gene="T21E18.18"
     CDS             complement(join(57181..57333,57481..57579,57665..57739,
                     57840..57940,58476..58599,58708..58911,59127..59312,
                     59881..59908,61229..61286,61443..61750,62695..62897))
                     /gene="T21E18.18"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Contains similarity to glyoxalase II isozyme from
                     Arabidopsis thaliana gb|U90927 and is a member of the
                     Metallo-beta-lactamase seperfamily PF|00753. ESTs
                     gb|AV519053, gb|AV535897, gb|AV535667, gb|AV556046,
                     gb|BE039169, gb|AV525509 come from this gene."
                     /codon_start=1
                     /protein_id="AAF80136.1"
                     /translation="MKKQLILGVILLGLFVIFLNTTQVEAARPLQADSEIRFVFQLLQ
                     RGQVIGSGPNGCTNIPGGSGTCRPNKFTYITIIKNPRISGCVSRRRIKCPVSTQPWHL
                     GVPRGMLVQPFGPDPLTGPLCSAWNTNRISSAAVGNGLIASTCLTSKNTTKKATNITK
                     IITCLFIFLDQLLVNTSWLDFGIILTSLYISSVTDLVTWKLVSQPCVRPCVRQLHVRK
                     GLVSGVMKLFSSPLRTLRDAGKSVRISRFCSVSNVSSSLQIELVPCLTDNYAYILHDE
                     DTGTVGVVDPSEAVPVMDALQKNSRNLTYILNTHHHYDHTGGNLELKDRYGAKVIGSA
                     ADRDRIPGIDVALKDADKWMFAGHEVHIMETPGHTRGHISFYFPGARAIFTGDTLFSL
                     SCGKLFEGTPEQMLASLQRIIALPDDTSVYCGHEYTLSNSKFALSIEPTNEVLQSYAA
                     YVAELRDKKLPTIPTTMKMEKACNPFLRTENTDIRRALGIPETADEAEALGIIRRAKD
                     NFKA"
     gene            63943..65619
                     /gene="T21E18.19"
     CDS             63943..65619
                     /gene="T21E18.19"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Contains similarity to a hypothetical protein
                     F24K9.13 gi|6006885 from Arabidopsis thaliana gb|AC008153
                     and contains multiple PPR PF|01535 repeats."
                     /codon_start=1
                     /protein_id="AAF80137.1"
                     /translation="MLPVNRARALLTILSQAKTLNHTQQVHAKVIIHGFEDEVVLGSS
                     LTNAYIQSNRLDFATSSFNRIPCWKRNRHSWNTILSGYSKSKTCCYSDVLLLYNRMRR
                     HCDGVDSFNLVFAIKACVGLGLLENGILIHGLAMKNGLDKDDYVAPSLVEMYAQLGTM
                     ESAQKVFDEIPVRNSVLWGVLMKGYLKYSKDPEVFRLFCLMRDTGLALDALTLICLVK
                     ACGNVFAGKVGKCVHGVSIRRSFIDQSDYLQASIIDMYVKCRLLDNARKLFETSVDRN
                     VVMWTTLISGFAKCERAVEAFDLFRQMLRESILPNQCTLAAILVSCSSLGSLRHGKSV
                     HGYMIRNGIEMDAVNFTSFIDMYARCGNIQMARTVFDMMPERNVISWSSMINAFGING
                     LFEEALDCFHKMKSQNVVPNSVTFVSLLSACSHSGNVKEGWKQFESMTRDYGVVPEEE
                     HYACMVDLLGRAGEIGEAKSFIDNMPVKPMASAWGALLSACRIHKEVDLAGEIAEKLL
                     SMEPEKSSVYVLLSNIYADAGMWEMVNCVRRKMGIKGYRKHVGQSATEVG"
     gene            complement(66276..72341)
                     /gene="T21E18.20"
     CDS             complement(join(66276..68043,68379..68458,68746..68871,
                     69010..69150,69304..69405,69514..70722,70814..70933,
                     71061..71120,71373..71414,71497..71578,71892..72035,
                     72247..72341))
                     /gene="T21E18.20"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Contains similarity to an unknown protein T5J8.5
                     gi|4263522 from Arabidopsis thaliana BAC T5J8 gb|AC004044
                     and contains multiple PPR PF|01535 repeats. ESTs
                     gb|AV565358, gb|AV558710, gb|AV524184 come from this
                     gene."
                     /codon_start=1
                     /protein_id="AAF80138.1"
                     /translation="MGYTLQQILRSICSNTDWNYAVFWKLNHHSPMVLTLEDVYCVNH
                     ERGLMPESLHGGRHAHDPLGLAVAKMSYHVHSLGEGIVGQVAISGQHQWIFSEYLNDS
                     HSTLQVHNGWESQISAGIKTILIVAVGSCGVVQLGSLCKVEEDPALVTHIRHLFLALT
                     DPLADHASNLMQCDINSPSDRPKIPSKCLHEASPDFSGEFDKAMDMEGLNIVSQNTSN
                     RSNDLPYNFTPTYFHMERTAQVIGGLEAVQPSMFGSNDCVTSGFSVGVVDTKHKNQVD
                     ISDMSKVIYDEETGGYRYSRELDPNFQHYSRNHVRNSGGTSALAMESDRLKAGSSYPQ
                     LDSTVLTALKTDKDYSRRNEVFQPSESQGSIFVKDTEHRQEEKSESSQLDALTASLCS
                     FSGSELLEALGPAFSKTSTDYGELAKFESAAAIRRTNDMSHSHLTFESSSENLLDAVV
                     ASMSNGDGNVRREISSSRSTQSLLTTAEMAQAEPFGHNKQNIVSTVDSVISQPPLADG
                     LIQQNPSNICGAFSSIGFSSTCLSSSSDQFPTSLEIPKKNKKRAKPGESSRPRPRDRQ
                     LIQDRIKELRELVPNGSKCSIDSLLECTIKHMLFLQSVSQHADKLTKSASSKMQHKDT
                     GTLGISSTEQGSSWAVEIGGHLQVCSIMVENLDKEGVMLIEMLCEECSHFLEIANVIR
                     SLELIILRGTTEKQGEKTWICFVVEGQNNKVMHRMDILWSLVQIFQPKATNSLHLYRQ
                     SQILYMNAFANVHSLRVPSHHLRDFSASLSLAPPNLKKIIKQCSTPKLLESALAAMIK
                     TSLNQDCRLMNQFITACTSFKRLDLAVSTMTQMQEPNVFVYNALFKGFVTCSHPIRSL
                     ELYVRMLRDSVSPSSYTYSSLVKASSFASRFGESLQAHIWKFGFGFHVKIQTTLIDFY
                     SATGRIREARKVFDEMPERDDIAWTTMVSAYRRVLDMDSANSLANQMSEKNEATSNCL
                     INGYMGLGNLEQAESLFNQMPVKDIISWTTMIKGYSQNKRYREAIAVFYKMMEEGIIP
                     DEVTMSTVISACAHLGVLEIGKEVHMYTLQNGFVLDVYIGSALVDMYSKCGSLERALL
                     VFFNLPKKNLFCWNSIIEGLAAHGFAQEALKMFAKMEMESVKPNAVTFVSVFTACTHA
                     GLVDEGRRIYRSMIDDYSIVSNVEHYGGMVHLFSKAGLIYEALELIGNMEFEPNAVIW
                     GALLDGCRIHKNLVIAEIAFNKLMVLEPMNSGYYFLLVSMYAEQNRWRDVAEIRGRMR
                     ELGIEKICPGTSSIRIDKRDHLFAAADKSHSASDEVCLLLDEIYDQMGLAGYVQETEN
                     VY"
BASE COUNT        24138 a        13729 c        13609 g        22840 t
ORIGIN      
        1 gtggaatcct ctgttttgct cttgttcctc ctcttacatt gagacagagt agctcttcca
       61 atgctcgccg tctctgctaa gcttcttgtc tctgtggaga ttgatcttca tttgtacagc
      121 cggctaagtt ggggcaattc tagagggttt tggtcttact acaatgctag agggtttgga
      181 tgtctgttat tagtaagctt gttgtttctg attctatact atgatccgtt gaataactct
      241 aacattgagt atgtttatgt gaacattgct agcttctggg attatttggt agcacaaaag
      301 ccattttcag tcattcaagg ctttagttga aatgcacaag catactttta ttaacttctt
      361 tacaacaata atgtttaact gccttatccc atccaatcct taaactcgac ctgaatatgt
      421 atgtgacata cagtatgtct ctcacgaaac gcagaaactt gctatcaact ctacaaatgg
      481 ctttaagtaa cacaactata atgtagcatt actaagcgtc gctttcagtt tcaggtgccc
      541 tctgataatc caacatgctc ggatctgcgt ggtactgccc atacaaggca taaacggcag
      601 ttgcaagcac actgacaaca acaaatctta tccatgcttc ataatgcaac tgcacagtag
      661 cggaaaaatc aaaggtagat catatggtat gtgaaattag tataaagtta gttcttagcg
      721 tgtacctgag caaataagaa gatgttgaag aaaatgcaaa cggatggcac aatgggtaca
      781 ccaggacagc taaacccaga acctagaggc agagcataag cctggaagcg aaaagctgag
      841 gggtttaaca tgaagcatag ctagcaaggc atttgcctga tttgtggaga caaccatgag
      901 ggtatatttc ctaattgatg ttaacaaact tctcctctaa accaagaatg caaagacttc
      961 aatagtcaca gactttcata gtatcactgt agagttctaa gtgccagaac atgctagtgg
     1021 tggtctctat tttatgctgt atcagtaaaa gacttagtat ctagcatttt aacaggggtg
     1081 aaacttggtt tttttatttt attttttttg gcgctatgaa attaagaaga gtgtgctatg
     1141 gaattaaggc ttatacttaa ggctacttac ttggcgataa tgaagaactg ctgaagcaac
     1201 aactgccaca ccaactgaga ggagaataaa tataactgaa gcactgaaac ggtaaaatac
     1261 gccagcacca aaaccactgc atgcaattat aacaaggcaa atgacgcctt cctgccaact
     1321 tgatgtccat ctattggacg actctctatc ttttttatca ttcagtctca atgccacaac
     1381 acaagccgca acaactgaat acccagtctg aagaaatgga acaccgaaaa taatgttaaa
     1441 ctggaaagta taagtatcaa taagaaaagc aaagagatat ttaaaattaa gaccttgacg
     1501 taccaatgta ccaacagaca gaatatggga aagactatgt acattaaata tgccagctaa
     1561 aacgccagct acaatgccgc accagatttg agaatgaaga ggtgtatgaa gagttgggtg
     1621 tattctggaa aagattgaag gcaatagacc atcccttcca agtcccagat ataacctgga
     1681 ctgtttatcc gaaatatcat atgattactc aagagtgtta ccttggtttg cataatatac
     1741 aagtacataa taaaagaaat tacaaaagaa atacatatat atatattatc acctgaacat
     1801 aaagaccaac aagcagagta gttgtgagtc cagcaacagc accaatactg attaagattg
     1861 agacgaactt catacccttt gatgaaaagg cttcagctaa aggagcatct tcgctgagga
     1921 ggctaaaagg gaccatcccg gtgagcacca aacatacgcc aatatacagc gagatacaaa
     1981 ccagaaggct ccccataatt ccgattggca aatcgcgctg aacaagaatt aaacagacat
     2041 aagagacttt gtagatagta tgtacattca acatatatat aggcagacct gagggttctt
     2101 cgattcttca gcagaattag caactgcatc aaatccaaca tatgaaaaga agacaacagt
     2161 agctccagtg agaactgctt taaaaccatt aggcgcaaaa ggagaccaat ttgctacatc
     2221 aatttcaaaa gcaccggcac aaatcacaac gagaacgatc acgacctaca gaagaaacaa
     2281 tatagtgaag aagagttttt tttggtaaag ataagaagag aaggttaaaa ggaaagaagc
     2341 ttaccttagt agcagtcata acggagttga cagcggaaga ttctcgcaca ccttggcata
     2401 gaacaagggt caagagagca agtaaaatgg gagccaaaat attcaaagag agaagccctc
     2461 ccaagagctc tttgccgctt cccatccaga gaggaataga gcccttgagg gctggaaaaa
     2521 gctcaagaag agcaacagca tagctggcca agctacggga gatactagcg gcgccaatat
     2581 gatagtcaag catgagttga acgaaaacaa gaaaagctgt gatctcattg aaagctgagt
     2641 aagagtacat gtaagctcca ccaacaacag cagggaaacg agatgaaagt tcagcataac
     2701 agagagcgtt caacacacac gatgctccag ctagcaagaa gctgattgtg actcctaggc
     2761 acgcaacggc agcaataatc actaagcgat tctgaacgaa tcaaggaggt ggtgagaaaa
     2821 agtaattcat tcaactgacc aggtccagca tcgcgagcga cggttccggt gacgacgaag
     2881 acaccggcgc cgatggaagc gccgacgccc aacagtatga ggtcgaaaag gccgaggcga
     2941 cgaaccagag agtcgccaga ggtggagcga acggcagtct gcgaggacgg agggggcagt
     3001 gatttagatc ggagagctga agcacggaaa tgagagaacc atgtggcgga ggagaggcgt
     3061 tggttgctga aaccttcgtg gcctcccatg gaaacttcaa tttgagagtt gaagattgat
     3121 cgagacgatg actgaaatca cccccgggat aatcagaatc caaatcaata aatattgggc
     3181 caaccattgg gcccaacaga gaccacttaa acccaataac cctctaatga actgaaagct
     3241 cgcgacgaca tctgtctttg ggcctttagg tgcgatggag tcctctgttt tgccatgaga
     3301 cagtatagct cctattttcg ttgttgacaa gtttcttgtg tctgttgaga ttcatattgg
     3361 tctaatcttt caggccattg ttgaggtttt tggtctagtt aacaatatta gggttttttt
     3421 ttactaggat ttctttcatc cctctttagc actttgttgg gtttttgagt ttctaggatt
     3481 gttttaaatg caggaggctt aggattaggt ttttaacatg attctggttc tactttagtt
     3541 tctgcatcag ttaatacctt tgacttcttg taatatatct caaaatctca accagaggat
     3601 ggagttttgt acaaatcttg ctattcgtcc aaaatggcca tacatatcaa aatcagggtt
     3661 gttttctact catgctggaa gttagtttgg tttctgagtt gttcttgaat ctcacataat
     3721 catgataagt tggctgctgt gtcgtgttgt aactttgtta gcaagcaagc tgccgcagat
     3781 tccctagctt cctcagcatc agacttttcc tctccatgta ttgtacatgc gacatgattc
     3841 cccgtgattc ttacttcagc ttcatatcca cctttttgaa caaagcatca acatcaacat
     3901 gcaaatctga agggagtaat ggagctgaac tacgagtttg gcaaatgatc tcaaaacttt
     3961 accatctgat ggagccacac gatagtttgg tagtacccag ttattcatga gacagatatc
     4021 atcgagtctc tgcaataaat aggggcaatg aatcttaatt ctttgaacaa gaaatgatta
     4081 aagtaaccat aaactaacct gacacagact tttagtagaa ggaagagttt cactgagctt
     4141 cagcctcttg ttgctttggc atgctgactt gtcaagagat tcttgaaggt tacgcctcgg
     4201 gtatgtctcg ttacagcact cgagtactgt ttctaattgc agctcccaat cacctataac
     4261 acccacgaga tcactaagat tcatgtaaaa acaaagctgt gcagaaagga aaagtatatg
     4321 tatatataca tacctttgat gttctggatg catttatcac atttagcaat ctcgtcttct
     4381 atgttcctct gttgacgagt ctgcagccag agaaaaagag agcagctctt aatcataaaa
     4441 taaggatata tatgctattg ccaatcagtt tttttgctgt gttgtgtatc tttgatcaaa
     4501 ttctacagtt attaccagtt tatctcgttt gcaaagaaga actttcaatg cagtttcgga
     4561 tagtgatgtt gctttagaaa gaagagacgt ctgtagctcc tcaagatttg gattagagtt
     4621 atgagcagaa gcaggagttg aattaagctt atgaatgcta ttaagtctgt caggaacagc
     4681 tttcttcctc tggagacctc tttctttaag ttcctttggg tcagacgcaa cctgcattta
     4741 caaaagggtg ataaaggata cttgaagatt gaattgagaa tatataattg ttagtgtaga
     4801 tttcagattt cacctcgaaa ccacctttct ctccattcga atagttatcc ttacaagggc
     4861 tcatttcatt acctacattc ttagccttca acgcaactac tgtctccgag tgaacattag
     4921 gttccttcgc accactcata cttcctttta agtaccgatt ttgcaacctc gtcgtagctt
     4981 ttcctctagc tccaggatgg ctcagtagag cggcaacttt tttggcctgc aatttaaatt
     5041 cttaagttaa tttgtaatac cattttcctt aacacaacca tacaatacaa gtatcattat
     5101 gagagcatac tttaatttca tatctccttt ttaaagcagc tttttctcgt ctttcaaaaa
     5161 tgtcggaaac ttccgactcc ttggttgcat ctactttgtt gctttcgata tcatcacata
     5221 cagcttctgg ttctttctct atcacaaatt cggtatctcc tcgcctgaaa aagcacaata
     5281 aacttatatt gctaccccta aactagaaat gataccaaac aaactcaaag taatgttaag
     5341 gaataacaat ttaggaagaa aaaaaggatg caattaaacc tggaaaacca atcttctatg
     5401 agagtggcat atggaagaac atgaaagtat tccactatag aattcatagt ccagtcggaa
     5461 aagctcttct caaataaagg accctgcata ctattttcat agagaaaagc aaaagaagat
     5521 ggttaggaat atcatgtcaa tacctccttg tacttacaaa aagtaaagaa tgatccaatc
     5581 atgcaactaa tgtaaagtaa agtgagttta aggataacag ctgaataacc atcttgccaa
     5641 aatttgggag tcatttgagc tagagcatac caaagtcaac ttaccaacta agcacttctt
     5701 cgacaggatt ttctccagaa aatttgtctt gtgaagtgca cttcattatg taaaagcgga
     5761 ctgctgtctt ctcttcactc aaggagcata ccaaatgcct ctccaagatc acaatgtcct
     5821 tgtgattaac acctgcaaaa gattcaaaac agttagtaat aacttacaga aagaatgcta
     5881 ctaccaaatg atcagtcttt gaagataacc tgtggcctcc ttaacaacag caaatgcaac
     5941 tttttgaaag acgccctctt ctttctgatt ttccctagcg gctttctcct tttcaatggg
     6001 tttctcaagt agagaccaga caccttgtgt gatggaactg tgttgaagat agcaactctt
     6061 cttctctgag tcaaccaaca gaactgcaac tctccttatg ggacacttgt tcaagataaa
     6121 aagatctgaa gacgcatcta agctcatgga taaactacat gcatccacaa taaccttctc
     6181 cagcaatacg gtttgtcctg aaacaccacc atcttccttc aaatgctgga gcagagcagg
     6241 cttcataaca gtagctaagc tacggaaaga ctcaaaagac aaacattcaa gatgaggatt
     6301 gtcttttctg tggtaatagt tgtagagcaa cacaacagca tgaacctgga atcaaacaaa
     6361 caccattttt gaaagaagaa aaaaacagaa ctttaaaaac aaggcattgc agtctaatta
     6421 agaaaaccaa tttaagagat ttcgaagtcc cacctgtttg gcaacagatt cacggataga
     6481 agtggaagga agatcatcag ttggttttga tggaagcaaa gggtcgacta agctttctaa
     6541 taaagctcga atggcgtcct ctgtcggaca agaatccgtg gtcttcgtga ctggtaaact
     6601 gcaatctact tcctccataa aacccgaaaa gaagaagaaa gagaaaagaa agttgcgatt
     6661 tttagtgatg ggtagacaga aagtgaacaa ctttaccggg aaaggaaaac cctagatttg
     6721 ttctccaatt accgtttttg gtaaatgaga gagagtgata tgtgtcagct ctctctctct
     6781 ctctctctct caagatcatc taaacttcgt gtttttcatt tccatttatt attattattg
     6841 tttagttagt gggaaattcg aataggcgcc aatatttcgg ggctttactg taatactgtg
     6901 tctcttttga gggcattttt ggaaaatttt ctgtcgtaca ttattggata ggactgttca
     6961 atttgacttt tgagtttgac gtgcgaagaa cggtcggaga acgtttaaag actaatacat
     7021 acataatgat gacatttgga ttttgtttca aatgtttcta taaaattgtg taaatttgcg
     7081 ttaaaccacg attatacaag tcaatatata ttcagaacta attgtaactc atttattaat
     7141 tcagataaga aatcaacaca aaatcccaag tttgtcattt tcgtgagcaa accagacaca
     7201 atacattgac cgaccagacc ctcccacagt tcttaaccct aaaccaccac aagactctgg
     7261 ttcaaccaaa actcttacac acacagctca ttacatacaa aaaacaatca acgacacttt
     7321 gaatcaatca aatgatattc ccacccccaa caaacaaaaa cattaaacaa acagacaatt
     7381 ctgagtttct gcccgacctt tcggtgcttg tgctcttcca tgacggttcg atcagattaa
     7441 acgaatgctc cttgatgatt acaacttttt tttttcacaa cgaaatgaat caatcattgt
     7501 tgctttcaga aaaaaaagcc aagagatgac taagaatata cgaagcagaa gattacacgt
     7561 gataatatat attatgctct ctgtgtgtgt ctatatatat gcaagattct cagaatgtac
     7621 cggtttaaca cccggctgct ttcaagaatt tatcgtaggg gctcgaaggc ggtaaccgaa
     7681 atgaattttg tggaacttct tgtgagaaga atccaagctg gccttgaggt tgaacatcag
     7741 ccacaattat tgccttctca tcatcttcac cagcttcttc tgtctgcagc acaggagaat
     7801 acaaaaaaaa atgaacactg aactgaacca agattcaacg tttataggat gacaattaat
     7861 gtcacagaga acaaactctc acctccttga gaagatattg ttcgtccttt tcattgtctt
     7921 ctgaggttat agctttggtt gcttggggtt tgaaacttcg aagcacagac atcttttgct
     7981 gcttacccgt cacaagagct tcacactggt tcatcatttg gtcataaggt acaggaatgg
     8041 aggaaacagg gagacttgca acttgccgag cagtttctga tacctacaca tcaccgatga
     8101 aaaaatcaca ttaaaaagga ggagaccaat aaaaactatt atgaaatatt gagtgtaact
     8161 attaccgatt ctaacaactc attgacactc agaacatcta ctgggttagt gtttgtggac
     8221 aatgatgttc tgtggccaga ctgactccca ctggcccctg gggatattcc ttcaaatgcc
     8281 gctatgtctg aaagctcaac ctgaaagatc cacaaaattg caataagaga atcattcctg
     8341 aagcaaattt atcatgaaat cattatacct cttcaaaagc tggaagttct gtttgattaa
     8401 gaggagaact aggtcctggt gtatccgtga ataattgtcc accaagcgaa tgtgcatcat
     8461 ctagggaaaa atctgactga atttcctttc tcaaatttaa ttgctcctcc taagagaatt
     8521 acacatataa aaattcaaaa caaaagtgtg aaattattgc atgaaatggt tataaggtca
     8581 agcactccct ccgcaaaaaa taacagaact atcatgaatt acacattata taactttaaa
     8641 ctagataagt acctcagata atgtctgcaa tttcgatgta aaatgagtta tcacgatttc
     8701 cttcaggcgt ctatcatctg tgacaatcac tgaagaattg agagcagcac tatcatcttt
     8761 gtcagatcca tacgtttctt cctgtggaaa tccagaacat acagcacgca gtctgatatc
     8821 tccttccagc acaagataag gatcaaccta tttaggacat gaagaattgc acatatagat
     8881 taaaaacagc tgagcaaccc agaaacaaga gatttagaaa acggaaaaca aatggatgca
     8941 attatcaacc aaagctcacc atttgggcag ttaaagattc tttgataatt ggaactagct
     9001 ccagaatatt ggaaatcttg gcaccgaaaa tgagcatata tgatgcaaaa gtgaagatag
     9061 atcttctacg agagtgctgc atacctcctt caacattata ccagaaatct acgtcagaaa
     9121 taaactcaat agaatgggga gttcagtaca tattaatctt tttgcattta caaggagaag
     9181 atgtcgttca tcggtattcc acaacaaaag gtacttttac tgaacatata agttctagcc
     9241 aatctgtgac tggtaggtag tgtttcaagt ttcaacaaaa caaattaact tccggaagat
     9301 cctgtccaat atgtagatgc taaaactata attgagtcaa aaaggaacta aaagctaaac
     9361 tagtgttccc tttgattaaa ttccttgcat cctgactaga tgtttgattt atcaccatat
     9421 tatcctctct taataggtgt acaatatgaa cgcgagagac tgtataataa catccaccac
     9481 taacaaaatt acatcgcaaa tcaacaaaaa tggcatggca taatttaatg aacaatattc
     9541 atcatagtta aatgctaatt aatgagatcc attcataaaa tctagcgaaa gtaggtaatt
     9601 ttctcgatga acggaaaaag cattaagcca ctaaccacag tctttcactt accatcttga
     9661 ttcaatgaga gatttcgaag agagaatgcc agctgaaaac actgcaccag agccatgtga
     9721 tttgatctct gccatttgca atcacaaaaa cagagaaaat tttacaaaat caaaagacca
     9781 tcccatctag atggattgca taaagtatta aagttcttaa ccataaaatt cagtttcaaa
     9841 aacaaggtgt tgtaagttca ttttgatcta aaagagtcaa gatgtccggg gccagatttc
     9901 cagtggaatt acccaccctg gccagaatga aataatacca acattccata agcctttggt
     9961 atggtggaat atctagaact caatatacaa taaagctaga gtagaagtat cgactaacct
    10021 ttgctagtga aaacagtaaa gtgatttgat atgtgctggc catggcctca aaattttcag
    10081 gggtattgtc ggtagaagtt gcttggatcc atagggatga aagaagcata ttcacttggt
    10141 gactactcag tcggagtgaa cataacgact gtaatagcat gaacccacac tatagttagc
    10201 tccgtattaa atacactcaa atcgataaga aagtgccaac taatatactt cgtgtgtgtg
    10261 tgtggggtgg tggggagagc gcaaagagat aggtttagaa aaatagtacc tttataccat
    10321 catctaaatc ctttaagcta tccaaggact gacagctaag ctgttgactg gtctgtcctg
    10381 atacacttgg acgagatatg tggtttacat ctttacacag ttcactgttt aaggatttct
    10441 caactttttc tttctcttcc tcctggttcc ttactgtaca aattccatca actgacaatg
    10501 acccagaaac agcttctgag gtttccttat gttgatctga ccaaggcaaa cgaagagttc
    10561 caagaagcac gacggaaaaa atattgtgtg cctcgactct agtcgtacaa tctgcatggg
    10621 acatcgcaag gagcagttgg tgaaacaagg catccggaaa tacctgggac agaccacagt
    10681 aactcagtta gaacataata actactgcca tagtcaaata caaaacaaaa gttgcagtaa
    10741 aagaattcat ttactttctt gtggtaagaa acatttggga ccaccgatac tatatgtgca
    10801 gctcggagaa tggctgatgc tgtggtccta gaaaggacta cattagtgga aattgtctca
    10861 agaaccactg cgaacatatc aagaatgggc cctgcatccc caaccttaaa agcaaacaaa
    10921 aaaattgaac aaattatggc gttttgtatg aacacgcgga caggagagaa aacaacaata
    10981 tgcacaaatt tcactggcaa ctccaaggag tttcaagagt gaaggtagat caaaaccaca
    11041 tgctgaaaga agaaataaca tattacataa gataagaaga agctgcttga tttcgaaact
    11101 gttatgtgat atatggggta ttgaattagt cttagcacac tatagatcat ataggtttcg
    11161 acactataac aacatgtcca taactttcaa atggaataac gccgtaactt ctattttgac
    11221 aatatactgc aagaaccagc taactaagat acttaattga tactgaaagc tgaacatggg
    11281 actcataacc actggctatc tactaacgcc ataactagat aagaacagaa ttcataagga
    11341 cttgggaaat gattcctaat atacaagcta ctgctgttta cctagcgtat ttccttttac
    11401 aatcttattt tttcatacaa gcaaactaca taattttaag aacgagtaaa cttgaagcca
    11461 tgttcgacca ttgaaaaatt aataatatct ggtgtattag gacatataag acacaagaca
    11521 atacaagtaa cacttgtggc gagggtcaga tcaaaaccac agaaacctct aaagaacaga
    11581 aaccagtcca actaacctta tttgagagct ctgctatgca attttctaat gcatgctgga
    11641 ggtccgagtt ctgctttgtt ttatcaacag acacatctga ttcagctgca ttttgcaggc
    11701 attttcgcaa gtgcttaatc aagtcagcta ttacagcagt catcgcgcct gaagcctgct
    11761 gctttgcatg tagtgcaagg catgtggcta cattgaccat gttaatttga agaccttgtt
    11821 gctttattac attcttatga tccaagtgct tgatcaaaga agataccaac acatgacaat
    11881 tttctcctgc ttaaatactt ctttagtcag ttgcctcata gacaagttat aaatatactg
    11941 aaaatcagga aagatcgcaa ataatatata tcatctgacc tgattcttcc agacgagact
    12001 gcagaaacaa taaaacagaa gaggcaacgc ccttctgagg agaccagtaa tctccactgt
    12061 caaaagcagt cagaagcggt tccaaaaccc gacgaacagt ggtagtttcc tttgctaatt
    12121 tggctatatt gcaaaggcaa accatagacc agtatgaggg gctcttcgaa atatccctga
    12181 atggatttaa tcattcaatg aataaattaa gcaacttata gatgatgcat ttccaatggt
    12241 cgtaaaaaca agtgaataaa tctataagga gaagccttac atgttttcca acttatagtc
    12301 agtcaccgga ttaggtttga aagaaacctt tttagtcatg ttgggaatct tcgtatctga
    12361 aatttgatca acttctttgg tatcttcttg gcccttctcc aaatccatat aattctccag
    12421 aatcacagaa ataatctaat tcaagatgaa aaagggttca caacctaact acagaacttg
    12481 tatataaaaa tcttgtatgg atcagcagaa gttgaagtat ccgatgactc accatatcca
    12541 agtccattga tagttgggaa tgctcaccaa tgaaagatac ctggtattaa ctattgatta
    12601 gtagcaaaag ttccaagcag aaacagttgt ggactttgca ccacataaga cgaaggtcga
    12661 aataaaatag gatttcaact aaagagaaac taacaacaga attccctttg aactgaaatg
    12721 gaactaacta gtaaaactaa acaggttgac cataaattct atactagctg aataaggact
    12781 accatgctta aaatgttttc ttgaacaaga aaaaaaactc attaataaaa gtgtccgtta
    12841 acagtttgca ggtcaaaatt attaagttca agtaaatata acccattcca ctaacataga
    12901 taattcaaag cagaagttct ggctatctac aataggaaga gcacataacc cgtaacatgt
    12961 tgcacatcta aagggcatgc aataggatat gtttcgtgtg aggaatgtat acagctaaag
    13021 ggcatgtttt ctgtcagtca aacaaaagag aaagtaaatg gataaagcat taccatgaat
    13081 gccaaagcct gcattcctgc tgaccgtaat tggagtgatc tttcatcatc acccatttct
    13141 tgagcaagtt gacaaagttt agggattaga ccttctaagt tgaacatgtg cgaattcaca
    13201 gtctgtatgt aaacagatgt gttaccatat gtagtggtag caggaaaagt agcttgcaaa
    13261 accatgtctc aaaaaaatgc taaaatgtac ctgtaaactt ataaagtcga caagagtatt
    13321 gcaacccaag atctgaactt cttcctcttt tgtttgctcc aaaagagttc tgacaatgct
    13381 tagcaaacta cacgaaaaaa gaggcctaca agaaaaatag acagtctcag taaaacgtaa
    13441 ataaggaacc tggaaagaaa cctataaaac atacaggaat tcgaaagtaa atgatcgagc
    13501 aacaagaaag aaaaaagtaa gcattatttc tgaagatcta atttaacaaa agcgaaatat
    13561 gatatactga ttctaagtaa ccagttgact tacatctgct ccttacatga tgaaagcagt
    13621 ttcttataaa tgcataagac gactttcact gaaccaatat ttccatttcg caattctttg
    13681 taacattttt gctcaaggta ctctgtaatc tgtcataatg gaaaactgaa acacatgaga
    13741 ataaaattga gagaagtatg ctaagaaaat tgaaaaggga ataacagaaa aaaaaatgca
    13801 acaacctttg gaattcgtaa aggattccta gacgcatact cacacagctt gccgattttt
    13861 ctatcattag gctcagcttc ctgccaaatc acaacataga aaaatgttga aacttgtatc
    13921 attccgtgta gcaaacctca ttttagtttc attgggaatc cattccactt acatttcccc
    13981 acttacaatt agagagatct taactagtac acacaaaaaa aaattgaaaa taaagaagtt
    14041 ctccaatcaa agagtgggta aggaaaaaag acctgattac gagggaagat ttcagcgagc
    14101 attttcttgt agcgtttaac gggatgccta gaccttgccc tcaaagaagg acagaagaaa
    14161 cagaggttac cacaggcggg caaaacccgt ctggacataa cccccatttt cttctccgcc
    14221 taatatcccc ccctgcaaat atctctatat cttaagacta aatctttgaa agcaacaatt
    14281 cctaattgaa gacaacaaca acagaggaat caaagaaaac ctagcagctg cgatttgatt
    14341 ggcaccctaa attcaatatc tagttaccaa gatcgcaatc cggagaaccc tgaaaaccca
    14401 gaacaaaaaa agggaaattt agaattttcg atcccggaaa ggaaataaag gaatcaaatt
    14461 cagagaaatt acaaatccaa attggaatta accaggaaaa aagagagaga tagagattga
    14521 agaaggagag aattttacca ggaagatggg gaaaagccag agaggcagct tggggagaag
    14581 aaggcaaatc taatcccgct tgcccgctca gaggtggcat tgctcttctc tcgtcttttt
    14641 atcattattt tatttaatct ctccatttca ttattaaaaa agctctctct ctctcttctt
    14701 tccgccatta atgtcggaaa gtgtcagtcc gaattcctct ttaaattacc aatataccct
    14761 tcaaatatct tgtaatggat ccactagtgc ttatgtgatg cgggctatat acggtccgaa
    14821 tttttgaagg ttgttttctg ctgaatggat ccattgacta gtcctctatg attcttgaca
    14881 attgttcttt tgatcttttc ttaatttttc ttggttttta attcccttca gaattggttt
    14941 ggtggttcat gactaaaccg aaaattatta tattcgcttt acacaatttt tagtttggtt
    15001 aatagtaata caattcaaat gtctgatcca acatagaaat caagctatct catctcaaat
    15061 gtcatacact actcacaaga cttaagaacc gggaatgtag aaaaccaaac gccaaaaatc
    15121 tgaaatatca gagagagcag aatatgtgtc tctaaagctt aaatcttgtt ttgcttgaga
    15181 attaggcatt aagaggagag gtcaaggtaa actaaagcag ggactttgat tatctcattt
    15241 acacgcttct acttgtttca cataaatgag aatgtggaac attcttcatt acgagttaaa
    15301 gtcagagcgc ctacagcaaa gtcagctcaa ccaaaataga cactgcacaa actagtgaca
    15361 taaggaagtt ctaagcaaaa taccatatgc agtctctctc taccgataag gaaaaccttt
    15421 caggtcgtaa cggccagcca gtttctgagc aacaccatcg tagaggagtt tatccatcat
    15481 ctcaaacttc ttgtgatgtg ttaccgccgt ctcagcttgc tgtttcgaca gcttctctgc
    15541 ctcctcaagc tgtttctgac aacagaagac aagaaaacac attcacacaa tagcacacaa
    15601 gtcttcatta acactatcac cgccaatcag atccaatacc acaggaagag acaacaaaca
    15661 aacgaaaaca aaaaacaaaa aatataagca ccttgagcat gaacgaattt tcagcactat
    15721 gcttacgagc aagccgcttg actctcctgg ccttgtcgaa atcaggatcg ttaggcttaa
    15781 tccagcgaaa acggaccgtt ctaccaggct tcttcggttt atcaacaaac atattaggct
    15841 cagcagcaca agctctcaca ggccttggca taccagcaac catgaaaggt aactgtgaga
    15901 cagtagagat aacagcctgt gtcatctctt cattctccat ctcaacaaga acacccatag
    15961 gaagctcctt tggacccaag tagttaggta tgaagctgac tttcttgaca gtcccaaact
    16021 gattgaaagc agatgaaata acaggagctg tggcaagagg cgtgagttcg tctacgtaga
    16081 cagtacgacg aactctctct aggaacttct catacgctac ttcttccgga gtcgccatca
    16141 ctaaccaaat taagaagaga aaacgataaa cgaatttaag ttcaaataga acaaacccca
    16201 aattgattca acagagttac aatttccgtc ttaaatatat gcaacgaatt ttctggaaaa
    16261 acaaaaaaga aatcggggcg aaaatctagg gtttctcaga gaaatgggaa tgaagagata
    16321 gtagcgaaat cgatggggca ttgatgaata gaaggataga gatcaaagaa ttacctgaac
    16381 tggagagaat tcgtgttaaa ggcgtcgtct ctggaagtaa ctgttaaact cgtgtcaaag
    16441 gcgtcgtcta tggggggaga cgaaataagg aagaagaagt aagttaggag gataaatgac
    16501 gacttttata gatttatata tttgttattg gattccatta tcaatggccc gtatagctca
    16561 gtggtagagc gtcagtcttg taaactgaag gtccgtagtt cgatcctgcg tgtgggcact
    16621 tttttatttt tcaaccttat gcaattttat ttttttcctt tccctgtaaa ttataaaaaa
    16681 catgtagttg aaattaaata agatattttt ttttttgtaa gtattaaata aagagattta
    16741 gtgaaagcga tgcgactcat tgtaatgtat caattttgga tctctttgta gtttttataa
    16801 aacaaaatct ttttaggata ctttcattgg ccataaatca taatagtggt tcaccacttc
    16861 attagagttt ttagctgttt ttcttttaag aatcaaatat taaatcaaat tctgatttga
    16921 tcaataataa actgttattt agctaatgca attgtttaaa ctgataaatg tttggagcta
    16981 aacgtgcaac caatatcctc gaggtgggga gtacctgcct accatttact atctagtttt
    17041 ttaacagcaa aatatgtctt atttaactgg gataaatgtt tggagctaaa cgtcactaaa
    17101 actgttcttg attaattgta actgggaatt aattacgcta acaataattt aaaacgaaac
    17161 atatattttg cgtatactaa tgttaattca agaatgtaaa ttccagggta tttgtcgcag
    17221 ttgtttatac taaatattaa ttcgctcaga ttcaagaatg taattatttt acaagaattt
    17281 tgttatctac cttcaaaagg atacacaaat ctatcagatt atatattatt tgaatgttga
    17341 ctcaactttc cccctagtac tactgtttct taattcttac ttttttgttt ggtgaaaaca
    17401 aagtattaat taaattccca ctatatatat aacaaatttt aagaaaataa ttaattccat
    17461 aaactcatag agttgcatcc ttttaaaacc ctcaacatgt ccatctctac cgattaacaa
    17521 tatcaaccaa aggcatatct ttttatctcc ttcttccttc ctatttttgg ctaatgaatg
    17581 tctctttgtt gcatctcttg taacttcctc ctagattttt gaattcctgc ccttatccaa
    17641 gaagccagga aagggtaaaa gattttctcg gcctcgtgga gccctcacca ttatcttttc
    17701 ttcctccaca cgcaacacta caactttaaa agagatggat ccgacagagc taaaacgcgt
    17761 gttccaaatg ttcgacaaga acggggacgg gacgatcacg gggaaagagc tgagcgagac
    17821 actacgaagc ctagggattt acatcccgga caaggagttg actcaaatga tcgagaagat
    17881 cgacgtgaat ggtgatgggt gcgtggacat agacgagttt ggtgagctat acaagacgat
    17941 aatggacgag gaagacgaag aagaagagga catgaaagaa gctttcaatg tgtttgatca
    18001 gaatggagat gggtttataa cggtggatga attgaaggcg gttttgtctt ccttggggct
    18061 caaacaaggt aagaccttgg acgattgtaa gaagatgata aagaaagtgg atgttgatgg
    18121 tgatggtagg gttaactaca aagagtttag acaaatgatg aaaggcggtg gttttaattc
    18181 tttgtagcta attaatatgg ttttattttt ttctggcatt tttgtgtttt gggatccttg
    18241 atttaattaa ttatattgtc ttaggaatga aagacacaaa agaaaaatga tcctagttta
    18301 ctgcattctt gttctgtttt cctagtgaat attttagttt gtgttttata aatgcgtttg
    18361 atttataatg taatgagaat ccacctgtgc caataattga gatcattggc aactaggcta
    18421 gctaattgta actgatgtag ctctattagg aggaatctcg tttataaata ctgaatcaat
    18481 tagacaaaat aaagatggtt ggcaatatcc gtttgacaaa attagatttt tgtatccgaa
    18541 aaaaattgga tctaatgttg tatttttttc cacggatcta atgttgtatc cgcttgacaa
    18601 taccataatc taattttgtc aagcgcatat tgccaggaat cttcgcttta tctaatcact
    18661 ttttatgtat ggatttggat cgagatttgt gtgttgctcc aattttctga ttgtaaactg
    18721 tttttactgg accgctaaaa ataatccata acctatccat aaagtggaag ggattttacc
    18781 taatgtgaaa tgtgtaacaa acagtcttcc ttcgttcctt gtaactaaaa gaggtgtgaa
    18841 ctcaactaac gtttattcag aaatagtgag gtcaaacata catgaataag tagtacgtat
    18901 gcatttgttt ataaaaaaag tacgagttat atgaatcaaa agtgttcagt ccgagtttca
    18961 gttcaacggt tgcagcctag tccagagaat caggcactca tagtcttgat cctccacacg
    19021 accacaaaca cgaacaaaca tctatttttt cttccttttt tgtttttgtt gctaaaaatg
    19081 taagttgggg tctgaaaatt ttgaagagat ctgagaaact tcacaagtgg gagttacaaa
    19141 agtctcggag tgacagagag caaataaacg agataaggtt aatgagaaat atataacttg
    19201 tggaaaattc aaaaactttg gtgtacgtta cgaaaattct catataggca aagttattta
    19261 agtttcgtaa tatacaaaaa aaaaaaaaaa aaagtagaaa aatatttgaa ccgcgtgtgt
    19321 aatgtatcga ccacagactc tatgcccttg tgtatcatgt gagaagataa catgggtccc
    19381 gcctgtagtt tttcctattc ttttctttaa tttcgaaatt tttgtaatta atgtgaatga
    19441 tacttttttt ttttgtctta gtattattgc catcatcata ctagaaaaca ttgactaacg
    19501 aactctaaat cgagttaatc gttgtcatat caaattaaga aagaaaaata acaggaaaat
    19561 aaataacaat tttcttaccc catttgctta ttgactctct taaacaaaca aatcttaaaa
    19621 agcaagagaa gaggatattt attacaaaca catctctgca acgagctcat ccaagttctt
    19681 gtaagagctc ccaccttctt taatggcctc catagctttc tccctcagct tcatcaacgt
    19741 aactctctcc ggcaagtcct ctctcgccga ctcagccaaa atcctagcga gcttgtccga
    19801 gtcaggaacc gagtctctgt tctctccaac tcgcactgcg gctcttagtt tatcaacgat
    19861 gagcgtcgtg ttaaagaaat ggtctgcttg catcggccac gctagcaaca taactcctcc
    19921 gaccattcct tccagaaccg aaccccaacc caaatgagtt aggtaagatc caacggctcg
    19981 atgctcaaga atcatagttt gtggggccca tcctcttatc acgagtcctt tctccttcac
    20041 tctctcttca aatcccgccg ggatcacatc ttcctcaacg gagttatcgc tggagttcac
    20101 cttcttagct gcgtctctca ccgcccatat gaaacgcaca ctgcttttct ccaacgccgc
    20161 cgctaaagca gctgtttgct ccgccgtgag ccggatctgg cttccaaaac cgacgtatac
    20221 gacggagtta tcctcggggc acgaatctaa ccaagccgag actttcgccg gcgggattga
    20281 gctttgtccg ccacggtcaa cgccagcttt aaaggggagc aacggtccga cggtccatat
    20341 acggtggtga ttcaggaaac gtgttttaac agtttctaca aactcaggct cgaggtcgta
    20401 gaaactgttg atgacgagcc cgtagctttc cgttgtggca gtctcgagat cgttgaagaa
    20461 gcttctatct tcttgagccc acatgacgga gatcgaatga gcattgatgg gtaagaaact
    20521 aatggactta atagagaaag catcagctac tttgttaatc caagggctga gaaatgagct
    20581 tcctaggatg gcgtcgggga gatccgacgg tggttgacgg ctgagaaagt caacgagagg
    20641 gtcgtggaga cgagagagag catcaaacat gtgaactata gcttcgagag gaagttgctg
    20701 gagagattcg acaccggaag gtatacaagg gtgagaagga aaaggaagga ttagggtttt
    20761 gaagtgttcc ggggagtgaa gagaacggag agcatcgaga taggaagagt ttttgggtgt
    20821 gacgaggaca gtgacggtgg ctccacggag aagaatctga tgcgtgaggt caagatgtgg
    20881 aaccatgtga ccggattgtg gaaacggtat caccagaacg tgcggcttct tcgttgttgt
    20941 tgttgtcatg attgatgttt ttttctttct ttctggtttt ggagtggaga aaaattgaaa
    21001 agtggaactc cttttatttt tagttttact gccgacaatg gaactcttat ttataaaaca
    21061 gatgcagcat atatatctct attaaaaaaa aggaccaaaa ccccaaacaa atatagacca
    21121 gtcgataaag ccatacctac ttcgacgtaa ttgctacgtg gtggtttggt ttggtgcctt
    21181 attaaaataa ggttggacag agccggccca ttccctaaac aaaagaaggt aggtggtgct
    21241 ctagttcaaa attcaaaata aaaactaatt agacaacaat ttgagtatgt acgtctctgt
    21301 agatactagt cactagatat cctctaattt ttccgttata aacatttttt aaatagatgt
    21361 gatttcatta tttttaatat atattataca ttttggatgc gatttgctaa aggaggccaa
    21421 atggagaaca tgcatgattg aggtaatgat gttgttaact taagagcagt gtgtcgaaag
    21481 aaccaaatga agagtgagag atatgtcatt attgtgtagc aactcttttt cataaaaaaa
    21541 tcaataccgc aacattataa catgtgctaa attcgaaatg atgacgtcag attgattaaa
    21601 aacaaaataa aaccttcgtt acaagaagac ggctttaccc ttagccctag tgaaatcaaa
    21661 tgataggttg gtttaattcg ggtttatgat accggtttaa ataacccggt tctaataaaa
    21721 ccagatagag tattcttctt ccgggtctct ctctttcatt tgacatttcg ctcgctgggt
    21781 tcttcaccgc tttcaagctc tcctctgggt ctttctttga atcgtgaaag gtatcgtttt
    21841 tatatctctc tatacttgtc tgattctttc tctggatctt tttccgtctc aaaatttgtt
    21901 aagggaacta cattggcttg tcgatttgct taacacaagc agttctcatt ttagagttaa
    21961 cgaaagtagc aatcggtttt cgattttgta aactttaatc gccaattaca gttactgaaa
    22021 ctctgtattg agagaattag ggttcggttt caaatcagct gggttttgta attttgtttc
    22081 tcgtttatct gaaacccgag tttttgaggc tctatgtgtt gggattagag tcttacgaga
    22141 ttgttataat taggattcga ttaatttgtg gtgtaaattc tggtgggaga tgtttatgca
    22201 atctctaaac cccttttttc tgcagttatg tcttataatc agtttctgct tactgcattt
    22261 tgatctctag taaaccattt tttctcacta ttttgtatcg aaatcaatga gggaaccacc
    22321 aaataatccc catctattga ttgaatgatt cttcttgttt agtttagatt cgtcacaaga
    22381 aacaaaatct tgataattgg tctaggtttc tgatcactgg ttagccaaac tgtagtctgg
    22441 ttttagtttg tcactctgct aaaaaaattg ggatgaattt gtgatgctag gaaatgggaa
    22501 gagagaagag ccctggtttg aagatcctct gggtatggac tatcggcact gctgctagta
    22561 tgattctctt tctgacattc actgaatttc gtcatgagat catatgtatg tgttaatact
    22621 gactagtctt ctactggttt gcagtattgg tgacaagtgt tgtccgcaca agaatgcagg
    22681 atatgcaaac aatgatgaac cagaaccagg aacaagcacc aaaagaaaac cagaacggaa
    22741 gtgcaggtga ttcttccgtc ttaatggatg aaacagtttt gcctgagtcg gatcgagaga
    22801 ttgcagaaaa gctttaaaga aagaagagcc tggttctagt gttgtcttcc ttttcttctc
    22861 ttcctttttc agctctccat gaaggtgatg aaacatgttt taatggtttt ggtaatagtt
    22921 tccgaatatg agtagatgat gctagtctct agatgtgtct aggaaaataa aacttgaaaa
    22981 gtgaattgct caggaagctt gatgaggagt gtctagcagt tttttcgtgt gtgaatattt
    23041 tcccttgcaa ggatgatata tgataaagtt gctaagcgaa attttctttt ctcttcttat
    23101 gttctatgct aatcaaggct accaaaaggc atcaacttta tttagttcgg tctgtgttac
    23161 atatgactta taatcatttt ttggtggtaa acaaactttt ttaatttggt ggtaaacaaa
    23221 ctttacaata ctgagacatg aattttaggt caaaaactga gtgagagaat agatatttaa
    23281 gagtgctttg ttcttatcca ctatatattc aaagttcgaa attccatgat caatgtagaa
    23341 atgttgaatt caattgaacc tgtaaagctg tatcactaca tttttttttt ttttttggta
    23401 ggcgtatcac tacaattatg gaacaaatga aaatcagata caagaatttt tgctggaatg
    23461 gtaataaatc agaaattcaa aatatagtct acctggaatt tccataaact tggatattcc
    23521 acgtttcagt tcaaacatat cttcaaggat tgacttgttt attatgtgac ttcaaaggat
    23581 taaaaaccat ttgagccttt attatataaa aacctactcc atagtccata cttcgttcat
    23641 ttttatactc tcttatcatt ttcatttttc gaacggaaaa tcgatcttgt tcgaatggca
    23701 tcatccaccg gcgagaaagg tctcatcgtg agcttcggcg agatgctcat tgacttcgtc
    23761 cctaccgtat ccggcgtctc cctctccgaa tcccccggat ttctcaaagc tcccggcggt
    23821 gctccggcca acgtcgccat cgctgtttca cgtcttggag gtcgtgccgc cttcgttggg
    23881 aagctgggag acgatgattt cggtcatatg ctcgccggaa tcttgagaaa gaacggtgtc
    23941 gacgatcagg ggatcaattt cgacgaaggg gcgagaactg cactcgcttt tgtcactttg
    24001 cgttctgacg gagaacgaga gtttatgttt taccggaatc ccagcgccga tatgcttctc
    24061 cggccagatg aactgaatct tgaacttatc agatccgtac gtaaaatctt tctctttgtt
    24121 ttcaagattg ttactcgttc tatcttttta tttattacat ttttctctta caaggttttt
    24181 taatttctaa aacacgcaat tttataaatt tccttcggta ataatatgcc atgtgtaatt
    24241 ttaaccctaa ttttactctt ataatttgaa acgtaaatca aagaaaggtg ataattaaat
    24301 caatacaagg cgttaattaa taaaattttg taaattgcaa accaatcttt ccttttacgg
    24361 ttaacaaatg aatattaaaa aaaagatgtt gaaggttatg aagctatgac tttatttgaa
    24421 taaaaatacg atttgatata aattttattt gtttgtgcag gcgaaagtgt tccactatgg
    24481 atcaataagt ttgataacag agccatgtag atcagctcac atgaaggcaa tggaagtggc
    24541 gaaagaagct ggagctcttc tttcctacga tccaaacctc agggaacctc tttggccatc
    24601 acctgaagaa gctaggacac agatcatgag tatctgggac aaggctgaca tcattaaggt
    24661 cagtgacgtg gagcttgaat tcttgaccga aaacaaaacc atggatgata agacagcaat
    24721 gtctctatgg catcccaacc ttaagctctt gcttgttact ctcggcgaaa agggatgtac
    24781 ttatttcaca aaggtaaaca tctttttcga ttacttgtta ataaagaaac tacttttgca
    24841 agtcttgatt gggacaaaaa cacttgtgta gaaattccat ggatcggtag aaacattcca
    24901 tgtggacgcc gtggatacta ccggagctgg agattcgttt gttggtgcac ttctacaaca
    24961 gattgttgat gaccagtccg tactcgaggt gggtactcaa ctgaatgaat cttccttagt
    25021 tgatcaaaat gcgatttact gatgatatct ttttttcttt aggatgaagc gaggttgaga
    25081 aaagtgctga gatttgcaaa cgcttgtgga gccatcacaa caactaaaaa aggagccatt
    25141 ccagctcttc ctacagacat tgaagctctc agttttctta aagaccaaaa gaaacgtcaa
    25201 accaatctta aattctcaaa atggtgttgt acggcttctc cttgttaatt ttgattttgt
    25261 gtgagtttag atccaagctg ataagtctta tttgaaataa aagatcccac agtttttttt
    25321 ttaaatcaga tttaagagac ctaagtttat gcgaaagtgg aattgaacca atgccgaatg
    25381 taaaagtcaa agaactgtta tttcatattt gctgctccac caaattttcc tttttgttag
    25441 tcatagatat atagacgaat ccatctaatc cattatatca aaaatttgtt ggtgtattca
    25501 tagatatata gacgaatcca tataatttga attaaattta agagtgttgt gttcatcaac
    25561 tatccaaatg ttttaattgc catgatcaac catataggaa tgtttcataa ccatatagaa
    25621 acgttgaatt cattgaacct tttaaaattt cttgtttcaa aaggtagtcc atacattaat
    25681 tattaagaat tttatcaact acaattatgg aaaaaatgat attcagatag aatttttttt
    25741 tgctcaaatg ttaatatatc tgaaatcagg atatagtata actggaattt ctaaataaac
    25801 ttatatattc cacttttcaa accttcaagg atttaattat ttatgatttg tcatttttct
    25861 ttataaaaag ccattaatgt gaagaaatat gacctcaaaa caagatttaa accctgtctt
    25921 cactctccta gagccttata taaactactc aaaacttcgt tcactcttca ttctctctat
    25981 cgttttcatt cttcgatctc tggaacacaa aatcgatctt gttcaaatga cgtcatccaa
    26041 cggcgataat aaaggtctcg tcgttagctt cggcgagatg ctcattgact tcgtgcccac
    26101 ggaatccggc gtctccctct ctgaatcctc tggatttctc aaagctcctg gtggtgctcc
    26161 agcaaacgtc gctatcgctg tttcccgtct cggaggtcgc gccgccttcg tcggaaaact
    26221 cggggacgat gagtttggcc atatgcttgc cggaatcttg agaaagaacg atgtcgacga
    26281 tcaggggatc aatttcgata aaggagcaag aaccgcactc gcttttgtga ctctgcgttc
    26341 tgacggagaa cgagagttta tgttttaccg gaatcccagc gccgatatgc ttctccggcc
    26401 agatgaactc aacctcgaac taatcagatc cgtacgtaaa atctttatga tctctgtttt
    26461 caagatttca agattttact tgttttggag atttgatgaa tatttttctt tatttggcag
    26521 gcgaaagtgt ttcactatgg atcaataagt ttgattacag agccatgtag atcagctcac
    26581 atgaaggcga tggaggtggc gaaagaagct ggagctcttc tttcctacga tccaaacctc
    26641 agggaacctc tgtggccatc ccctgaagaa gctaggaaac agatcatgag tatctgggac
    26701 aaggctgaca ttattaaggt cagtgacgtc gagcttgagt tcttgacagg aaacaaaacg
    26761 attgatgatg agacagctat gtctctgtgg catcctaatt tgaagctctt gcttgttaca
    26821 cttggcgaaa atggatgtcg ttactacact aaggtaatgt acaacaaaca ttcatgtgga
    26881 ttcatcatca tcatgatgat cttggtgtgt gattttgatt gatgttctct tgactcttgt
    26941 gtaggatttc catggatctg ttgaaacttt ccatgttgac gctgtggata ctactggagc
    27001 tggtgattct tttgttggcg cgcttctaaa ccagattgtt gatgatcaat ctgtactcga
    27061 ggttaactcc cattgatatt gtgtgtctat tcaatcaact gaatattgtt gatgatattt
    27121 actgattttt ctcgtttctt aggaggaaga gagattgaga aaagtgctga gatttgcaaa
    27181 cgcttgtgga gcaatcacga cgactaaaaa gggagccatt ccagctcttc ctacagattg
    27241 tgaagctctc agttttctta agatacaagt agaatagtaa aacttctctt cgagtccaga
    27301 attctccttg tctattgtaa taatctgttc tggattcttc ctgatgattc tgatcatttg
    27361 taatgttttt tttttttggt tctctctctg tcttttcttt ttcttcttca ttgtattgaa
    27421 taaaacagac ttgtgacttc tgagcttttc ttgctaatag aaaacaaaga gtttttcgta
    27481 gttgtttgga accgtaaatt gcattgagga ttgtttctca aggctttgaa aacagagtaa
    27541 taatcaggaa caaacaaaaa aaaaccaaga aagaacagag agaacacatt tagtatcaag
    27601 tttgtagcat caaagcatta agcatagacc atgttcaaga ggtatgaaca aaactcaaac
    27661 acagacattt gttataagct ctcaacatat cttacacaac ttaagacaaa actaaaatgt
    27721 atatgacatt aactccacac atgcagatag gtttcttgtt tgttctttta cattgaagaa
    27781 tgtctacaca tagattacat atagcttttt agccaagatc agggacaatg aagtgttcct
    27841 catcatcatc atcatatctg gtctcaaacc tcggcttctt gtgtgaaaca tttgacttca
    27901 taggtttgta tgaatgaaca tgacctaaat gcgaaacaga aagctcagga acttcagctg
    27961 caggaagagc cttgtcatta atctgatcac cgaagaatcc catgtctgaa aaccaatcca
    28021 actcccctgc cccaagatca agctgtcctt tctgctcaat ttaaaccaag aagtcaataa
    28081 aagcttcttg caaagaaagt gatctaacat tgaatctcaa ttctcatcac taccttgtcg
    28141 gtggattcaa tatcagagaa gtgaaagaaa tcgtcaacag cccagggaag tggagtagca
    28201 gaagaaggtt gttgttgctg ctggcttgtg gatttagcag gaatctgatt agccttctgt
    28261 tggttgttgg aaggctcagg ttgattcttc tcaatttctt tactacatat agttgaggtc
    28321 agagctactt tgatcccagt ggctaagaac ctctggtgat tagcagatcg agaattagcc
    28381 acgtggatgg attcatcgca gtccctgcaa agcagagctc tatcctctac acagaaaatg
    28441 aaagctgcct tctcctacaa gtcataagaa cataatgagc aaaccctagt cttaaacaac
    28501 aaggcataca tacaacagtt gctacaagat ctataaaatc acaactttgc aacagagcag
    28561 attcaaacta acgaatccat aaaatatttg acaagatcta atgagatctg tagagaaact
    28621 tacttggcag atatcgcaac gagggaattt ggtggagagg gaattaagat gaagacgttg
    28681 gtgcttgcta gcgagtttgt tagcggcgtg aatctcgatg tcgcattgag gacagagagc
    28741 agcttcgtcg gcgcaacaaa tcaccgtcgc cggagctttc tcacacacat cacactgtat
    28801 cttcatcacc ggatacaaga aaccaaaata tctaggtttc tcaagaagga aacagaatgc
    28861 ttaaaatgaa gggtttattg ctagtctggc ttctcttaga atagcttagc agaagcgtag
    28921 gttcagagaa agagcttaga gaagatgaaa gaacaaagag ggagagagtg ttttgtgggg
    28981 aacaagtagg tgggatgagc aattggttgt gagtgaaaga gagaagataa ggatttgatg
    29041 aatcttgctt gttgctttgt tttcattatt ctgcgtatca aaaggaaaca ctctgcttct
    29101 tacagcaagg tcttgcgggt cccactcttt ttctgtggct ctccttcttc ctctcgtcat
    29161 ctctcctacc tttagatatt tttattatat tcacactttg ctattttata ttcttgttat
    29221 tttctcacgt agtagagatt tgtgttttgt ttactaatct agtcaaaaca cattaatttt
    29281 gactaataaa ctaacttcaa taattccacc accactagac ttttacgctc cttttatatg
    29341 atatgctcga atttcaagtc tcgtgaactt ttacgatttc aagaaagatt tgtatacaaa
    29401 aatgggcttc atctagaaag aaagagttgg gtaatggtat tactcaaatc agagaatatt
    29461 acacgactac acgtaatctt gaaaatgaca tgtgaattga ttccttggaa tgacgacatg
    29521 ttatgttaat atgtaccatt cgatcagatt tttcttcttc tttcactttt tcgttttctc
    29581 aatcataaaa acgattaatg caatcattaa aaatatactg gcatgttaac taacaaagaa
    29641 atgaatgctt agcccgttcg agaaaaagaa tgatcctaaa agacaccaat acaaaattag
    29701 gcatggttgg tcacaagaat tgttgttgga tatcacatat ccatccatat tagtaaaaac
    29761 caatctatac atctgtggtt tttttaaaga attgacaagt ttttgtttct gttttttggt
    29821 aatgaaatcg aacaaattca aagaattgtg aagttaataa ctcccaaaac acttactgct
    29881 tctgtacatg ttcatccttc tggatgtccc catgagaagt attgttcatg ttggccgtat
    29941 cttgattaag cagattagag aatccatttc caatcgattt ccaccagctc gaccgctctg
    30001 aggtagtttg atcccactgg tcattactgg tgcttgagga cagttcgata gatgtggctg
    30061 actcggtctg cagctcagag aatctcacag ctcctagtag cttttctgga agctctgctt
    30121 cggtctgact ctcaatgagg aacgcaagat caactgtcaa tgtagtaacg tagccaaatg
    30181 cgagatgaac aatggcacta gcgaccattg aagaaccaat atcgacatca atctccacaa
    30241 agttttcccc tgaaacatat ttgcaagaga gtgcacgtcc aatcacacag atcgcttgct
    30301 ctccaacagc ttttctaaca atccaagggc ctttgacaat gtttgcaatc agtttaagcc
    30361 tcgatttctt gaacccatca tctcctttca aaaaccgatc catcagggag ccttcaagga
    30421 taggctctgt ggtaacaaag taagccacag cactgtaatt gtctttgtga ggaagctgga
    30481 gattgaatgc ccagacaaaa ggcttagttc catctttttg aaactcctca tcgataactt
    30541 tcctgattcg gctgcttgga taactcagga tctcagaaag ctttttagga cctttaatcc
    30601 aatcaaaacc cagaggcttt agaaggaaat caccagcagg tatcttaact ttgtcagaga
    30661 aatactttgg tcctctaacc ataaatgtgt caggagatgg cgtcgtccaa ccatttttgc
    30721 agttgtcgtc tggcttaaga catggaacag ctccctctaa tttcactctc ttaatccatt
    30781 ctggctcagt ttcctcacca acagagccag ccatatcttg cgaaaacctg caacacagag
    30841 cttaaatcct tgagtaaaac tgagtgtgga aaacaatctc atggattcta cttagtgaat
    30901 atagcaaaca agaatatgcc atcaagaaga ccaaaacatg tgatcagaaa acagaaccat
    30961 gtatgtctga ggctctatct attcctcatc taatttccca taggattcat actatgccac
    31021 aagaactttt taaaagaaaa gagtgaaaca aaaattgctc aaagaaacaa aaactaggag
    31081 ctggtaactc cggttcaagt catagctaca ccggaaacta gaataaagtt agtaaattga
    31141 ctcaaattct gagtaatgac atcaaaattc agcatacacg attctgagat tttctacaaa
    31201 cctaagccct agattatctg aaataacatg cataccattc aatagacaaa gcacagagac
    31261 agagcccaga taattgaatt ttacattcat ctacaacaca taagaagaaa cggaaaaaaa
    31321 aacgtttttt tttatcaaca gagcaatcaa aacccagaaa cgattaacaa gtttcagagg
    31381 ttcaagagga atcagctaca ataataaaaa ggaaaaaatc aaagttgaga gatacaaata
    31441 acaaaagact aattcaatcg caggacaagg agcaaacaat aaaccttttg cagccgaaga
    31501 agagaagaat tgtccaaaaa ccctaattca aaaacgaaga cttgtcaagg gaaaagaaac
    31561 aaagaagata atccgatttt gctaatcttc ttttgttgtt tggatttagc gttgaaacgg
    31621 atgctgcgaa cagatcctaa attcttccgt ggcgtaacgc tttagttcat atctaattaa
    31681 ttaaacttcc aactggaaat aaggtccaag tccaactagt aattattatt aatagaattc
    31741 aaaataaaaa taatattatt agtttggatt taacaaaaat ttatgattat tatgacaaaa
    31801 aaaatatatg attatttact atgaatatta taaaataaaa ctatatacca tatgattttt
    31861 tccctaatca agtatgagat tatataattc aaactataag atttttttcc cttaattttt
    31921 acacctaatc aagtaaaaag gaaaaaaatt agaaaaagaa aaagaaaagt aatgttagtt
    31981 tttacttttt cctatttttt tttgtcaaaa atcgtcaaaa taaccaaaaa acattaaaaa
    32041 aaaatccaaa ttaaaataaa taaaagaact tttgttttgg gctttccaca tcgtaaacta
    32101 taatcggcgt ctctccggac tcacacctca tcgaaatttg gccatctcat ctggcttctt
    32161 cccctccggc gttggataac catcattact tctcgcgccg gcttcgagtg gaacaatatg
    32221 gatcctcgtc aattcgaaca caccgtaagt ttttctctcc ttgaaatgtt ttatgacttc
    32281 tctctcgaga tttcagaatt ggaataacga tcctgctcaa agatgatcgc acctatttca
    32341 tttgattgga ttatggatta ttctaggttt tcatgagtgg atatgcatta gttatcgtct
    32401 tgtgtattgg tggtggttct tagtatgaaa tagatcttga ggctttttat ccagaattgg
    32461 aagctgtact aatcttcctt agtactgcag tgttatatta agttattgga atctggaaac
    32521 tgtgtataat gtgttattct ctaaagactt ttcttttgtt aaccaggttg ttgctgataa
    32581 tgatattcac agcattgtta tgtcatatct tctgcacaac tgcttcaacg aaactgcgga
    32641 ctcacttgct tcttccactg gagttaagca gcctgcaatt gatcgtgata acatggagag
    32701 aagaaaacgt gagttgtaca agtcatcttt tgttctgctg ttaaatgagt gcttatgcaa
    32761 ttatgtgatt atatgttttg attgattgtt cacttattca gaaataatac attttatact
    32821 ggagaggaag gcgttgaagg cttttgaact aactgaacaa ctagcacaag acttgcttga
    32881 gaaaaacaag gatttgcaat tcgatcttct atgccttcat tttgtggagc taatctgtgc
    32941 tgggaactgg tgagatttta tgattggtct tccattagaa actctggttt tatctgtgcc
    33001 tgtaatctta aaatgattct ctgcgtgtgc agcaccgaag ctctcaaatt tggtaagaca
    33061 agattggctc cttttgggaa ggtcaaaaaa tatgtagaaa agcttgaagt aagtctgaat
    33121 cttgtttgat cctccattat attcgtcttg atgtattggt agattacttg ttatgttctt
    33181 ccaaatgatg gtagatttgt tttttcctga gacaggacgt aatggcattg ctcgcttatg
    33241 aagaccctga gaaatcccca atgttccatc ttttgagctc tgaataccgc caacaagttg
    33301 ctgataatct gaaccgcaca attcttggtc agttcttttt tatttttacc tccacgaaaa
    33361 tctctaccgt cctgtgacct tagcaaatta caagttttaa ctcattcttc aaattatgta
    33421 gaacacacaa accacccgag ctacacacca atggaaagga tcatacaaca ggtgacagtt
    33481 gtgagacaat acttgactga ggagaatggc aaagtaatcg tagtatttca gtatttttac
    33541 tcatatatct gattcgttgt agaagccctg ggaatagtag gtgcctgtgt ttaaacgcta
    33601 tttcatgtct tatgatagga tgcgtttcct ccattctctc tgaaggattc tctcaaaggc
    33661 taagatcgca ggactactcc aaagtttgct aggaggagga tatgctaagc attgtcatgt
    33721 aaatacaaaa agaccttgct cctctctaaa gtttgcaagg ttagtcttcc atggccacag
    33781 gcggggtttc agtttgctgt tacaggagat caatattgtg aaggacagtt tcggcttggt
    33841 ttggtttggt ttggttcagt tctctaccag aagattgttt catcaacttt gtgtgagttt
    33901 agtcgataaa tctgtaatcc atatctttgg aatacacatt tctctttgta actatcgttt
    33961 atgttttgat agaatacttg caaattcaag gttttatttt tagacatcac aattcaagac
    34021 caaatgagac ttttcaagta accaaaatga acaaaaggca aagaatatga atatggttaa
    34081 acgactacag acttggacta aggacccatt tctaaccaaa tgaccaaatc caagaacttt
    34141 ttaagagctt aggatcatac aaagagaaga ttgtaaacta ccaacagacg agaacaaaag
    34201 cttcactaac aacttctaaa tccgcaactt ctaagctgtc ttgtttttaa ctctataatg
    34261 cagtaaatcc caaatccatg agcctgcgat gaaaaagaag attttccaag agtaacttac
    34321 taaattggac attagcacag tctagactca gtcttttgtc aagggagttt cacgatcagg
    34381 cgatgtcaca ctctctttct gaccaggaga aggcatgggt cttcttagct ctgaagcccc
    34441 gctttgttgt tcctgttgtt gaagccgttg ctgctgctga agctggtaca gttgctgctg
    34501 ttgaaagtga aattgctgct gctgctgctg ttgttgttgc tggtgttgct gttgttgttg
    34561 ttgctgtttc tgtgactgga tctggagctg ctgtaactgt tgtgcggcta agatagtgtg
    34621 catcgactga ttattgggat agaattgctg gtttgatcca aaagaaccgt agttcattga
    34681 tgtaccattt gatggacctt gccccgtcaa taccttaaga tgctggactt cctcctttag
    34741 tgcatcattt aaagctgtca aacagataaa gacgattaaa tcaagtagca gcattcacaa
    34801 caaagtgcag cgaatatctc gacgggggac aaatatttat agactttctt aaccagagaa
    34861 atggcattga gttttgaagg tgtatgttta tgtgttattc aagattctgg atctgtattt
    34921 taagctttgt atgaccacaa acatggcata caatcttaca ctgacagatc cagaatgtgg
    34981 tatgtcatat atactacacc ttcgacagtc attgacaatg tttatttgca ttgatagtaa
    35041 agagatgaag aaatatcagc tcctaggaag tatgtgagaa aagatcctca ccatcctgta
    35101 ggtggacctg ttgctccata gtttgtactc gcagtttaag ctcattgttt tcaacaccca
    35161 ggccatttgt atctctctga acacaaggat gaaaagagaa caagattaca accataaact
    35221 tacaaatatc ttagtctaga gttaaatttg gtctccaaac ctgtaagaga gtcaactggg
    35281 ctgagagaga tgtggcctct gtttgtaaag tctgtacttt tctctcgagc tctgcaatgt
    35341 atctcatctt cctttctttt gacctcgcag cagactgcct gtttgcccat atcctatcaa
    35401 atgatacaac atgtcacgca tcttatacaa attcattact agttaccgta atttacgagt
    35461 gagctacttc tagatgaagg gttatgtaaa actccaacag atcagttcag ccaagcttta
    35521 ttctttttag tcaacaaccc tagataatgt ttcaccaaaa actatacaac ttcttaaaaa
    35581 catagaagga aaactgttca gaaaagaaaa aaatacctct tggcgcgttt tggatcaatg
    35641 agagcaagct cagaaagttt agcagcagag atggctttct tagagtcaac tccagacaca
    35701 tcttcattcc ctgacataag catctcaggc ttgatagttg ttgaaccatc catcgattgg
    35761 ctgtgttggt gtctaattct cggtctttca ctagagctac cgggtgtact ctgaaggtta
    35821 gaagtcgagg ctaattcatt cctccaagtc ggttctgatg gctcacccat ttgagaagtc
    35881 gatgtagcag aagaattgaa tttttccata tcaagataca tatagagtaa gtcctcgtca
    35941 gtatcatcag agaaagaagg tccatcagca gcaccaacca caccaagatc actatcaaag
    36001 cttaagtcat caggaagagt aagaatctct gaatgagctc ggcgatggcc taggttctta
    36061 ggtggattat ccggcattcg gctaatatca tggctgaatc ggttagcatc tgagctattg
    36121 cttccacttg gagtcaaagg aggaaaagat gattcagctt tcattgcaaa gctacttcca
    36181 ttaggtgaaa acgcagagta acgacccgat ggtggaggaa gacctccact aggtggtggt
    36241 gcaggagatt tctccttatc catttcaaga acttgaccta aacccactaa tctgcatacc
    36301 atttattccc gaaaaaagat agattatatt ccatactaga acagattagg gtttcatctt
    36361 tagctatcaa attcatttga aacaatcaca cgctttatct cagcgattat attccatatt
    36421 agaacagatt agggtttcgt cttagctatc agtttcctca actaaggaga tacacaaccc
    36481 taaaacaatc acacgcttta tcttagcctt aattcaaaac gaaaacccta aaataagtaa
    36541 aaagatagga tcttttgagt tttcacgcac ttacagagat ctaatgagaa gcctccagaa
    36601 tccaaagcag aatgtccaaa gagagatcaa cgagacacaa aattaaaggt gaagaaaact
    36661 tgaaatttga aaaatcacta aatcagagag atccgacgag agaggaggaa gaagaagaag
    36721 aagaagaaga agaagaagta gaacattctc tctcccatta aaggatcctt cgaactagtg
    36781 tgcatcagaa gatttacggc gtaaacgatg tcgtttaaac gtaatttggt tcgggtaagt
    36841 ggtacttttg tcggaattag ggtgtaatca gctgcgttag cgtgttgcaa tgaacgatgt
    36901 tactgaccgt tggatgatga tcaatatgtc tggttggttc gtgaagagcg taaataaatt
    36961 atttttgtca aattggttca cgtggttgct aatttttggt tggaccgtcg agagttgctt
    37021 gcgaatacta ctactatttt tgatgacttt ctaatttttc ttttataaga aaatactaac
    37081 caggaagtta taaccatgtg atatgttttc aatattatta atgctgacgt acgatttctt
    37141 tcaatcatat gaaaatctaa tattttaaaa gagaaatgaa agagtttgaa accattgcaa
    37201 tttcagtttc ataaaatata tgtttcttac tatttgtatt tgtcaacgct cttataagta
    37261 ctgtgattgt tgttgatttc tggataaggg agcatgggga ctaatattct ttgaaaataa
    37321 tctagagtgg gccatcgttt atgggccgca tggtaaaaga tagggcccat agtactacta
    37381 cccatcacac ttgaccgacc tctctcaccc attgacaatt gaatgggcgt gtttactcct
    37441 ctcaacaacc tcgtctggcc atacttcaat tcaattccta aaattatggg atttgcaaat
    37501 tatttgctag aaatattttc attctaccaa aaaatccgga tattcgtaat aatcaaaaga
    37561 aaaataagta gtaaaatata tagtgttttt tacagtgaat ttttctgcat atattctcac
    37621 gtgaccttgt tggctctata gtcacaagtt aagccttagg gggtacccat aacccatacg
    37681 aaataaggca gcaatatgat gccaattgaa atggtcaggc aagtatatat acaattatgt
    37741 tactcacaaa ggattctcaa atgaaaaaaa gaaaatggtt gaaaagttcc attatagata
    37801 tgtagtttta tagcagagta cgtaatgtag ttttctacaa aataggtgtt attgcacagt
    37861 tttagggttt ggtatcgtca tatattgttc ggcttttttc ttacttggag aatttaattg
    37921 gacctacatt tcgctttcgt attaaataat tctaaatact tactattttt ctggttgacg
    37981 gggatgtaaa atttgagtct acactctaga gtctgctcgt gcatgtcggg tttatttgta
    38041 ttcatgttac tttttagttg cttcatatgt ttctgtagtt atagaaaaat gcttgttttc
    38101 atggtagatc aaagatacat aaaacagtaa aactacctgc tccattatgt acatagaaca
    38161 gcgtgtccat ttttttgtgg agatcaagat gattaactaa aagcaagaaa atcaaacact
    38221 aagcaaattg agatgtcaaa atggtaacca agattgactg gaccatatgt tatttagcta
    38281 gttaaagcat aaacgagaag caagaccatt attaagtacg atacactaat taattagtaa
    38341 cattgttaga aaggtgcaca caaaaaaaag taacattgtt atttttcttc tgaccttacc
    38401 cagacttgtt cagacatcag gtttttacca acaacctatt gggtctcagg ttattctttg
    38461 agtccgattt tttttttatc gtcataaaaa tatatttgaa ttcctttcat tacttgtcag
    38521 ggaaaataat aatgatgaca aaagatcata tgtttttttt ttacttttgc atatttttac
    38581 ttcaatgttt ttatagtcca gtaaaaaagt agcagtggag gttcgaatca atggcgaggc
    38641 atggccttga atggtggcaa aagagaaaga accggattgg acaccgaccc acatcagatt
    38701 tgtcattagg atcccagaaa cagaggaagc ctcattgaga tctgtgattc gtcatttact
    38761 actttttatg ttgtaattaa ccttaataat aggttaatat atataaaaca aaatttgtgt
    38821 tactggtgaa tggtaaagaa acaatgggtc ggaccccttg tggtttttgc aggtgcatca
    38881 ttgacttttt ggtcccaaat ctaattaatg tcttctgtag ttatgacgtt gaatctatca
    38941 cactgtggcc tgtgggttct cttacaatct acgaaatagt tcttttgtag tctatagggt
    39001 ttatacattc tattatttta ttttcaaatc tcctaactta tataagttat aagtgaattc
    39061 aacttttaag tgaattcaat ttttaagtga attcatggag tataagttat aagtgaattc
    39121 aattttcttt aacttataac ctttctgaag tttttttgaa ccaaatgatt tttaaaactg
    39181 ctaatatatt ataatgcccg ataattttag atgaacaaaa atgctagtta taaaacatcg
    39241 ataaagaaat cagctgagat agacaatatt tgccgtttca ttaattactt tgcatgtatg
    39301 aataaatttc acaagaactc gattttttct ttctaagctg agtaaataat gttttcgttg
    39361 ttacgatgtt aagactacga agatgtggat gggttatcat tctgtatgga tgggggaata
    39421 cattttgtgt agagatgttt ccatggatca aaagtcgttt tttcattgtt attatctatt
    39481 catattttga tcgagataca gataacctca aactttaaca tacgcggttg tgtgtatttg
    39541 tgtatataca ttgcataaac ataaaactca ctttttatag attagtgatt ataattaata
    39601 cggtatggtt tggtactcga agttgagctg cctagatggc ctgatttccc ctgtaccgca
    39661 aataatttca tttctttagt tttttcaatc atttctaaac ttttcatatc tgaatgtata
    39721 aagttttttt tggttgtaat aaagttacat tacaagaaaa gaaattgtgg atatgataat
    39781 ttttttcttt cgctctatag tatattattt atatggacat aagaaatact aatgaaatag
    39841 tatattttct gctatttaaa gaaaagcaaa aatatactat ttaattagtt tttttttttg
    39901 tcaatctagt tagtaattct tattgtccaa aaagaaaaag aaaagcaaaa atatactttt
    39961 ttagattgtc caaagaataa aataatacaa taaaattaaa actatcaatt agaaaacatt
    40021 ctattatttt gctaatatga taactatata aaagatttct attaaaagta gaaggtagaa
    40081 cgatttatga aatgggccat ttttctgctg ttgctagcta tgatcatgtt caaagtacgg
    40141 agatatgggt atctatattt gtatatagag tattgataaa tgagtagtga ctatattcta
    40201 tgtacaatgg tggaaatggt ccattgattg atgttttaat ttccttttct ttatttattt
    40261 ttccttcgta tacattttta gacaccgaaa ggaagaaaaa atggccatac acatggtgtt
    40321 cgcatttaaa gaggttcgaa cttacccact atccatgatc catctatcag ccatgctcgg
    40381 cagaaatatt ttaggcattc tgcattgatc atatcaagtt aataaataca tttctaactc
    40441 tcttatcgta taagaaattt ataaaaaaaa taagcttgta tgattttctc catgaacctg
    40501 atatgcattt gcactttgca gtatcttttc gacagcatgc gtttttgact gttctgttat
    40561 tcttaatttc ttattactac gggacatgca tctgttttcc atttctccat atgcctagca
    40621 aaaaaaaaac gaaataataa ttaaatagta gtacatttgt tttttggttt taagaaatag
    40681 tacaagctag agtaagtgca tgtaatatat atatatatat atgtatatgt atgtatgtat
    40741 acataaacat attacatgca cttattaacg aagtcaatat cgagctccgt gtcaggttta
    40801 tgcgtacatg catgatgcat ctatggtttc caataataat aataatatta ctacaacaag
    40861 ttaatgaagt gttatgaggc caacgtccca actgcaacaa tttacagata taatgaaaag
    40921 tggccctgga gaaggaatgt attagctaag cctaagtagt cgttagttcg aacaatttgt
    40981 tcatacgttt cttattttgg tttttgaatg ttaatatttc tttttgacat gaacgacttc
    41041 tcgtcaccat tattacgttt taaaaattca aaaaaattgc ttaacaaatt ttctctaaat
    41101 tattacgcat cttataagcc aacactttca caattgtata ttgtttacag aaaatatttg
    41161 actttacata gtgacggttt tttcgtctaa cttctaccat tcccaacgat ttatgaatat
    41221 cgctacaacg taataaaacc gcgtcatggt taatttgttc ctagtgacga aatatcgcta
    41281 caacgtaata attaaaaccg cgtcatagtt tgttcctagt gagtaaaaat gtttcatttc
    41341 ttcctttttt tttttttgag tttttaattt atttttcaaa tgctttctta gttttggaga
    41401 ttagatagtt gctagataaa gatagtaaga tggcattcat taatttttac caaattttaa
    41461 gtaaaactcg ttcttcttct ctgggatata tgcatgtgct ttgcatatct ttcttagttt
    41521 gaagattaga tgattgctaa aaatctcatt aaccgattct tccttattaa ttcaagaaag
    41581 atatattaat caatatacat gttcttccat ctcgtcctta tttttggaga ttagatagtt
    41641 gctaagtgag aatacgtgaa ttaatatctt ctaacttcaa gaaagagtgg ttttcttctt
    41701 tgggatattt gcatgtgctt tccatttctt ccttatcttt caggatgagg tatcgatggt
    41761 tgctaagcaa ttacactaat taatttcatt cgaactcata taagtttcgt tcattaattt
    41821 attagagata taggagtcct gatgttgctt ggtccaccac atacacaata tagtattaag
    41881 aaaaaaatta ttattgacat aaaacaacat atagaaaaat tcaaactttt tctaacaaga
    41941 agctaacaag atacatggtt gagatatctt gattaaaaag atgattttct attacttcta
    42001 atctccaaaa aataaaatat ttagaaagtg aatctgtttt gaaatggtaa attatattca
    42061 ttaattactt taacatgtta tatcgaagac gaaatgagtg aactcgaaga tgatttcttg
    42121 aatatataaa agtaaacaaa caaatcgtga gaaagagtag aaatgaaggg tctaaatttt
    42181 gttgatatcc gttgctctaa aaatatttgt agtatagtct tgtattctct agattgtcac
    42241 caataagcct aattaacggt aacaaagaaa ccgtacgtgt tcatataacg gcatatagaa
    42301 ggctattcaa aaacagaaat gacaaaatca aagctataaa tatggatgta catatacatt
    42361 gaattagcat ccataaaata aaaaatagta caagattgaa gaattgcatg aaatacgggt
    42421 atgtatatca caatactaaa tcaaaatcga ggtctgtgtc agctttatgc ttacatagtt
    42481 acatgcatct atctatggat tccaacaata gaaatatttt attattttca caccaagtta
    42541 atgaagtgat aacgactacg tcccaactgc aacaatttac agataggata aaaaagaggt
    42601 agcatgcatt agagaataaa ttacggcgtc cgttagtaag tcaattcact ctattcaatt
    42661 ttttaccctc catgctacta taaattacaa cgatactcac tcacaaaacc taaaccacta
    42721 taacactctt tatacaaact tcaaatccac aaagagtctt tttttttttt tctcttcgac
    42781 ttagcttata catagtttta ttacaagatg tcattgtcag cctcggagaa ggaggagaat
    42841 aacaagaaaa tggcagcgga caaggctgag atggggagga agaagagggc aatgtgggaa
    42901 agaaagtgga agagattgga cattgtgaaa gcttttgcat ctctctttgt ccatttcctc
    42961 tgtctcttgg cgcctttcaa tttcacttgg ccggctttaa gagtcgccct cattgtctat
    43021 acggtgggtg ggctcggtat caccgtctct taccaccgaa atttggctca ccggagcttc
    43081 aaagtcccta aatggctcga gtatttcttc gcttattgcg gccttcttgc cattcaggtt
    43141 cgaactagct ctttcatttt tttcccccac aaaatttcca acttcgtagt tgtaaacatc
    43201 tccatatttt cgtaattcta tacttaacag aaatgcaaca gaacttactc attctcttac
    43261 atatttagtt atttttcctt tccaatatat atatgggtta tacgaatcag tcaatctacc
    43321 tgcaaatcca tgttttggac aataatatta gttacgtaat gctacaaatc tttaggtttc
    43381 aacttgttgg ggggatcata attaaattag aaacactcaa ccagtagttc aaagggacat
    43441 cgtcaatctt tatatattcc gttaggtttt ggtcacagtc tagctattat atcatgcttt
    43501 taaattgtta tatttccttt atgttctaat taattagttg cgttaaacat attttaccgt
    43561 ttttcatata ttcgttaata tctacagttg taaaaattca tggaggaccc acccgtaaat
    43621 ccttagattc ttaaaaactt atgatataga ttctataata tctatatatt catgtatttt
    43681 ttttgaacca tgagcattaa tttatttgta atattcatgt gtatactatc tgttttttga
    43741 accatgaaca tttgtttgta ttttgttgta actagggaga tccgattgat tgggtgagca
    43801 cacatcgata ccatcaccag tttacagatt cggataggga cccacatagt cctaacgaag
    43861 gattttggtt cagtcacctc ctatggctat ttgataccgg ttatcttgta gaaaaggtaa
    43921 ttaaccattt gggagaagta gattagttta ctttaatcac aattaaacta ataaaatttt
    43981 gtaatggtac agtgtggaag aaggacaaat gtggaggact taaagaggca gtggtactat
    44041 aaattcctcc aaagaacagt cctttaccac attctaacat ttggtttcct cctctattac
    44101 tttggtggtt tgtcttttct tacttgggga atggtaatat tttatattct ttccctttta
    44161 tttttaaaaa atttcttaca aaaacataaa aatagttaca aataataaat gaaaaaatga
    44221 aagaattcta atttttctat gagtgtaggg tattggggta gcaatggagc atcatgtgac
    44281 ttgcctcata aactctcttt gccatgtttg gggaagccga acttggaaga ctaatgacac
    44341 ttcccgtaac gtttggtacg ttcaaaactt tgatcaaatc atggatataa atatattgag
    44401 tagagaagta aattttttga atttgttact taaattggtg aaatgagagg tacctgaacc
    44461 aactgcctct gtttagaaag tcgatgtgaa tattaaatct tggcacattg tccaagaata
    44521 aacgctcatg acttgactaa acaggaaaag aagtatcatt ttcatcgcag tatagaacat
    44581 atgaaacaaa ttcctcttaa agggaaactt ttcttggacc actccaaagg catttagttc
    44641 accatccata aaccagacat atatgcagat cttttgattg tgtttttgtt tttttttgtg
    44701 tgtggattac tgcatgttaa aaagagtgca ctttatctta aaacaaaagg ataatgtcct
    44761 tactttgatt tttaacatat atatacagta ttagtttata aactataaac gcatattttt
    44821 attttgtata ttttataaaa aaaatataaa acgcatagaa tttttttttt aatgtatgcc
    44881 gtgtttgtat ttaaaactta taaaaataat cttttttttt ttttgctttt ttcgtgaatt
    44941 catatgcata taattacgaa acggcataaa ttaataaaaa taatgataaa taactttgaa
    45001 gaaactaatc aagtggtggt ttaaaatgga tatatatata ggtggctatc agtattctcg
    45061 tttggagaga gctggcacaa caatcaccac gccttcgaat cctcggcgag acaaggctta
    45121 gaatggtggc aaatcgacat ttcttggtat attgtccgct ttctcgagat tatcggtttg
    45181 gctactgatg ttaagttgcc ttccgagagt caacgtcgtc gtatggcaat ggttcgttga
    45241 agatatggaa cgacgtctcg tctcatttaa gcattagtta attaatgtct acgtacgttt
    45301 taagtttttg gtaaacgtaa cacttgtaat attgtgcgat gcggtgttgt tttgtgactt
    45361 gtggtgtgtg tttgaaccaa cttgcttaat taagataacg ttcgttttga tatgagcgaa
    45421 attttaaaat gcgttatgaa gtttatcaat cacggcccac tttttttccc tataactaac
    45481 acaaacatag tactctcata tatatgaacc cgggttatga aactaaaagt tccgttatac
    45541 tttatggtga acctgcagga agattaactg tacgtaacaa gaaaaatagt acaatatatg
    45601 ccgcaactcc ctccctccat attttgttct taataacttt tgagttttga cttttacaat
    45661 agagtgctac tactagtttg taaagaaaaa cataaaccta taatggacag agaagcttta
    45721 attcgtgaat acaatgttcc attaataaga aagttgaaaa ttgaatgtct aagaaccaaa
    45781 ccctaaaagg ctagaacgca accaaaccta aaatgcagta ctttattgat ccctcgtctt
    45841 ctaaagactc caaactaacc gaaaacgtta gagctcgaaa taaatttgcc taaaactgta
    45901 gtatccgtgt ttggaaatta tcgaccaagc agtttgggaa tctcgtgtta agatcaaaaa
    45961 ggtacaattc tttatccttc agtcaaacca attttcttgc atgttaattt ttacgacggc
    46021 tacaaatata ttataattat tgttttcgat attttagccg taatttgaat atctaaacta
    46081 aatttttaaa ctaaatctat gtctagaatt gattgaaaat taaaccgatt ataaaagaaa
    46141 atttgtttcg acctaaatat atgactgaat ttgattacat agaatcaaaa ttaagtaaaa
    46201 ttatattcaa aaaatagaat ggtgagtaca gtattgtgca ttaccttatt ttccttgctc
    46261 gactaaagct aaattaatta acaaatgaaa tacatattat tgtgttctta atattcatga
    46321 tgaggtggat tctctatgaa aaattatcat ttctatgtat gtgatatcat actaactaca
    46381 ataggatgat attatgtacg aaaatttaaa attacatatt tatttttcta ttagctagta
    46441 ttgtgtataa tttaaactga taaacagcta taaaaactgc attaatattt taaatgacat
    46501 ttagttgtta aaaatgacat tgtattttta tatacagcac tatatttctt acaatttaag
    46561 acagatacat acttacacta tatcacaaat atcaaagaaa aaaaaaacgt tttccaaatt
    46621 ccaaaacttt aaacgttaag aggaataaat atgtgtcttg tgtgacgtaa aagcattggt
    46681 aaaaccattc cttaaaacaa atacaaatgt ctcaggttta tacatgtgcc tattatgctt
    46741 aactcttaat tctcggacta accaattaat cgagattctt acgcatatat attaaaaata
    46801 ttatctattt ttttaaaaaa ataggccaac taaatggctt gttgttttcc taactaaatt
    46861 tggagacaag gcaaagacga tgtaaagtgt ccaagtttat gttttcgttg ttaagtagta
    46921 atgattactc aattccaccg atacaatcct taatctccac aacattcagc ttcaatgcac
    46981 caagattagc ccctatataa tcaaaccttt ggtcaatcat ataactctca tatctcaaaa
    47041 ataacaatcc cattcctcga cggtccaatg ggggacacca caaaggacga tgggtctagc
    47101 caaagtaaag cggtgcgtgg ggaaaaaaga gcattctttt tcaggaaatg gacccggatc
    47161 gatatagcga gagcttcggc tgttggggct gtgcatctat tgtgtctgtt ggctccgttt
    47221 aactataaat gggaagctct ccggttcggt gtgattctcg ctatagtgac tagtcttagc
    47281 attacatttt cataccatag gaacttgact cacaagagct ttaagcttcc taaatggctt
    47341 gaatatccat tcgcttactc tgcccttttc gcgcttcagg taaacatata tcgttttgac
    47401 caaaaatatt aatagaacta atatatatcc acaattatct ttgaatcatc ttttcttccc
    47461 agggtcatcc aatagattgg gtgagtacac ataggttcca tcaccagttc acagattcag
    47521 accgtgaccc acatagtcct atcgaaggat tctggttcag tcacgtcttt tggatattcg
    47581 acaccagtta catcagagaa aaggtaacaa aaattttaaa gtctctacaa acccaacata
    47641 tgtgaatcga tcttaagtta ttatgagaac tcacttagaa gatcagtaag taactaaagg
    47701 tgaactatac gtacgatgtt gtaataatgt aacagtgcgg aggacgtgac aacgtgatgg
    47761 acttgaagca acaatggttc tataggtttc ttcgaaacac aattggtctc cacatcttaa
    47821 cattttggac cctcgtctat ttatggggtg gtctacctta cctaacttgc ggcgtggtaa
    47881 gcactctatt tatttttgtg caattaaatt tttgtatcaa ataaaaaatg gattaacgtg
    47941 atgaatattc tagtaacatt ttcttcgttt tgaaataaaa attccgtgat gctacaacaa
    48001 aaaatgaatt cccgattatt ttctaccatt cacgtcattc ataaaaaaat acaagttttt
    48061 ggaaaacagc tctgctatat gtaaacatgc tagaaatata gttactaaaa atagaacatc
    48121 attaatctat ttaaaactat tttctagcat tttatgttat cttgcaaaac ttttttcaaa
    48181 taaattattg ctcttccatt tcacaattca tctaacatac taactattac aaatataata
    48241 ttttcttggc aacagggtgt tggaggaaca atcggttaca atgggacttg gctcataaac
    48301 tcggcatgcc atatttgggg ttcgcgagca tggaacacta aggacacctc tcgtaacatt
    48361 tggtacttaa tttatagacc tttaaacctt aaccgaatct gataaagctt catcaaaatt
    48421 agtattaagt gaatgtgaaa tggtgcaggt ggctagggcc attcacgatg ggagagagct
    48481 ggcacaacaa ccaccatgcc tttgaggcct cggccaggca cggactggaa tggtatcagg
    48541 tagacttaac ttggtacctc atttgtttct tccaagctct cggtttagcc acggatgtca
    48601 aattgcctac cgatgctcaa aagcgaaaat tggctttcgc tcgttagtca caagctctat
    48661 atctatgaat ctatctattt ctttaattat atatgcgtaa tcatcactcg ctcattcgtt
    48721 attttatgta aaacaatcaa gaataatatg ttctcaaaac ttgtatctag ttgatgtaac
    48781 accttctacg tatatttcat gttgtatgaa caatgaaagc cgagataata cattatcttc
    48841 aaacagtaac cgaacctttt gccaaaaaac ttcagatata attcaaaatt ccagagaaaa
    48901 ctcttgtgac tttgacttcg aagtgactcc cttttggatc tctcgaacta aaaataaaga
    48961 actaaaaaaa cttatatgtc aaactctcca aaatttttaa cctcgtatat atcacgtcac
    49021 gagtttaata gaacttacca accgcttcat tcacatatta aactatatca aaaataaaaa
    49081 tcacatattt aatttctttt cttttgtcag ttctataaat atggtcatgt tggatccacc
    49141 cgcaaaaccc attaacagta attttagttt taaaaacccg cctagatttg agctagtggg
    49201 gtctcattaa aatttggatc actcaaccac actagtttag aataattagg gccatactca
    49261 atctttataa taccttagat ttggtcagaa tctagctatg atattatgct ttttatattt
    49321 acttttgttt tagttagttg aattaaccgt tttatttata atcaagatct acgtttgtat
    49381 gtgctggcta tgttgtagtt agttgagtct caaatacatt tattatctca tttttaccat
    49441 gaatatttat gttgtttgct attgtaacag ggagatgatt catcaaatat tcaattcaag
    49501 gatttggttc agtcacctcc tatggctatt tgacactgct tatcttgtag aaatggtaat
    49561 taattattgg gaagactaga ttagtttact ttaatgacag taaaatatta atatggagga
    49621 cttgaagagg ctgattttga tcagtcgatc aacaatataa tcgctaattt tgaatttatt
    49681 gcttgaattg gtgaaatgag aggtgctcaa ccaactattt ctattttaat cttggcacgt
    49741 tatccaagaa aacgctgaaa gtaataaaca agaaaaatgt agcattgtcg tcatcggaca
    49801 tacaacagaa cacaggtgaa acaaattctc aaaggggaaa ttaattggac caacacaaaa
    49861 ggcaattatg ttcaccatcc aaaaaccccc cataaagatt actttgattg tgtgttcgct
    49921 ttttggtggt ccattttact agcacatgtt aaaaaaatta taatgttaat tttagttatt
    49981 taaaaatata aatgttcttg atgtttaatt tttagcaagt attatttcct aaaatgacac
    50041 aaataacttt tgaaactgtc ttccgtgttt gcatttagtt tttataaaag ataattatag
    50101 tttttaaata aatgtatata aaattcattt aatccaaaat tttacaaatc atcatcacta
    50161 actaataaaa atgcattaaa aactgaaaat aaatctacat ctctttcttt gaaacagttt
    50221 tttttttgtt tctaatactt ggattaatta ggaaaaggag atatgttatt catattctaa
    50281 atttaaatat gaatgactaa atatatttat gtactcaatt cattaaaaaa tatactatat
    50341 gcaaaagaaa tcaatatctt taatgtgcta tataaaaaca tgtgaaatat agcaacgctt
    50401 ttttatattt agaaaacaat cgacctaact aaattttcat tttggagacg aggcaattta
    50461 agtacgagat aaagtgtaca agtttattat ttcgctgtta ggtagtgatg attatttttt
    50521 actcaaattc accgatacaa ctcttactct ccccaacatt caactacaat aaccaactct
    50581 tttccctata taagcaaacc tttggtcaat cataactcaa atatctctac tacataatat
    50641 ctcaaaaata acaaacccat accttgacag ggtccgatga gtgagaccac taaggacgat
    50701 ggctctagcc aaaaaaaatc agtgcgtaag gaaaaaagag cgtatgtttt aaggaaatgg
    50761 acccagttcg atgttgggag agcttcgact gttggaaccg tgcatctgtt gtgtctattg
    50821 gctcctttta actacaaatg ggaagcattc cggttcggta taattctcgc catactgaca
    50881 aacctctgca ttacattctc gtaccatagg aacttgactc accggagctt taagctaccg
    50941 aaatggcttg aatatccatt cgcttattct gctcttttgg cacttcaggt aaatactgtt
    51001 aattttaacc gaaaataaag atgaaactaa ttaaatcctc cattccaata tgtatcctca
    51061 actatctttg aattgtttct cttttctttt cttttctttt cagggtgatc cattggattg
    51121 ggtgagcata catagattcc atcaccagtt cacagattct gaccgtgatc cacatagccc
    51181 tatagaagga ttctggttca gtcatgtttt gtggatattt gacaccgatt atatcagaga
    51241 aaaggtaaca aaacttttta catatctcca caaacccaac attttgtgaa tcgatattaa
    51301 tttatttgag attataatag aagatctgtt gtaattaacc aaaggcggat gttgtaataa
    51361 ttgtaacagt gtggaagacg taacaacgtg atggacttga agcaacaatg gttctatagg
    51421 tttctaaaaa agacgttggt tctccacatc ttagcatttt ggaccctcat ctacttatgg
    51481 ggtggtctac cttacctaac ttggactgtg gtaaactctc aatttacttt ttactattac
    51541 tttgtttata tcaaatggaa atcggattat acatgatcaa ttttatacta ctttttgaat
    51601 gtacgtagcg aaatatcacg atttttcact attgaagaaa atttcattaa ttgataaatt
    51661 aaaacgtttt gtgatttaca ctgctgctaa caaaaactta tttaattttc attttcaatt
    51721 atttcattat tcctctattt cactacgttg gaaaacaggg ttttggagga gtaattggtt
    51781 accatgggac ttggctcgta aattcggcat gccatatttg tggttcgcaa gcgtggcaaa
    51841 ccaatgacac ctcacgtaac gtttggtatt ttatataccc tctctattct ttatagacca
    51901 ataaaccttg atcgaaatag ataaacctta accgaaacta aaattgagtg aatgtggaat
    51961 ggagcaggtg gctagcgcta ttgactatgg gagagagctg gcacaacaac caccatgcct
    52021 ttgagacgtc ggctaggcac ggactagaat ggtatcagtt agacataact tggtacctca
    52081 tttggttctt ccaggctctc ggtttagcca ccaatgtcaa attacctacc gatgctcaga
    52141 aacgcaagat ggctatccgt cgttaatctc aactctaatt cgatctattt cgttacttat
    52201 atgtactcat cattcactct tttgctattt atgtaaaact gttaagaata atctgttctc
    52261 atgaacttgt aaaccagttg atccaacacc tttattttat taggacattg catgctgtac
    52321 ggacaaagca aacgatacaa caaattatct tgaaagagta acgaaccttg tgccagaaag
    52381 agttcagaag atgtagtccg gtaactccag aggaaactct acgactttga cttcgaattg
    52441 actccctttt ggatctctca aactaagaaa aaataatcat aaggtcaaga ttccagttta
    52501 gtttcaaaac tacaagacat gtggtctaag attcttcaca tcatcatata ccttccaggt
    52561 acaaaggtga aagagccatc aatggatcca gcagttgtcg gaaaactgga acaactctca
    52621 tacacaaact cttcctcccc ggcttgtaag agcgggtact acaaatataa caaaacagag
    52681 ttcatatcac aaaacggaaa acgactgttg gtccttcaac aaacaaattg ttgttatctt
    52741 gaactaaaag caaaactaca cctttcctat gacagcttct ccattaacat tatctatcac
    52801 ttcattatca gctcggataa cccaatgtct ccaatacagt tggcaagagc tatgatgtgt
    52861 cccattcaag atgcatcctt ctggcatgag agacatccgg attgaatatg cataccagta
    52921 tgccggtggc tgatcccgaa ggttcgatat ttccgggata aaaacagacg aagcacgtac
    52981 ctgcattatt catgaacaag cttttcaacc cacaatccac aaacctgaat atcaataaaa
    53041 ctgaataaca cattgcttta cctgcacacc attagttacg gagacagaac acaagggagg
    53101 aatctccggg aacaaactga tactcttgac attgttctgt tgacggacat ttatagtgcc
    53161 ggtttgtaac cgccggccat gttcttccaa ccaaagcagc atggcatcct gttgctgatc
    53221 gccgttggta tcatgaaccg atctaaccaa agcatcgggt acacaaggaa gcaattggcg
    53281 gttacttgtc ccagtaaaaa gctgtccggt tgtgcagtct aataaaaata ttttcagact
    53341 ggcaactacg gatgcagcca taacaataag gtctaatcta ctcgagaaac cgaggtcgcg
    53401 catgaaactt tcctttgtct ccctcatcac ttccttaaga ggtagcaagt agacattaac
    53461 gtcatgagaa taagcggaat agccacctat aagccccaaa gagccatcaa gcccattggg
    53521 ggaagaaagc tcttgaccat caacgaaacg gtagagaagc cttgtgggca aaggaagttt
    53581 cactttgaga gaagtctcga attcttgaag atcatcttct gtgacacctt tcctcagtgt
    53641 tgcctttgct tcagggaagt ttaaggtcaa ccattgtttg aggttgtccc aacaaagtct
    53701 aactctttta accagattcc aaggatacat tctaaatgac tccctccaca attgatatgc
    53761 tctctgatga attaagagaa aaatctttac tttaaggtag tctcaaattc aggtcaaatt
    53821 ctaaggcgct aaacaatcaa aaccctagaa aatgtgaaaa gaagaaaaga gtgaaattga
    53881 ccttgaagga aggagcagga tctccatggg gatcgagagg agtagagata ttaagatcat
    53941 tggagcagaa gatagaccag agagattcct cggaggcgga gaccttaagg cgtttactga
    54001 cacaagccac tctcgcggtg ttttcagggc cgattttgga taagacgatg tggagaacca
    54061 aatctccagc atcctctaga cccatagctt tcgtcgtctc agacaacaac ccttgttcgc
    54121 tttctttctc tcggttgctt ttgtcggctc tgtttcagtt cagttctttg gattgtttca
    54181 atcaagaact gaaagaaaca aagcattttt gattacacgt ggcacttgat attacagtga
    54241 gttaatacaa aattcgaggg tacacattaa agaagaaact tggggcacat agggaccgta
    54301 ccataatggc gcaaaaaaaa aaaaaaggga ccgaaccaca aaaaaatcat tttgagtatg
    54361 accatgaaaa gttgataact gctaggagac atcatcatct gtacagagga accattcttg
    54421 tttatttttt ttgctaagct ttgaaattgt cctttgctgt tcttataata acccagagct
    54481 tctgcttcat ctgctcttct tatcgaatac tacctatccc aagttgcatt tgtttatgtg
    54541 atcttttaaa tcatattaac aacaacagtt tgaatataga catagctaac aatcatttct
    54601 tttaggaatt gatcactaat tatcttagtt gttgttgatt cagctggtac gtgattcatt
    54661 cttgataaca taatacgagg ggatggtgtg gaaaacaact gtacatgtgg ttccaaaacc
    54721 aataaaataa aaaggaatat gaagaagaga acatttgata ataacgaatg atatggtggt
    54781 tccacacgaa cggaaagtca aaaggggttt attaataatt tatttcaaca cgagaataag
    54841 tgaatgtgat gatgatgatg gtataacgat aatcaaatgc ccaaaataat taaaatccta
    54901 cgaataatga agagcttctg acttggtaca catactcaaa ttctcttaca accgaaaacc
    54961 aaaataattt aaaaagcaaa agcgctgact ccaccctggc tctctaaacc aattacatcc
    55021 catatataat caaacgtcct ttggtgatca atcatatata taactctcat atctcaaaaa
    55081 taacaaacgc attccttgac gacggtccaa tgggggacaa aaataaggac gatagctcta
    55141 gccaaagcaa agcagtgcgt aaggaaaaaa gagcgttcct tttcaggaaa tggacccggg
    55201 ttgatgtaat gagagtttcg gctgttgggg ctgtgcatct attgtgtcta ttggctccgt
    55261 ttaactacac atgggaagct ttccggtttg ctgctatggt cggtatatcg actaatctca
    55321 gcattacatt ttcataccat aggaacttga ctcaccgaag ctttaagctt cctaaatggc
    55381 ttgaatatcc attcgcttac tctgcccttt tcgcgcttca ggtaaatata tattgttttc
    55441 accgaaaata ccactataac caatatgtat cctcaattat ctttgtattt ttttctccca
    55501 gggtcatcca atagattggg tgagtacaca taggttccat caccagttca cagattcgga
    55561 ccgtgaccca catagtccta tcgaaggatt ttggttcagt cacgtctttt ggatattcga
    55621 caccagttac atcagagaaa aggtaacaaa atgtttaaag cctttacaaa cccaacatat
    55681 gtgaatcgaa gttatcatga gattttaata ttagaagatc tgtgagtaac taaagacgaa
    55741 ctatgtacga tgttgtaata atgtaacagt gtggaggacg tgacaacgtg atggacttga
    55801 agcaacaatg gttctatagg tttcttcaaa acacaattgg tctccacatc ttaacatttt
    55861 ggatcctcgt ctatttatgg ggtggtctac cttacctaac ttggagcgtg gtaaatactc
    55921 tattttatta atgtgtaatt aaattttcgt atcaaataaa aactggatta tatgtgatga
    55981 gtaacctttt gttcgttttg aaataaaaat tccgtgatgc tacaacaaaa aatgaattcc
    56041 cgattatttt ctaccattca cgtcattcat aagaaataaa tgaaaaacag ttctgctata
    56101 tatgtacaca tgctaaaaat ataataaaaa taaaacatca ttaatctttg taaaactatt
    56161 ttcgaagcat tttatgttat cttgcaaaaa aaaattcaac tgttttttgc tctttcattt
    56221 catccaacat actagctata tatcacatat atgatatttt cttggcaaca gggtgttgga
    56281 ggagcaatcg gttaccatgc gacttggctc ataaactcgg catgccatat ttggggttcg
    56341 cgagcatgga acactaagga cacctctcgt aacatttggt acttaattta tagaccttta
    56401 aaccttaacc gaatctgata aagcttcatc aaaattagta ttaagtgaat gtggaatggt
    56461 gcaggtggct agggccattc acgatgggag agagctggca caacaaccac catgcctttg
    56521 aggcgtcggc taggcacggg ctggaatggt atcaggtaga cttaacgtgg tacctcattt
    56581 ggttcttcca ggttctcggt ttagccacag atgtcaaatt gcctaccgat gctcagaagc
    56641 gaaaaatgtc tttagctcgt tagtcacaag ctctatatct atgaatctat ctatttcgtt
    56701 aattatatgt gtaatcatca ctcgctcatc atttgttatt ttatataaaa ctatcaagaa
    56761 tgatatgttc tcaagaactt gtatccagtt gatgtaacac catctaagta tatttcatgt
    56821 tgtatgaaca gtgaaaaccg atataataca tgatcttgaa acagtaacgg aaccttgtgc
    56881 cagaaaactt caaaagatgt aattcggtaa cttcagagaa aactcttgtg actttgattt
    56941 caaagctact cccttcaaaa gatccaaaaa caaataataa caaaattcga gggttcatca
    57001 aagtagaaac ttgggtactt aggaccgttt gatcaaaagg aaaaaaaaaa tcatttcgag
    57061 tatgaccatg aaaactacta ggagacgtaa cgtcacggtc aaaactcaaa acaccttatt
    57121 acagattaaa ccaggatcgc atcatcactg tacagaggaa ccattcttat tatattttag
    57181 ctaagctttg aaattgtcct ttgctcttct tataataccc agagcttctg cttcatctgc
    57241 tgtctctgga atacctaaag ctcgacggat atctgtgttc tcagtgcgga gaaacgggtt
    57301 acaagctttc tccatcttca tcgtcgttgg aatctgagat ttcccagaca cgaaattaat
    57361 caagaaaatc tagaatccga gtccagaagt cataatttca attactttgg atatatatta
    57421 tcaatagcga cagaagaaac atcaatgaca gtgaagttac tgaaatgaaa gaaagattac
    57481 cgttggtaat ttcttgtcac ggagttctgc aacgtaggct gcataagact ggagcacttc
    57541 gtttgttggt tctatagaca atgcaaactt ggaattactc tgccagattg aaaatgattc
    57601 catcagaagc gataacacat gtgtggtatt tgtatattaa aaacacacaa taaagataac
    57661 aaaccagtgt atattcatgg ccacagtata cgcttgtgtc atctggcaac gcaattatcc
    57721 tctgtagaga agctagcatc tgcagcaaaa gatgcagatt gttgaaaacc aattaaaaca
    57781 actgacactt aataaagtca agttcagaga gaaccaaaga ttagataaat gatgtttacc
    57841 tgctctggag taccttcgaa gagtttacca catgataagc taaacaaggt gtccccggtg
    57901 aaaattgctc gtgcccctgg aaagtagaaa ctaatatggc ctacaacaga aaatgggaca
    57961 ttaaaatggg gacaaggctt aagcatatac tgtgcatagt ttatgtttga ggaaccgaaa
    58021 ccagcaaatc ttcaatagtt attgagagaa gttaagaacc taatcaacta atcacagggc
    58081 caagggaaat acagagttct tacttcttag agcatcaaag aatattatga caaaagcaac
    58141 acttattaga atagaaactt atttctgtga atctttcaaa atatacaaat tcttgaggct
    58201 caaaatgtta tttaatacta cagaccagta aactatacag gtctcacaag taggatatat
    58261 ttctatattt caagcagtct gagaagaaat cccccaacac attacatact cctcgagtta
    58321 taaacaattc tgaattctca aagcattatg tagaaaaaat gaatgacata aaaatatgga
    58381 ttggataact aaactttgaa ctagtctgaa ccagaagtat ataaactaaa cactgaaagg
    58441 aataaactat ccatttaaga tggcaagtat tcaacctctg gtgtggccag gagtttccat
    58501 aatatggact tcatggccag caaacatcca tttgtcagca tctttcaagg ctacatcaat
    58561 tccaggaatc cggtccctat ctgcagctga gccgatcacc taagtacatc caccaatata
    58621 gtgtgcaatt aataattaca acaaaagtct ttgaagcatc tccacacaat atggacagag
    58681 agagagagag aagtaagatc cgcctacctt tgcaccatac ctgtctttta attccaaatt
    58741 gccaccagtg tgatcataat ggtgatgtgt atttaatata taagttagat ttcgactatt
    58801 cttctggagg gcatccataa caggtacagc ttcagaaggg tcaaccacac caactgtacc
    58861 ggtatcctca tcatgtaaga tataagcata gttgtccgta agacatggca cctgaaaaga
    58921 agaattgtta tccgcaagac tgctaaacaa gcttgttgac ttgatattta agacacaaat
    58981 aaatgtgcag ctgaggaaac ggttcaagta atcactagtt tacaagttgt tgtttgttgc
    59041 aaagacagaa aaaccattta caagatgaag ccattatttt aggacaacaa aagaaataaa
    59101 aaggaaggaa aagcaaacac acaaaccagt tcaatttgca atgaggaaga gacattggag
    59161 acactgcaga atcttgaaat gcgaacggat ttaccagcat cacgcaaagt cctaagaggt
    59221 gaagagaaca gcttcatgac accagagaca agaccctttc tgacgtgaag ctgtctcacg
    59281 caaggcctca cacatggctg actaactagc ttctgataaa catatagata agagcagaga
    59341 ctaatcaaag atatgaacaa caatattgaa aaatattcat acaagaaaag tcacagccaa
    59401 gactcataca agaaaagtct cagagaagct ttgagtagaa gctagtgtga ttttaaaaaa
    59461 aaaaaagaaa aagtgtacaa ccagatttct caattcataa tttcaccata aacagagaaa
    59521 gttcattaac tgaaaaaaaa tccagtcgta aagaagtaag taacttgtat aaatccaata
    59581 agctataacg catcgaatta aaatagagat ttaagaagaa acaatcaaga gtatctaatt
    59641 tttcgaacag aggagtgaac cctaaaaaat tggtgagtaa tcggacaatg agattggagg
    59701 aaatgattca gcacgaatta aggaaataca aaccctagaa catctaaaga atgatgctgc
    59761 agaagaaact ttggagatgg cttgcatctt tctctctcga ttgcccaatt ctgtccaatt
    59821 ttgttataga gagagagaga gttctacaca aatctctgtg aactgacaac agaaactgac
    59881 ccaagtgacc aagtcagtca cactactact aaaccgaaac caaaccaaac caaaccaaat
    59941 aatcagggag gcgtggtcta atgattatta agtaaaccgt atgatagata aatacataaa
    60001 ccgatatttg aaataggtta atagtgtagt ttataaattc atcctatata taatcttttc
    60061 ttagaaattt atgtaagaaa atatagttta tgagttcaca cattcacgta tttttaaaaa
    60121 ttataaatta gaaaacaagt tttgactttt aaatatacaa tttaggattt tacacatgca
    60181 tgtgtatttt tcctaggact ttccaattcg gtaatacata tacgtacgcg gcacgcagaa
    60241 gtacacatcc ggtgtaggca ggcgcgttcg cattatctta atttgctagt ctgttcataa
    60301 ttcgtaacat ttagtttatt agtattttgt gcctttgacc cgaaacgtga cttttacttc
    60361 tcaatcattg tagtataatt aattttaatt acatctcaat aattatataa caattaacaa
    60421 ccctatgttg aaatacacag gagaagagta tttttttttt tctttaatgt taaaagaaga
    60481 aaactatctg attggaaagt aaacaataac atagactatc tgatgaacca agcttaaacc
    60541 ggaattctga tctggtcttt tgcggttata atctgccttt tagtggtgta cggccgagaa
    60601 ccgaccgagt cgtacgtgta gtaacttgtt tgatcagttt cattgttcaa atgtcatcat
    60661 tagtcccaag taaagtcaag cctcgatagt ttcttcaatt cttgtcaaac cattattagc
    60721 cacccccaac ataccttgta tatatacaag ttatagagcc acttatatat ataggagata
    60781 caaaattttc aaacccatgc aaaaatgact ttttcaaaaa aagattgtag caaactagtt
    60841 atcatcatcc attgcaaaat tgtaatgggt gacaggatga gagtcataat tatgtaagca
    60901 tatcacaaat taaatctaac tatactcctg tcccaattag ctagtgatga acgtagccgt
    60961 cacactagct agagtaaatt ccatatataa aatcgaacat gcactaaacc aatctagacc
    61021 gggttatgca atttctttgt tttgggtata ttagatggag acacgtgcta tttgttcggg
    61081 acacgaagag gcctttgtct aaatgcgatc gcaaagtgga aaccgtgtta tagtgactcg
    61141 tttgatcaat tcctacgctt gttttatcaa atatttgaaa gccatttgtt tttgtagtaa
    61201 agtcaaagtc aaagatatat atacatacat atacaagcta gtgaggatga tcccaaagtc
    61261 aagccatgag gtgttgacca ataactctac atatatatat atatatatat atatatagac
    61321 ttaaaatgaa accccatgca aacaaaaaaa ggcctacact ctacaaccaa ttttacgtgc
    61381 caatacacac agaaaaacaa gtcagattat ttttttcttt gaggaagata ttgcaagagt
    61441 acgatcgagg aagatgaaga gacaagtaat gatctttgtt atgttagttg ccttttttgt
    61501 tgtattcttg gacgtcaagc aagttgaagc aatgaggccg ttcccaacag ctgccgatga
    61561 gatccggttc gtgttccaag cactgcaaag gggtccagtc agcgggtcag gtccaaatgg
    61621 ttgcaccaac attccccgtg gtacacctag gtgccatggt tgagtactga ccgggcactt
    61681 gattcttctt cttgaaacgc aaccagagat tcttggattc tttattattg tgatatatgt
    61741 aaatttgttt ctactagaaa tcatagccga aaacaatatt aaccttttat actttacacc
    61801 gcaatgtaaa tttgacaaat taaaaaaaga tggtgtaccc acatatatgt tttttcgtca
    61861 gtaattaata accattatat tatcataatt aacctgggtt aatacgagtg tgtcatgaaa
    61921 tttgtttaat taataaccac aaaattacca tagcttggtg tatgagtgta tcatataaaa
    61981 tgaattataa tcgacgtcat gtgactcatg ttccaatcaa aactcgaact attagaaaat
    62041 ttctctccaa aagagtgtgt catgaaattt gtttacttag ccagtaataa ccacaaaatt
    62101 accatagtat gtcatgaaat ttggtaatta tatgatactc gacgtcatgt cccaatcaaa
    62161 actcgaacta taagagaatt tctctacaaa atagagttag ttgtgtctac actatagatc
    62221 acaaccatta aatttcttta atttacgatc acaatcatat ttctgcgatc gtagaatact
    62281 ttctttttga aaaagcttct tcaagaaaag taagatcaga caattataac ttaagaaaga
    62341 ttttagtttt gtttaccaat atacaatttc acaaactgca gtcttaaact cttaatactg
    62401 ccatcttgac cggcattata atctggactt gcattcataa attagcagaa agattcttaa
    62461 aataaaaaat ataaaccaaa aagttacatg tttaaagttc ataaaacaaa aaagaatagc
    62521 taatctcatc aactagtttt ggcaaattta ccaagttaat gaatacatac atttgctttc
    62581 acatgtgcta caactgcgtc aaaatagaac caatacacaa aacaatattg tgtttattac
    62641 attaggcttg aaaaaattta aagaatgtaa acccagactc acgtgaccgc tcacgggcga
    62701 caagtgccag aacctcctgg gatgtttgtg caaccgttcg gacctgaccc tataacctgg
    62761 cccctttgca gcaactggaa cacgaatcgg atctcactgt cggcttgaag cggcctagcg
    62821 gcttcgactt gtgtggtgtt caagaaaatc acgaatagtc cgagcaaaat cactccaagt
    62881 attaattgtt tcttcatttc tttctctttt ttgtatgtat tcaaagtgaa caaaagaaac
    62941 aatctttttt tctgtttgtc gcgtaaaagt tgttgtatgt cttttactcg ttgtttgtgt
    63001 tgtatcacat ttggttcgat aatgacttat atatataggg cttatgatca tggttttgat
    63061 ttgatcgtta aattggtatc tttgtgtgat tttggtctta ctaagacatt cttgtggctt
    63121 gacttttact aggaaagact tggttttcaa catttgaacc caaactatag gaattgatca
    63181 aagaagttaa gacacatgac acggttattg ccttggaccg caatgtatat acattacaaa
    63241 gaaacctgaa aaaggtgata aagtgataaa ctaaattata tttacgtttg taaaacagat
    63301 tcccgtccag tttcagacca aaagtctact aaatctatga actcattatt aggacttaat
    63361 ttatttatct tgattaacgt taggttttga agatttagtt ttgtactttc ggtgagtctg
    63421 gtatatgata gttgttgtaa caagatagta gccagttaaa tcgaagcatt ggggtcgatt
    63481 caaaaaacgt attccaatac taggtacaat tcaattattg actctcataa gttgtttttt
    63541 tgcaatattt atgacgcaat tcatattcga atttgggagg tgaggatgac acgataacac
    63601 caaaaaaccg gaaccactaa gcataagcta aggaacttgg aaatggtcaa atgtctcaaa
    63661 aagggaaata atttttaaaa aaaatcaatt ggcaagtttg attcagtctt taactcttaa
    63721 aagtctcaac gaaatagaaa ctgaagacat aacactggtt ggtacttgag catgtgtgta
    63781 tatacattat taacactaaa acttcacaga aattcttgct aaactcattg tgacaaataa
    63841 agacataatt taatatttca agccattttt ttttttgctt aaattaaatt tattgacttg
    63901 tgtggcgcgg gtaacataaa tttgactttt tttttgccgt cgatgcttcc ggtgaacaga
    63961 gccagagctc ttttaacaat cctgagccaa gccaaaacac taaaccatac tcagcaagtt
    64021 cacgccaagg tcataatcca tggattcgaa gatgaagttg ttctcggatc cagtctcact
    64081 aacgcttata tccaatcgaa tcgtctcgat ttcgctactt cttctttcaa tcgaatccct
    64141 tgttggaaga ggaatcgcca ttcgtggaac acgattctct ctggttactc caaatccaag
    64201 acttgttgtt atagtgacgt cttgcttctt tacaatcgca tgagaaggca ttgtgatggc
    64261 gttgatagtt tcaatttggt atttgcgatc aaagcttgtg ttggtttagg gcttttagaa
    64321 aatgggattc tgattcatgg cttggctatg aagaatgggt tggataagga tgattacgtt
    64381 gctccgtcgt tggttgagat gtatgcacaa ttaggtacta tggaaagtgc gcagaaagtg
    64441 ttcgacgaaa ttcctgtcag aaactcagtt ctttggggag ttctgatgaa aggatatttg
    64501 aaatactcga aagacccaga agtgtttcgt ttgttttgtc tcatgagaga tactggttta
    64561 gccctcgatg cgcttacctt gatatgtttg gtaaaggctt gtggaaatgt ttttgctggt
    64621 aaagtaggga agtgtgtgca tggagtatcc attagaagga gctttataga tcagagtgat
    64681 tacttacaag cctccattat agatatgtat gtgaaatgta gattgttgga caatgctcga
    64741 aaactatttg aaacaagtgt tgataggaat gtggtaatgt ggactacgct gatttctggg
    64801 tttgcaaagt gtgagagagc tgttgaagca tttgatctgt tcaggcagat gctacgagaa
    64861 tcgatacttc caaatcaatg tactttggcg gccattcttg tttcttgctc gagcttggga
    64921 tctctgaggc acgggaaaag tgttcatggc tacatgataa ggaatgggat tgaaatggat
    64981 gctgtaaatt ttacatcgtt catcgatatg tatgctagat gcggaaatat acagatggct
    65041 cggacggttt ttgatatgat gccagagaga aatgtgatat cttggagctc gatgatcaat
    65101 gcttttggga taaatggtct gttcgaggaa gctctggatt gttttcataa aatgaagtca
    65161 caaaacgtag ttcccaattc tgtgacattt gtttcgcttt tgtcggcctg tagccattcc
    65221 ggaaacgtca aagaaggatg gaagcaattt gaatcgatga caagagacta tggggtagtg
    65281 ccggaggaag aacattacgc gtgtatggtg gatttgctag gtcgagctgg tgagattgga
    65341 gaagctaagt ctttcattga caacatgcct gtgaaaccaa tggccagtgc ttggggagct
    65401 cttctgagtg cttgtagaat ccataaagaa gtcgacttag caggagaaat cgcagagaag
    65461 ctcttatcca tggaacccga gaaatcaagt gtctacgttt tgctttctaa catatacgct
    65521 gatgctggga tgtgggagat ggtgaattgt gtgagacgga aaatggggat caaaggatat
    65581 agaaaacatg tgggacaatc tgctactgaa gtcggctaga acattttgct atggatttct
    65641 gcatcatggt tttgacagat gatggaaata tgaagcacca tgacagaaag atgatggaaa
    65701 ttactgtgaa atagttattt ggaaaacttt ctaaatccaa ggtttcaact ctctgcgatg
    65761 aagatgagag attggattgg attggtacga gactacgagc tggttgttgc tgaagtcaaa
    65821 agtcactgtc ataagatgcg ttgatattct tagaacaatt gaagaggttt atctctctct
    65881 ctgttacaag gatcttagct tagccaaagc tagttgcgcg gtgtattttt cacgtgatta
    65941 agcttgcaat ttgaaatgtt gttaatatat ttggttggta tttggatatc aatagagaat
    66001 ctgcaaagac agcagtaatt ttgggaaggt gacttgggga tcaaagtctt ctcatggtac
    66061 atattgtaga catctttaca ttttctggct tcaaaacatt ttgtaagatt tcagtattaa
    66121 caatttgttt ctcgaaaaga tctcagcctt ttagaacctt acttgtatta aaatcttgaa
    66181 taatgctgca aattgcgagg atgcagtttg atctatctct ttcctacttt catgtaaaca
    66241 aagctttcaa ttatctaaga aagttttggt aagtcttaat atacattctc agtttcctgc
    66301 acatatccag ctaatcccat ctgatcatat atctcatcaa gcagcaagca aacctcatct
    66361 gaagctgagt gagacttatc agctgcagca aacagatggt ctcgtttatc tatccgaatc
    66421 gaacttgtcc caggacatat cttttctata cccaactctc tcatccttcc cctaatctct
    66481 gcaacatctc tccacctgtt ttgttctgca tacatgctaa ctaaaaggaa ataataccca
    66541 ctattcatcg gctccaaaac catcagtttg ttaaacgcta tttcagctat cacgagattc
    66601 ttgtgaattc tgcacccatc aagcaaggcc ccccagataa ccgcatttgg ttcaaattcc
    66661 atatttccaa tcaattcaag agcctcatag atcaacccag ctttgctgaa tagatgaacc
    66721 atgcctccgt aatgttcaac attagagaca atggaatagt catcaatcat gctgcgatat
    66781 atcctccgac cttcgtcaac aagacctgcg tgagtacacg cagtaaaaac actcacaaaa
    66841 gtgactgcgt taggtttcac cgactccatc tccatcttgg caaacatttt cagtgcttct
    66901 tgtgcaaaac catgagccgc cagtccttca atgatcgaat tccaacaaaa tagattcttt
    66961 ttgggcaaat tgaagaacac cagaagcgcc cgctctaagc taccacattt ggaatacata
    67021 tctaccagtg cagaaccaat gtagacatca agaacaaaac cgttctgtaa cgtgtacata
    67081 tgaacctcct tacctatttc cagcacgccg agatgggcac aagctgaaat aacagttgac
    67141 atagtaacct catcaggaat gatgccctcc tccatcattt tgtagaacac tgcaattgct
    67201 tctctatatc ttttattctg cgagtaaccc ttgatcatag tggtccatga gattatgtcc
    67261 ttcacaggca tctgattaaa caatgactct gcttgttcca gattgcctaa tcccatatat
    67321 ccattaatca aacagttcga cgtagcctca ttcttctccg acatttggtt agctaaagaa
    67381 ttcgcagagt ccatatccaa aacccgacga taagcagaaa ccattgtggt ccaagcaata
    67441 tcatctcttt caggcatttc atcaaacact ttcctggctt ccctgattct accagtggct
    67501 gaataaaaat caataagagt cgtctgaatt ttaacatgga aaccaaatcc aaatttccag
    67561 atgtgcgcct ggagtgattc cccaaaccta gaagcgaaag aagacgcctt tactagtgaa
    67621 gagtacgtgt agcttgatgg agaaaccgag tccctgagca tacgaacata caattccaga
    67681 gatcgaatcg ggtgagaaca agtaacgaag cctttaaaca acgcgttgta gacgaaaaca
    67741 ttaggttcct gcatctgggt catggtggaa actgcgaggt caagacgttt aaaggaagtg
    67801 caggcagtga tgaattggtt cattaagcga cagtcttggt ttaggctcgt cttgatcatg
    67861 gcggctaaag cagactccag aagcttgggc gtcgagcatt gcttgatgat tttctttaaa
    67921 tttggaggag ccagagagag tgacgctgag aaatctcgaa gatggtgaga aggtacccga
    67981 agactatgca cattggcgaa agcattcatg taaagaattt gagattgtcg ataaagatgc
    68041 agactttgaa aaaaaaattg ttttgtccaa aagaatcttt taggtataga gaaactctga
    68101 aaggactaga gggtttcagg ttcaccagac aataatactg aatgttgcta tattgtggca
    68161 ttaatcaatc tgagaagtgt tcatgataac aattccaaac aaaaatggca cacctttaga
    68221 ctttttatac ctattccaag ataatagtat cacacacaca caaacactat aaacatacac
    68281 agcgttttct tctctgttct catcatgctt ttcaatcctt gtagttgttg atacatgaag
    68341 ccgagtctgc atgatgtgac gggtttcgtt gttgctacct gtttgtagcc ttgggttgaa
    68401 atatttgcac aagagaccac aggatgtcca tcctgtgcat tactttgttg ttttgtccct
    68461 gtcaattcat aaagagtatc cagttattag atgtgatata acaacaatac aatgattaag
    68521 gaccttgtgg aaatttcatg atgctgtaat gttaaagcga ttatattgtt tgttttccat
    68581 tcggatttaa aactaaaata acgttgttta gttccatgtt aaaaaatgga tgactattca
    68641 gatcatgtaa actgtaaagt tgtttagcca agtgttggag tctattccat gctgtgtgtg
    68701 accttagagt ggagaacagt tctcaattat tcccaaataa cgtacctcca ctacaaaaca
    68761 tatccatgtt ttctcgcctt gtttctcagt ggtgcctctg aggatgatga gttccaagct
    68821 ccttatcacg ttcgctatct cgagaaagtg gctacattct tcgcatagca tctgttcaac
    68881 atccaaaaca cactcaagca aggaattgca tataaccgca aaattcagga tgataaatgc
    68941 agagttcgcc agtcgttctg acaaagtgct tcaaatacat gaaaaaggta acgagaaaat
    69001 aatgcacacc tcaataagca tcactccttc tttgtccaga ttctccacca tgattgagca
    69061 cacttgcaga tggcctccaa tctccactgc ccagctcgaa ccttgttcag tgcttgatat
    69121 tcctagggtg ccggtatcct tgtgttgcat ctgtaacttc aaatgtataa gcttttaaga
    69181 aaacttcccc aacaatttga taaatgatct attaatcagt catgaataaa cggaaacgtc
    69241 tcttcacaaa ctatggagaa tataaagcaa ctttccttgg gaagactaga aattattaag
    69301 tacctttgaa cttgcacttt tagtgagctt gtcagcatgc tgagagacac tctgcaggaa
    69361 gagcatgtgc ttgatcgtgc actctagcaa ggaatcaata ctgcactgta caatataaca
    69421 acatagttag aaaatagcag aagaaaatat acaattcatg acactacaac tgcatgagtg
    69481 cagtcagtca catgctctga atagaaaaac caccttagat ccattaggca caagctccct
    69541 tagttctttg atacgatcct gaataagttg cctgtccctt ggacgaggcc gagaactttc
    69601 accaggttta gctctctttt tgttcttctt gggaatttcc agggacgtcg gaaactggtc
    69661 gctggatgaa ctgagacatg ttgatgaaaa cccaatggaa gaaaatgctc cgcagatatt
    69721 tgatggattc tgttggataa gcccatctgc tagaggcggc tggctaatca cactatcaac
    69781 tgtgctaaca atattttgct tattatgacc aaaaggttct gcctgtgcca tttcagcagt
    69841 tgtaagcaat gactgtgttg acctgcttga agatatttca cgcctgacat taccatcacc
    69901 attactcata ctagcaacaa cggcatctag aagattctcg gagctggatt caaatgtcag
    69961 gtgactatgg ctcatatcat ttgttcgtct tatagctgca gcagattcaa actttgctag
    70021 ctccccataa tcagtgcttg ttttactgaa cgctggccct aatgcctcta acagctcact
    70081 gccagaaaaa gaacacaaag atgcagttaa agcatccaac tgacttgact cacttttttc
    70141 ctcctgccta tgttctgtat ctttcacaaa tatacttcct tggctctcag atggttggaa
    70201 aacctcattt cgacgagaat aatctttatc tgttttcaac gcagtaagta cagttgaatc
    70261 aagttgtgga tatgatgaac ctgcttttag cctatcactc tccatagcta aagcagatgt
    70321 gcctccacta ttacgcacat gattcctcga gtagtgttgg aaattgggat ctaattctct
    70381 tgagtatcgg tatccacctg tttcctcatc ataaatcacc ttactcatat cacttatatc
    70441 cacttgattc ttgtgtttag tatcaaccac accaactgaa aaaccacttg taacacaatc
    70501 attgcttcca aacatggaag gttggactgc ttcaagccca ccaattactt gagcagtcct
    70561 ctccatgtga aaatatgttg gagtgaaatt gtatggaagg tcgttacttc tattacttgt
    70621 gttttgagat acaatattta acccttccat atccatagct ttgtcaaatt ctcctgagaa
    70681 atcaggggat gcctcatgta agcatttgga aggtattttt ggctgcagga aaattataca
    70741 acgaatcatg gttatactca gaaatcacat ctcttccaat tttgcacgaa cattgaatga
    70801 gaaagatcat tacccgatcc gatggactgt taatatcaca ttgcattaaa tttgatgcat
    70861 ggtctgctag tggatccgta agtgccaaaa ataaatgcct gatatgagtc accaaagccg
    70921 ggtcttcttc aacctgttcc accaaaagta tacaggaaga tcagaggcat tcaaatgttt
    70981 acattttcaa tgggaaagct ctcttactat attgtataag ctactttgaa caccgcatac
    71041 agttagaaca tcttacttac tttacacaaa gagccaagct gcacaactcc gcaagaacca
    71101 acagctacta taagaattgt ctgcagagaa tgaagaaaca aattgtcata aaaactgaaa
    71161 tgcaaacgtt gagggaaaaa aaacttcaat gttttgttac aaggactaga aaaagagaca
    71221 aatgtgtgga agtagaaaat atctaatcta attataaata tgaagaaaca ttcaaccaca
    71281 agaatatccc atgcgataga taacaataca caaaagacat gaaaaccagg gcaggcaaag
    71341 aaaagaaaaa aaactgaaaa cttatcagat accttaattc cagcagaaat ttgactctcc
    71401 caaccgttgt gaacctaagg ggaaaatatt atatttcaga caaaatgttc ccacgaaatt
    71461 atattttcaa attcaacaac gtgcatattt cccaacctga agtgtcgaat gagagtcatt
    71521 caaatattca gagaagatcc attgatgttg tccagagatt gctacttgtc ctacaatcct
    71581 ataatagtag agagatacga atgaagatgt tagcatcatt aagtaaaatt caatcatcaa
    71641 aacgaattaa tagctgatgt tcctgataga agattcaata ttaagtatat catgtagtca
    71701 ataccaatga aacaaaagtt aaaagagcag agaatattat agctacatta atgtaagact
    71761 gtaatacaca gtcaagctat aaacacacca agtctttgca ttgtttgaca acatcaataa
    71821 aagatctcaa agtaatgaag atagcaagag tattaacaag aacagtgcat cagcaagcaa
    71881 attttcctta cccttcccca agagagtgta catgatatga catcttagcc acagctaacc
    71941 caagagggtc atgagcatgg cgccctccat gcaagctttc cggcatcaaa ccgcgctcat
    72001 gattaacaca gtacacatcc tccaaagtaa gaaccctgca agtgttttta atagcccata
    72061 tgtgaaaaac ttctacttga cttctaggct taatacttaa aaaccacact tgacattcaa
    72121 caaaattgac tacgtattga ctataactct caaagcaaca aaatcgatct tatcagagtc
    72181 cttactaaat tccaccaaac agaaccaaca tattggcata agattataaa cttttggata
    72241 acttacattg gcgagtggtg attaagtttc cagaacacgg cgtagttcca atccgtgttg
    72301 gagcagatgc tcctcagtat ctgttgcaag gtataaccca tctaaacctt ccccttcacc
    72361 actaaaaaac accccttttt aaaacttaaa atagtccccc gacaagaact ctcccttgaa
    72421 ttcttaatca gtctctgtgt ctgaaaataa acagtcttgc cacctaaaag gaaacccttt
    72481 ttgcctacag atgagctacg aatctactaa ctacctctgt atgaacctct accagcttgt
    72541 tcccttcgca atccagctct cggatttatt ggtggcccta cttctcccag tgaatactgc
    72601 ctagtgccca ttcctttccc aaacataaac aacccctagc tcgaagaaga agaaattgag
    72661 atcgaagaag aagaaaacag aaacagagtc tagcttattt catgagacat tgatcctttc
    72721 tcgagagatg atacgctctg aatctgcatc tacaaccgaa aaatctctct caaagttaga
    72781 atctttgtcg agaaatccac cggtgaaaga gagatgaaca ctttgagtaa gaacaacaag
    72841 tgactagaga gagagaaaga aacgcagagt tgctaaaaag acatctcctt tttaaagggg
    72901 ggcgttgaag aaaattcagg gctcatttta gcaacggtgg taatattatc agagctatcg
    72961 tgcgctggct aggtgcgcat tttagcaacc ctaggcctag ggtagtagtg tggggggtgg
    73021 attttaaggc atgggattaa taatgtggaa aaaacattcg agtgatatga tctctctaat
    73081 ggccagcaaa atgattcacc aagtgaaatt ttgttcctag tgcactttat tttacttttc
    73141 ttcatcatac aaattacacg atgtgtagta cttgtaattc tttcgccata caaataactt
    73201 ttttctttga aatggtgttt gatagaacat aataataatg cgtctatatg ttgatgtgat
    73261 ccttattttt gatatgatct gttatgtgta tcgtttgttc tccagccatt tttttttttt
    73321 ttgtgggcaa agaaggattt ggaatgtgtg atgggattgt ggtccataca aaatctatgg
    73381 aatctaatga ttatttccag ttgaaagata aatcatacta tctccaaaca aattcctttt
    73441 gattttctcc tcttttactt atcaagtttc aaacatgtgt atggtcaagc ttctgaaaat
    73501 ataaccctaa aataagtaga tcttttttct tcaagttcat aagtatttgt tacaagaaaa
    73561 aaaaatcaat atttgttaga aacaaaaaga gagaagtagg tgaaagaagg ctttgtttgg
    73621 gaagagggag gtgtgattgt gataaggggc gaatgatgaa cattggccaa acaaacaaaa
    73681 caagtgtatc aagaaagaag cctcaccttt cgctttcaat ttcacacttc tttgtttgac
    73741 ctttgggact tgagcacatt ccattttcct tttcgttctt tcttttgttc tttctatatg
    73801 tataataaca cacaattttt tgcgtagata tactgtcaag aggataagag ggaaggagaa
    73861 aaaggaaacc gaaagttgta tgacttttac tattcaacaa tatcatttct cttttggcat
    73921 gtttttgtgg acgaagccca agttcaagaa tacatttaac ggtctccctg taggaaagaa
    73981 gaaaaataga tcataacaac ttcttttggt caacaatatt atctcataat tgaagtgaga
    74041 ataaaacaag aaaaactttg aagagtgaat atttatcgtc gtttgttaaa tggatatgtg
    74101 cattcagagt ttgaagaaaa acatgaaaaa gtttaaagag tgaacaccac agacacaaca
    74161 accaaaaccg acaaataaag aaagcttgtt gaactggaaa gcagcggcaa taggatatgg
    74221 ctctggagtc ttgttatgac tggcaatcgg acaagttatt gcttcttaca aaccggtgtg
    74281 tgttctttaa gttgtttcgt ctttgagatg aagctt
//