LOCUS       AC000107              102393 bp    DNA     linear   PLN 09-AUG-2000
DEFINITION  Genomic sequence for Arabidopsis thaliana BAC F17F8 from chromosome
            I, complete sequence.
ACCESSION   AC000107
VERSION     AC000107.2
KEYWORDS    HTG.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 102393)
  AUTHORS   Khan,S., Brooks,S., Buehler,E., Chao,Q., Johnson-Hopson,C., Kim,C.,
            Shinn,P., Altafi,H., Bei,Q., Chin,C., Chiou,J., Choi,E., Conn,L.,
            Conway,A., Gonzales,A., Hansen,N., Howng,B., Koo,T., Lam,B.,
            Lee,J., Lenz,C., Li,J., Liu,A., Liu,K., Liu,S., Mukharsky,N.,
            Nguyen,M., Palm,C., Pham,P., Sakano,H., Schwartz,J., Southwick,A.,
            Thaveri,A., Toriumi,M., Vaysberg,M., Yu,G., Federspiel,N.A.,
            Theologis,A. and Ecker,J.R.
  TITLE     Genomic sequence for Arabidopsis thaliana BAC F17F8 from chromosome
            I
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 102393)
  AUTHORS   Ecker,J.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-JAN-1997) Arabidopsis thaliana Genome Center,
            Department of Biology, University of Pennsylvania, 38th Street and
            Hamilton Walk, Philadelphia, Pennsylvania 19104-6018, USA
REFERENCE   3  (bases 1 to 102393)
  AUTHORS   Ecker,J.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-JAN-1999) Arabidopsis thaliana Genome Center,
            Department of Biology, University of Pennsylvania, 38th Street and
            Hamilton Walk, Philadelphia, Pennsylvania 19104-6018, USA
REFERENCE   4  (bases 1 to 102393)
  AUTHORS   Shinn,P., Brooks,S., Buehler,E., Chao,Q., Dunn,P., Khan,S., Kim,C.,
            Walker,M., Altafi,H., Araujo,R., Conn,L., Conway,A., Gonzalez,A.,
            Hansen,N., Huizar,L., Kremenetskaia,I., Lenz,C., Li,J., Liu,S.,
            Luros,S., Rowley,D., Schwartz,J., Toriumi,M., Vysotskaia,V., Yu,G.,
            Davis,R., Federspiel,N., Theologis,A. and Ecker,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-1999) Arabidopsis thaliana Genome Center,
            Department of Biology, University of Pennsylvania, 38th and
            Hamilton Walk, Philadelphia, PA 19104-6018, USA
REFERENCE   5  (bases 1 to 102393)
  AUTHORS   Ecker,J.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-AUG-2000) Arabidopsis thaliana Genome Center,
            Department of Biology, University of Pennsylvania, 38th Street and
            Hamilton Walk, Philadelphia, Pennsylvania 19104-6018, USA
REFERENCE   6  (bases 1 to 102393)
  AUTHORS   Cheuk,R., Shinn,P., Brooks,S., Buehler,E., Chao,Q.,
            Johnson-Hopson,C., Khan,S., Kim,C., Altafi,H., Bei,B., Chin,C.,
            Chiou,J., Choi,E., Conn,L., Conway,A., Gonzalez,A., Hansen,N.,
            Howing,B., Koo,T., Lam,B., Lee,J., Lenz,C., Li,J., Liu,A., Liu,J.,
            Liu,S., Mukharsky,N., Nguyen,M., Palm,C., Pham,P., Sakano,H.,
            Schwartz,J., Southwick,A., Thaveri,A., Toriumi,M., Vaysberg,M.,
            Yu,G., Davis,R., Federspiel,N., Theologis,A. and Ecker,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-AUG-2000) Arabidopsis thaliana Genome Center,
            Department of Biology, University of Pennsylvania, 38th and
            Hamilton Walk, Philadelphia, PA 19104-6018, USA
COMMENT     On Aug 4, 2000 this sequence version replaced AC000107.1.
FEATURES             Location/Qualifiers
     source          1..102393
                     /organism="Arabidopsis thaliana"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:3702"
                     /chromosome="1"
                     /clone="F17F8"
     CDS             complement(join(695..786,895..1051,1138..1252,1320..1387,
                     1473..1616,1706..1783,1866..1948,2038..2077,2159..2233,
                     2318..2430,2529..2621,2730..2769,3507..3658,3735..3789,
                     3899..4090))
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to UDP-Glucose Pyrophosphrylase
                     gb|AAD18994.1; similar to ESTs gb|N95844.1,
                     dbj|AV525591.1, dbj|AV441613.1, gb|N65104.1,
                     dbj|AV549160.1, and gb|T45941.1"
                     /codon_start=1
                     /product="F17F8.1"
                     /protein_id="AAF98204.1"
                     /translation="MERENGALTAATTTTTAVTSPPPMASSPRQALVERLKDYGQEDI
                     FSLWDELSPDEKDFLVRDIENLDLPRIDRIIRCSLHSQGLPVAAIEPVPENWVSTVDG
                     RTMEDREKWWKMGLKTIYEGKLGVVLLSGGQGTRLGSSDPKGCFNIGLPSGKSLFQIQ
                     AERILCVQRLAAQVVSEGPIRPVTIHWYIMTSPFTDEATRKYFSSHKYFGLEPDQISF
                     FQQGTLPCVTKDGKFIMETPFSLAKAPDGNGGVYAALKCSRLLEDMASRGIKYVDCYG
                     VDNVLVRVADPTFLGYFIDKGAASAAKVVRKAYPQEQVGVFVRRGKGGPLTVVEYSEL
                     DQSMASAINQRTGRLQYCWSNVCLHMFTLDFLNQVATGLEKDSVYHLAEKKIPSMNGY
                     TMGLKLEQFIFDSFPYAPSTALFEVLREEEFAPVKNVNGSNFDTPESARLLVLRLHTR
                     WVIAAGGFLTHSVPLYATEVSPLCSYAGENLEAICRGRTFHAPCEISL"
     CDS             join(9170..9279,9858..10236)
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="unknown protein; similar to EST gb|T43267.1"
                     /codon_start=1
                     /product="F17F8.2"
                     /protein_id="AAF98178.1"
                     /translation="MKQQFLGLIHGLVAPGRIHVWRRHILVTQVGQMVNTKLLTNKIK
                     ERSKKKKLEDRKMLREECTPSSSWWEDVQHHHNDHANSISSTSFYHKSSNNNSHANAS
                     CEEDNLSVSTVRASNRLDLTAESSNHHSLSASNQPASSSDELLRDHVVSSHNHLWSLA
                     FL"
     CDS             join(11084..11578,12120..12236,12599..12667,12859..12924,
                     13036..13074,13164..13337)
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="unknown protein; similar to EST gb|AA395190.1"
                     /codon_start=1
                     /product="F17F8.3"
                     /protein_id="AAF98179.1"
                     /translation="MDHHHHIASRNSSTTSELPSFEPACHNGNGNGWIYDPNQVRYDQ
                     SSDQRLSKLTDLVGKHWSIAPPNNPDMNHNLHHHFDHDHSQNDDISMYRQALEVKNEE
                     DLCYNNGSSGGGSLFHDPIESSRSFLDIRLSRPLTDINPSFKPCFKALNVSEFNKKEH
                     QTASLAAVRLGTTNAGKKKRCEEISDEVSKKAKCSEGSTLSPEKELPKAKLRDKITTL
                     QQIVSPFGKTDTASVLQEAITYINFYQEQVKLLSTPYMKNSSMKDPWGGWDREDHNKR
                     GPKHLDLRSRGLCLVPISYTPIAYRDNSATDYWNPTYRGSLYR"
     CDS             join(16875..17087,18129..18203,18278..18459,19009..19264)
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="hypothetical protein"
                     /codon_start=1
                     /product="F17F8.4"
                     /protein_id="AAF98180.1"
                     /translation="MVREGEEEEEMMMMMATKPAWLEGLMAETFFSSCGIHETRRKSE
                     KNVFCLLCCLSVCPHCLPSHRSHPLLQVRRYVYHDVVRLSDLEKLIDCSYVQPYTING
                     AKVIFLNQRQQSRAKVSSNVCFTCDRILQEPFHFCSLSCKVIILQQKFGNYFTFRIDE
                     SDFTFEGLRMDGHDQLGEISTMEDGEDILVISDESEQGNNSHKKEKKKSKKKKPESNY
                     LPGMVLSSLGNRRKGAPHRAPFS"
     CDS             21856..24474
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="hypothetical protein"
                     /codon_start=1
                     /product="F17F8.5"
                     /protein_id="AAF98181.1"
                     /translation="MNFSTFFFVDPYDFFIEFFFFKTFHRAVIERETKNMIKEIYCTD
                     GRVVQGDDIMVEAEKFFKEFLQLIPEDFVGVEVRELQDLLQFRCTNSDNEMLTREVSS
                     EEIKTVLFSMPKDKSPGPDGYTSEFYKATWDIIGQEFTLPVQSFFQKGFLPKGINSII
                     LALIPKKLAAKEMRDYRPISCCNVLYKVISKIIANRLKLLLPRFIAENQSAFVKDRLL
                     IENLLLATELVKDYHKDSISARCAIKIDISKAFDSVQWSFLTNTLVAMNFSPTFIHWI
                     NLCITTASFSVQVNGDLVGYFQSKRGLRQGCSLSPYLFVICMDVLSKMLDKAAGVRKF
                     GFHPKCQRLGLTHLSFADDLMVLSDGKTRSIEGILEVFDEFCKRSGLRISLEKSTLYM
                     AGVSPIIKQEIAAKFLFDVGQLPVRYLGLPLVTKRLTSADYSPLLEQIKKRIATWTFR
                     FFSFAGRFNLIKSVLWSICNFWLAAFRLPRQCIREIDKLCSSFLWSGSEMSSHKAKIS
                     WDIVCKPKAEGGLGLRNLKEANDVSCLKLVWRIISNSNSLWTKWVAEYLIRKKSIWSL
                     KQSTSMGSWIWRKILKIRDVAKSFSRVEVGNGESASFWYDHWSAHGRLIDTVGDKGTI
                     DLGIPREASVADAWTRRSRRRHRTSLLNEIEEMMAYQRIHHSDAEDTVLWRGKNDVFK
                     PHFSTRDTWHLIKATSSTVSWHKGVWFRHATPKYALCTWLAIHNRLPTGDRMLKWNSS
                     GSVSGNCVLCTNNSKTLEHLFFSCSYASTVWAALAKGIWKTRYSTRWSHLLTHISTHF
                     QDRVEGFLTRYIFQATIYHVWRERNGRRHDAAPNTPATVIGWIDKQTRNQITIIRQSG
                     DRRYDKAFQAWLRARY"
     CDS             complement(join(30354..30452,30592..30636,30992..31071,
                     31156..31206,31321..31368,31588..31696,31776..31805))
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="hypothetical protein"
                     /codon_start=1
                     /product="F17F8.6"
                     /protein_id="AAF98203.1"
                     /translation="MKSQWSNFHQIGRNSFLAASTVYVSNEFNFLNTSLLNRRSFCFA
                     EGVLKSEAEFNSALSKARDGSLPSVFYFTAAWCGPCRLISPVILELSNKYPDVTTYKV
                     DIDEGGLSNAIGKLNVSAVPTLQFFKGGVKKAEIVGVDVVRLKSVMEQLYK"
     CDS             join(32184..32542,32983..33254,33368..33471,33571..33706,
                     33841..33908,33988..34131)
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="hypothetical protein"
                     /codon_start=1
                     /product="F17F8.7"
                     /protein_id="AAF98182.1"
                     /translation="MQFLGRSISKSIRPSLNSTARKSWVLSSQQFLSTSSTESSSRTR
                     GGGGGNRAEKSSEEWPRPMEVPYQPKIANSIDLIGYVHQPVQFDSTLDGKFWAGTVIS
                     HEPSSDSKSESDSSSNFWIPVLFEGDLAHTANSYLKKNDRVHITGQILGDVIQSGANS
                     DQAHVQLFKSFHGSFSHQVMVRDLHYIEGSKAMPKVLPTLDQNEGVLKHSASVQRGRE
                     FGTNLWFDLVDKPNEWCDYREMKQNGSVNPKHPDFKKKDGSQALWLNNAPTEILSELK
                     DVKFDIPKYAKQPKAGEESWKDLVDNMNKWWDNRVDKRTPKSPDFKHKETGVGLWLSD
                     SPSWVLEKLPPPKSKTSDIYGVQEMF"
     CDS             join(34490..34749,34843..35680)
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="hypothetical protein"
                     /codon_start=1
                     /product="F17F8.8"
                     /protein_id="AAF98183.1"
                     /translation="MRMTRRRTKKTEIRNDSDSVRIDIVIEIVKRLPLKDVSRFLLVS
                     KLWSEIIRSPYFIRSFPFLFSSIQPHLLYALNSLDKDKGHHKCCDIHYVSGLICFGYG
                     QQQLITNPRTGKSIYLPKVKSRSKIIQSFFGYDPVYGQYKVLCMSERMNDYLNVPSSE
                     HQVFTLGGVQKVEQSWRMIECNIHHRPKTNSVCMDGVLYYGAFTGGDMLEWCLMRFDV
                     RTEKLDLVSRLNESSIQCYRPGHSPSLIKYHGKVALAFETSLHTFELWVMEDAEKWSK
                     IRFSICHSMHLFGQDDDDAFLITGNIHTGEIIFAPYDCDVRFGMTHVVYYDLKTNRLR
                     FRTVAFDLGTLFPQISVMVPFFDYVESAMLL"
     CDS             complement(join(35994..36265,36741..36927))
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to major latex-like protein emb|CAA11844.1;
                     similar to ESTsdbj|AV545261.1, dbj|Av552074.1, and
                     dbj|AV543375.1"
                     /codon_start=1
                     /product="F17F8.9"
                     /protein_id="AAF98202.1"
                     /translation="MAMSGTYMTDVPLNGSAEKHYKLWSSETHRIPDTIGHLIQGVIL
                     HEGDWDSHGSIKTWKYNLDGKEEEFKERTEIDEEKMAVTMTALDGQVMEELKVYIPNL
                     QFIPESQNACVCKVSVKWEKRTEDSEPAKFYKFLEKMIADSDDHILHNQE"
     CDS             join(38328..38465,38545..38646,38723..38776,38828..38898,
                     38940..39180,39255..39377)
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to mutator-like transposase gb|AAC24187.1"
                     /codon_start=1
                     /product="F17F8.10"
                     /protein_id="AAF98184.1"
                     /translation="MDNLVFTMVGEWKCKEEKWKFEPEEDMFGRCVRVKENMTYTEFV
                     CTSIEINPIISYWIPREMLVMIDTKRPPVYIDSQVRTLRNNVSRTHGDDAESDREDDI
                     EDDKTDEDEDGGGDNEDGDGTIDPTIDGSESSGEDYDYNKWNDEIVEEYGIGNVEENI
                     ILTQLTVQHPREFSLLLAECTYTSQRVPGGDNISHPGDRTPANRKVIQQTMSYLAIKQ
                     SFCYKQPRSYPTRLVMVCVDDTCP"
     CDS             40581..40841
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="hypothetical protein"
                     /codon_start=1
                     /product="F17F8.11"
                     /protein_id="AAF98185.1"
                     /translation="MIKSIESFIARYVFQATLYTIWCERNGRRHGEREAEPAALLIKL
                     IDKQAIFPQSEQLMIYAMTRASKSGLHRVVEIKPSIVHVFNL"
     CDS             complement(join(41362..41498,41810..42026))
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="hypothetical protein"
                     /codon_start=1
                     /product="F17F8.12"
                     /protein_id="AAF98201.1"
                     /translation="MGAKWNSMIIMVFVVTMVIAMENVNGETRAQCHEDCITDCATTG
                     IIPIKCLQNCYRRCPGKPRRTLGHHFSEGIHIVLKILFFKLNSRDYLEKLKVKIIDGS
                     DLYSGSADIEETMKS"
     CDS             complement(join(43694..43857,44188..44386))
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="hypothetical protein"
                     /codon_start=1
                     /product="F17F8.13"
                     /protein_id="AAF98200.1"
                     /translation="MGAKWNSMIIMVFVVTMVIAMENVNGETKAQCHEDCILGCATTG
                     RIPITCLQNCYRRCPGKPRRTLGIHIVLKILFFKLNSRDYLEKLKVKIIDGSNLYSGS
                     AEIEETMSHESVLDSWDF"
     CDS             join(45464..45657,46109..46209,46445..46574,47041..47462,
                     47544..47686,47800..47853,48082..48111,48373..48444)
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to 11-zinc finger protein
                     gb|AAD27869.2|AF133731_1; similar to ESTs gb|AW399280.1,
                     gb|BE204230.1, gb|N38677.1, gb|H77073.1, gb|AI994300.1,
                     and gb|AI996529.1"
                     /codon_start=1
                     /product="F17F8.14"
                     /protein_id="AAF98186.1"
                     /translation="MGKKKKRATEKVWCYYCDREFDDEKILVQHQKAKHFKCHVCHKK
                     LSTASGMVIHVLQVHKENVTKVPNAKDGRDSTDIEIYGMQGIPPHVLTAHYGEEEDEP
                     PAKVAKVEIPSAPLGGVVPRPYGMVYPPQQVPGAVPARPMYYPGPPMRHPAPVWQMPP
                     PRPQQWYPQNPALSVPPAAHLGYRPQPLFPVQNMGMTPTPTSAPAIQPSPVTGVTPPG
                     IPTSSPAMPVPQPLFPVVNNSIPSQAPPFSAPLPVGGAQQPSHADALGSADAYPPNNS
                     IPGSIPSGTNAHSYASGPNTSGPSIGPPPVIANKAPSNQPNEVYLVWDDEAMSMEERR
                     MSLPKYKVHDETSQLAIVGSEKHSMNSINAAIDRRISESRLAGRMAF"
     CDS             join(49080..49598,49795..49884,49992..50137,50471..50629,
                     50724..50898,50992..51131,51218..51302)
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to GTP-binding protein ERG
                     sp|082626|ERG_ANTMA"
                     /codon_start=1
                     /product="F17F8.15"
                     /protein_id="AAF98187.1"
                     /translation="MKAFRSLRILISISRTTTKTTPRNPHQAQNFLRRFYSAQPNLDE
                     PTSINEDGSSSDSVFDSSQYPIDDSNVDSVKKPKEATWDKGYRERVNKAFFGNLTEKG
                     KVKVAEEESSEDDEDSVDRSRILAKALLEAALESPDEELGEGEVREEDQKSLNVGIIG
                     PPNAGKSSLTNFMVGTKVAAASRKTNTTTHEVLGVLTKGDTQVCFFDTPGLMLKKSGY
                     GYKDIKARVQNAWTSVDLFDVLIVMFDVHRHLMSPDSRVVRLIKYMGEEENPKQKRVL
                     CMNKVDLVEKKKDLLKVAEEFQDLPAYERYFMISGLKGSGVKDLSQYLMDQAVKKPWE
                     EDAFTMSEEVLKNISLEVVRERLLDHVHQEIPYGLEHRLVDWKELRDGSLRIEQHLIT
                     PKLSQRKILVGKGGCKIGRIGIEANEELRRIMNRKVHLILQVKLK"
     CDS             complement(51549..52877)
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar ot unusual floral organs (UFO) pir||S57710"
                     /codon_start=1
                     /product="F17F8.16"
                     /protein_id="AAF98199.1"
                     /translation="MDSTVFINNPSLTLPFSYTFTSSSNSSTTTSTTTDSSSGQWMDG
                     RIWSKLPPPLLDRVIAFLPPPAFFRTRCVCKRFYSLLFSNTFLETYLQLLPLRHNCFL
                     FFKHKTLKSYIYKRGGTNDDDSNKAEGFLFDPNEIRWYRLSFAYIPSGFYPSGSSGGL
                     VSWVSEEAGLKTILLCNPLVGSVSQLPPISRPRLFPSIGLSVTPTSIDVTVAGDDLIS
                     PYAVKNLSSESFHVDAGGFFSLWAMTSSLPRLCSLESGKMVYVQGKFYCMNYSPFSVL
                     SYEVTGNRWIKIQAPMRRFLRSPSLLESKGRLILVAAVEKSKLNVPKSLRLWSLQQDN
                     ATWVEIERMPQPLYTQFAAEEGGKGFECVGNQEFVMIVLRGTSLQLLFDIVRKSWLWV
                     PPCPYSGSGGGSSGGGSDGEVLQGFAYDPVLTTPVVSLLDQLTLPFPGVC"
     CDS             join(62055..62197,62371..62624,62728..62837)
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="hypothetical protein"
                     /codon_start=1
                     /product="F17F8.17"
                     /protein_id="AAF98188.1"
                     /translation="MDSGKTFDSISNDLFLEILLRLSTKSIDRSRCVSKQWASILCSQ
                     DFTESEKFNFINASSFLFSSTKLINYKGKLGGIDLAYNHGGVYPVELRMWVLEDVEKH
                     EWSRHVYSLPETIEFQQCNYNICVGGMNAIGFEDYLNRRVYAFVDYVEDLSVNDAMQL
                     KSSSLQNG"
     CDS             complement(join(64575..64653,64732..64848,64933..65028,
                     65111..65175))
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="hypothetical protein"
                     /codon_start=1
                     /product="F17F8.18"
                     /protein_id="AAF98198.1"
                     /translation="MGWSKIEVEIEYRDKDRDELEILGFIDSVQSEKQNDQPTTIFRK
                     PNLGNNYSGPMASLAKGNFLDPSTEKEQAINSSSRSARLQDQLVFKISSPSTSAKARD
                     QVTDSSSSLETLFVLV"
     CDS             join(65374..65539,65688..65805,65878..66397,66499..66965,
                     67264..67378)
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="hypothetical protein"
                     /codon_start=1
                     /product="F17F8.19"
                     /protein_id="AAF98189.1"
                     /translation="MICVNCDIYIFFFINTKKIIIKYEAINFFFFFKPHRTKFILPFF
                     YFLFLSTEILSYFHRSSPSDHQNTPVKMKNWIPNDLIYEILSRLPAISVARSKARPRL
                     LIGVQQDGEWRFYSTPQSQNPCENKLSPADFHMKFSKGISNYSCSYASGLIYFDGMCI
                     RKEDEDAKHVLCDPLTGKYVILPELRVGDSYSYLGFDPVDKEFKVLFMTTRNNIAWKD
                     LDHYILTLGTGELKWRRIRCAFTHEPVWERICINGVLYYSAMNSDGNYVIYASHDGGS
                     TVKLSMWVLEDVEKPEWSKHVYSLWTESQVVKVNHNLSVSGMTATGDIVLSTKYASQP
                     FYVFYFNPERKTLQVPSVEVEGLGANRACMSYYAFADYVEDLSVNDAVRQLKSSPLQQ
                     QGQNIVTKRPKPRQGQDTSHDLSKSAPSVKNNKWFKSINKDDVVTFTTEDFPWNTLRS
                     KSVYRFSDSFI"
     CDS             join(70068..70386,70498..71340,73200..74094,74372..74441)
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="hypothetical protein"
                     /codon_start=1
                     /product="F17F8.20"
                     /protein_id="AAF98190.1"
                     /translation="MKNSIPIDLIYEILSRLPAKSVARCRCVSKRWRSILRHQVFTEL
                     FLTRSNARPRLLIGVQQDGEWSFLSTPQPQNRHESSSLVVAAADFHTKFSSGKSRHQC
                     TYASGGSYSYLGFDPIDKEFKVLFMDTCDFIASKDEDHYILTLGTGELKWRKIQCPFT
                     HEPFWERICINGVLYYSAYYSDSNGRSHLIACFDVRSEKFNFIATKHRYDQLINYKGK
                     LCGINLEYARHVGGFPVKLSMWVLEDVEKPEWSKHVYSLWTESEVVKVNRNLSVSGMT
                     ATGDIVLSMEDATNPFYVFNFNPDRNTLQVQSVEIQGLGANRDHIACHAFVDYVEDFS
                     VSDAVLQLKSSPLQQQGQDTSHDLSKSVKNKQLDNYEFLANKLNHSVSLAILFSKSVA
                     RCHCVSKQWRAIFRRKYFIELFLTRSKARPRILFVVQDGEWSEWSFLSLPQPQNSSLV
                     VESADIHMKKFSAGISGSIYFTYASGLIYFKCMRIPKEDEDEKPVLCDPLTGKYVILP
                     EPRVFGMYSYLGFDPVDKEFKVLFMASGYTASKDVDHYILTLRTGELKWRTIQCPFTH
                     EPLWTRICINGVLYYSAMNSDGNYVIVCFDVRYEKFKLVDTKCRSEFNGLINYKGKLC
                     GVKLKYAYRVGFPVKLRMRVLEDVEKDEWSTYVKVKVKQNLSVAGMTATGDIVLFMKF
                     ASNPLHHSIGLTILYSCLIYFVFLAL"
     CDS             join(76778..77178,77220..77430,77530..77885,78634..78715,
                     78808..79137,79920..80040,80163..80211,81075..81641,
                     81708..81766,81834..82053,83607..84816)
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="hypothetical protein"
                     /codon_start=1
                     /product="F17F8.21"
                     /protein_id="AAF98191.1"
                     /translation="MNSFPNDDLVYEILLRLPAKSVARCSCVSKLRRSILSRQDFTEL
                     FLTKSSARPRLLFGVKRANGEGLFFSSTQPRNSYEKSSLVVAADFHTKFSEVISREIC
                     SYASGLIYLSDMRISVNDEDVVRAICNPITGNYLGFDPIDKQFKVLFMAYPSGPDDHK
                     ILTLGTRRMRWRKIHCPLTHDPFCEGICINGVLYYLAIQIDEPLGKLGGIDWKHGNAN
                     GSRTFELSMWVLEDVEKHEWSKYDCTFLEYEVMFYNISLAVGMTATCEIVLSEKFASK
                     SFYVFYFNPERETLQRVEIQGLENHCRVYTITDHVEDLNVNDAKQLNVRQIKPKEEEA
                     ETHILKMVTWRKTPNEGKVGVINLTHAYERVFPLQLRMTVLEDFEKQEWSTYVYTLMA
                     ENIVVKYVSVVGMTATGDIVLVKTNACKPFYVFYFNPGRNTLLSVEIQGVGEDHKCLN
                     FHTVCAFVDHAAKKILVALDQKRKATSAPKVFLAVKSEKNPEEEVEIHCATETVANIL
                     VNEFDEPILGVELLLLSLASESLGKSSLVVAADFHMKFSKDISPNSCSYASSLIYFPI
                     IQISKEWDDEVRAICNPSTRQYAILPPDLRTTYQNFGPLLGFDPIGKQFKVLVFNCRV
                     GNELVYHILTLGTENVRWREIICPFTYEPRWKRSICINGILYYLAVNSNVSSSVINYK
                     LINYKGKLGLVDLEKDYDAGYLLGADENKVFNNNLSVVGATASGTLSEVLKSKVLEKR
                     KNGLTIIQFINYFVDHVEDLRFDGMKTTYVAPSLSPPEQSTSSSSEDPCSLGTRSFRS
                     RTIMNSEENTDSIPIDLILDILSRLPSKSIARCRCVSKLWESMIRQSYFTELFLTRSS
                     SRPHLLIAVEQEGEWKFFSLPQPKNYLGKSSLVVAANLHLKFFEDKRPQHGCSYASSL
                     IYFPNMTIRKKGDDHLGVICNPSTGQYGYVILPPLLDFKSVPYGKFLGFDPIDKQFKV
                     LIPIFDFDKHQTDHHILTLGAETVGWRKIQSPLRYLPHSNGTICINGILYYLAKINYA
                     MDKNVLVCFDVRSENFVFLRLNTYCSSTKLVNYKGKLGMINQEYVDDGGFPLKLSVWV
                     LEDVGKEEWSTYVYTLRDDNKVDQVKYNLSVVGVTASGEIVLVKKTQTLKPFYVLYFN
                     PDKNTLLTVEVKGLHRGLYAVHRIYAFVDHVEDLEFNIMKTTYAAKSKFSQEDRF"
     CDS             complement(join(86257..86382,86464..86574,86677..86779,
                     86856..86920,86986..87074,87174..87350,87438..87587,
                     88011..88146))
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="unknown protein; similar to EST dbj|AV530578.1"
                     /codon_start=1
                     /product="F17F8.22"
                     /protein_id="AAF98197.1"
                     /translation="MENTLSPLLSPSPASEVAARVSSLFVYPIKSCRGISLSQAALTP
                     TGFRWDRNWLIVNSKGRGLTQRVEPKLSLIEVEMPKHAFGEDWEPEKSSNMVVRAPGM
                     DALKVSLAKPDKIADGVSVWEWSGSALDEGEEASQWFTNFVGKPCRLVRFNSAYETRP
                     VDPNYAPGHIAMFSDMYPFLLISQGSLDSLNKLLKEPVPINRFRPNIFVDGCEPFAED
                     LWTEILINGFTFHGVKLCSRCKVPTISQETGIGGQEPIETLRTFRSDKVLQPKSKPHG
                     KIYFGQNMVWKDGFGDGIGKTIEIGDSVVVLRKLSSPAEAAT"
     CDS             complement(join(88515..88640,88756..88859,88946..89047,
                     89151..89214,89302..89384,89469..89708,89797..89880,
                     89962..90031,90117..90205,90278..90970,91489..91783))
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to vacuolar sorting receptor-like protein
                     emb|CAA16619.1; similar to ESTsgb|AW267745.1, and
                     gb|AI783218.1"
                     /codon_start=1
                     /product="F17F8.23"
                     /protein_id="AAF98196.1"
                     /translation="MSLIHKGATLALFLALTMVVNGVFGRFIVEKSSVTILNPLAMRS
                     KHDAAIANFGVPNYGGYMIGSVVYAGQGAYGCDSFDKTFKPKFPRPTILIIDRGECYF
                     ALKVWNGQQSGVAAVLVADNVDEPLITMDSPEESKEADDFIEKLNIPSALIDFSFANT
                     LKQALKKGEEVVLKIDWSESLPHPDERVEYELWTNTNDECGARCDEQMNFVKNFKGHA
                     QILEKGGYSLFTPHYITWFCPKDYVSSNQCKSQCINQGRYCAPDPEQDFGDGYDGKDI
                     VFENLRQLCVHKVAKENNRSWVWWDYVTDFHIRCSMKEKKYSKECAERVVESLGLPLD
                     KIKKCIGDPDANVENEVLKAEQALQVGQGDRGDVTILPTLIVNNAQYRGKLERNAVLK
                     AICSGFKERTEPGICLSGDIETNECLEANGGCWEDKKSNVTACKVLRTDELKGLHFYR
                     YLVSFIPKNGFYQDTFRGRVCECPVVNGVQYKGDGYTSCEPYGPARCSINQGGCWSET
                     KKGLTFSACSNLETSGCRCPPGFKGDGLKCEACQCDGCNCKNKWGGFECKCSGNRLYM
                     KEQDTCIERSGSRIGWFPTFVILAAVASICVGGYVFYKYRLRSYMDSEIMAIMSQYMP
                     LESQNTTDPMTGESQHQQLRLTSAA"
     CDS             complement(join(93059..93446,93569..93762,93816..93914,
                     93998..94177))
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="unknown protein; similar to ESTs gb|T76678.1,
                     gb|AI730852.1, gb|AI993427.1, gb|AI165001.1, and
                     gb|BE209780.1"
                     /codon_start=1
                     /product="F17F8.24"
                     /protein_id="AAF98195.1"
                     /translation="MAEMYNNMGPQPGMPRPPGNPEPGPFGNPFTGAGSGFIRGGLGA
                     YGERILGSSSEYVQSNISRYFSDPQYYFQVNDQYVRNKLKVVLFPFLHRPFNCTIVGS
                     ASNPQGHWTRISEPVGGRLSYKPPIYDINAPDLYIPFMAFGTYVVLAGLSLGLNGKFT
                     PEALNWLFVKGLVGWFLQVMLLKVTLLSLGSGEAPLLDIVAYGGYAFAGLCLAGFAKI
                     MWGYSYYALMPWTCLCTGIFLVKTMKRVLFAEVRSYDSSKHHYLLLFLALVQFPLLIW
                     LGNISVNWLL"
     CDS             join(95002..95236,95552..95679)
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="unknown protein; similar to ESTs gb|R30049.1,
                     gb|AI999261.1, and gb|T75656.1"
                     /codon_start=1
                     /product="F17F8.25"
                     /protein_id="AAF98192.1"
                     /translation="MAKSMRCKRVKRLRAIRREIVEKESFTLTREDAKSAAIEAALAA
                     PKLPVRQAPVSPFMEVATPSSESASASTTIANDSDEEMDDEKKNKSLKPIGKKLKKKF
                     KLGMKNRRSKGVLRGKRN"
     CDS             complement(join(96173..96934,97236..97523))
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to peroxidase BP-2B pir||S34355; similar to
                     ESTs gb|AA067592.1, dbj|AV551983.1, dbj|AV541703.1,
                     dbj|AV543976.1, dbj|AV546278.1, and gb|AI100412.1"
                     /codon_start=1
                     /product="F17F8.26"
                     /protein_id="AAF98194.1"
                     /translation="MKLAVVSVVVILGVLVAWPVSAGRKDLPGAGGYGGDDDDDTKSL
                     FPLDNLLSLNYYDRICPDFEKIVVTKVREWTKSDSSLGPALLRLIFHDCGVTGCDASV
                     LLDYEGTERRSPASKTLRGFELIDDIKSEMEKSCPGKVSCADILTSASRAATVQLGGP
                     YWPNVYGRRDSKHSYARDVEKVPSGRRDVTALLETFQSYGLNVLDLVVLSGAHTIGKA
                     SCGTIQSRLYNYNATSGSDPSIDAKYADYLQRRCRWASETVDLDPVTPAVFDNQYYIN
                     LQKHMGVLSTDQELVKDPRTAPLVKTFAEQSPQIFRQQFAVSMAKLVNVGVLTGEDRV
                     GEIRKVCSKSNSRAY"
     CDS             join(99812..100564,100664..100782,100843..101553,
                     101638..101959,102048..102362)
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Glu-rich protein emb|CAA18241.1"
                     /codon_start=1
                     /product="F17F8.27"
                     /protein_id="AAF98193.1"
                     /translation="MVSSPQRFGLILRDRNQNAGVFQKNLKSPVKEVLKSHVSDENLV
                     DSWIETHNNKNNRVLESPLESKRNDNLVASSLVQIWEARLNRSNGGNSPSSSQSTASS
                     SSRSDSGVSVQDSGLSESSSIDGDSEIADRTVEIESRSHGLVSDSGESKWGRVADLIR
                     RLSNEDKKRTAGDNGSGGGGGLEIIRTPRPYCTSSSSEKSNFPVVSFSPKIRGRQAFT
                     DFLMQMERDRHRELDSLFERNAVSRFTQRGRLQSMLRLRNLNRCLVIQDRNRSNAKTT
                     GLNRIESGSAVLHLRFSIFDWQRREKFHANVVNSAAATDKRKNHQRSTEMNNKSVEET
                     EGTTTTSTRLKDGGVTLEAFFAERLRPRNRKIEEATLCKEEESVSGTVDSQKNCLQLQ
                     ETREVEETCNDGKSEKKEEENTSPSEYLSRESRLRQNQDENNVGKYMQETRETEGLVH
                     ESNEMDQCLDQQETSYLNRWGEQEEYADEQSYYGEYNDDWLSEIARPRSYWEELRKSR
                     YLEVMNTRSEKDDICRLLERRTVTDFLDSGLREKIDNLMMSRVQTHSDKHSKKWELQQ
                     EEEEEVNFEIDEEIKEEPLRGGEEQDDRDDLSQSSSSHISASSPAGSWSSQDTDVTST
                     PALVVQNPQSPEMELISGMRSQIQQLQQEMSVLRDSVKTCLDANASLQHKAHQENPMK
                     RKCCVCDETQVEAVLYRCGHMCMCLKCANELHWSGGKCPICRAQIVDVVRVIYDTRN"
BASE COUNT        34003 a        17139 c        17586 g        33665 t
ORIGIN      
        1 aattatataa cacataagta caatttacca ataatattta ttttgtataa aaatacatac
       61 aaccataatc ttatttttac aaccaatttc ttaaataaaa atataaaatt aataaaatct
      121 actgattttt acggcaataa aatctatagc tatagtcatc acaaataaaa caaaaatttt
      181 acagcaaaaa aatctacagt tacagacgaa ccaatcacac acgaagagag ccaatatata
      241 gagatcggaa cctagggcat taattggttt ggttttgttt gatttcggtt tataagatca
      301 actaaaaccg atctgtatct agtcacttcg ctcttcacta atgtgataga ctttcctcat
      361 taatatgtta tgtttgagac ttgctttcga gcatataaag agttcgcttg tagttttttt
      421 cattttcttt gttgttaatt attaatcatc taataatcag ctttgctcct catctccaaa
      481 actataccta aaagattcaa aaaccaacat aaaattttta ttagatatgt tacattaatg
      541 gatataaaac gccaagacct ctttgactct ctctttctct ctctcatggg aagataatca
      601 gtttatatat aaaccacaac cggaaacaaa gaaaacaaag cacataaaaa tgatgaaaag
      661 attttaatac cccaaaacaa aaacacaaaa accattagag ggaaatttca caaggtgcat
      721 gaaacgttct tcctcgacaa atagcttcaa gattttctcc ggcgtatgag cacaaaggtg
      781 aaacctctac acctaaaatt tattcgattt tgcatataag aaaaataaat tcgttggaca
      841 gaaaagtaaa ataaataaaa acacagtaat gagaagattt gttttgagag ttaccagtag
      901 catataaagg cacagaatgt gttagaaatc caccagctgc tataacccaa cgtgtgtgta
      961 accttagaac caaaagcctc gcactctccg gtgtatcaaa attagacccg ttaacattct
     1021 tcactggtgc aaactcctct tcccttaaaa cctacacata gcacaaccca atttctcagt
     1081 ttttaatatt tggtttcttt agttagtata ttgtgtaaaa atgaattgat actatacctc
     1141 aaaaagtgcg gttgaaggag cataaggaaa cgaatcaaaa atgaattgtt ctagttttag
     1201 tcccattgtg tatccattca tagatggtat cttcttctcc gccaaatggt acctgccaca
     1261 aaccacaatt caataacatt ttgactgcca gattcgtttg tatttgaaga gaaacttaca
     1321 cgctatcttt ttctaggccg gtcgctactt gattaaggaa atctaaagta aacatgtgta
     1381 agcacaccta agaaatatgt aaaacacaac tttggattag tagtgaaatt cataagaata
     1441 agaagaagaa gaagaagaaa aaaggaattt acgttactcc agcaatattg aagacgtcct
     1501 gttcgttgat taatagcaga agccatagac tgatcaagct cactatactc aactactgtc
     1561 aacggtcctc ctttacctct tctaacaaac actcctacct gttcttgagg atatgcctgt
     1621 tttttttcca tacagaaata taaagaagat gaagtcttaa tcttaaaatc tttctagacc
     1681 agttacattg tatgatctta tataccttcc gcacaacttt tgcagccgaa gcagcccctt
     1741 tatcgatgaa gtatccaaga aaagtaggat cagctactcg aacctgcatt ttcaagattc
     1801 catattataa caacgttgag gaaacaaaca catgtcaaga ctcaagatta cactagagag
     1861 ctaaccagga cattgtcaac gccatagcaa tcgacgtatt taatccccct agaagccata
     1921 tcctctaata gccttgaaca ctttagcgct gtaaaaatct cggatcagca tcagcaacgg
     1981 tttgaataga acatatgtat gatagtaaaa aacagaatca aaatttagta aacgtacctg
     2041 catagactcc gccgttacca tctggagctt tagctagctg ttaatgatat gtaattaaac
     2101 tcattaagtg agtactgaaa acaaaagtga gtgcttgtca ttttttaatt gtacatacac
     2161 tgaaaggtgt ctccataata aactttccat cctttgtaac gcagggcaaa gtaccttgtt
     2221 ggaaaaaact gatctgtagt aagaagtgat caagattggt ctaagagacg aaggaaacaa
     2281 caataaggaa tgtttataca aataagcagc atcttacttg atctggttca agaccaaagt
     2341 acttgtgact cgagaaatat tttcgtgtcg cttcatcagt aaatggacta gtcataatat
     2401 accaatgtat tgtaactgga cgaattggac ctgaacgtaa gatattatgc ggaaaagagt
     2461 gtcaaatatg gcataacggt acaaatatct gttggaatat agaagaagcc atgagtagtc
     2521 tcactcacct tcactcacta cttgagcagc aagtctttga acacacaaga ttctctctgc
     2581 ctgaatctga aagagcgatt tccctgatgg taatccgata tctaagatgg aaataagtca
     2641 ataactactt tgttaagtaa ccatcatgcc ttcaagcaat gcaacaacct aagcttattc
     2701 agagcataac aaaaatgaga attactcact gaaacatcct tttggatctg agcttccaag
     2761 ccttgttccc tacattagtt tcattaccaa accatgttca ttatcaaatc actcaaggat
     2821 agttgcaaaa cagttaactg ggatatataa aagatcttct caaatctccg aaactaagta
     2881 atcaaaccaa accatgttca ttatcaaatc acttgaggat tgttgcaaaa aagttaactg
     2941 ggatgtataa aagatcttct caagttatga atctccgaaa ctaagtaata catcaagcaa
     3001 cacgtatctt taaaaccaga ttttttttca agcttcctta caacacacga aacagagcat
     3061 cctcctaata taataataaa aagttacgga atcctataaa gcatctttca gatcacgtga
     3121 tcaacatcag caccgttata gttaatcaga aggttcctcc tagaaaacgc aattactcaa
     3181 aaacaccacc gacagtgatt tgtctgaaaa ctaatcatga attattgttt gccaatataa
     3241 tagaacccat tattgtctct tttaataacc ctacttatct aaacaacact tttatttcca
     3301 tttcaaacta ctatatagca attatataaa gtacacaaca ctacactaaa gtcttataat
     3361 ctaattaatt caacttttta agttaggtag tagcagcatt attccaaaac tcccaatctc
     3421 aaccatcaac aagagaatca tttagcactc taagtagcaa cttaattata tagcttaaga
     3481 aaaattgcat tattaattaa ttttacctgt ccaccagata aaagcacaac acctaatttg
     3541 ccttcataga tagtttttaa tcccattttc caccatttct ctctatcttc cattgttcta
     3601 ccatctactg tcgaaaccca attctccggt accggttcaa tcgccgcaac cggtaaacct
     3661 aattaaccga gaaaaaccga gattatagta caatgcatgt taactaattt gattagcgta
     3721 acgaattaaa aaaccttgag agtgaagtga acatctaatg atccgatcta ttcttggaag
     3781 atccaaattc tgtaagcaga aaataaaata acagtgttat cagttaatta cgcttaaact
     3841 gaatctgaga tccaaatctt aacgaagaat ctggaaaaaa aaaatcgaaa tcacgaacct
     3901 caatatctct aacgagaaaa tctttctcgt ctggtgaaag ttcatcccaa agagagaaaa
     3961 tatcttcttg tccataatct ttcaatctct caactaaagc ttgacgcggt gaagaagcca
     4021 tcggaggagg agaagtcacc gccgtcgtcg ttgttgtcgc cgccgttaaa gcaccattct
     4081 ctctctccat cgacggttct atcattctct atatgcagat ctctctctct ctctctctct
     4141 tggaggctaa aaacgattcg gttttgagtt ttggatttgt gacgtttggc taagttggtt
     4201 ctgttttttg gaagggattt tataatataa ggttttaaca cgagcggagc aaacagtggc
     4261 gaagaagaca agaatcaaca aataatcaat caaccaacgt gtaacaactg gagttatgaa
     4321 atgactgttt cacccctttt gttagtctca tgcattctgt cagagctttc cgacagtttg
     4381 ttgcctagcc cttctggctt gttaagcggg tttcgagttt ccttttctaa ttgtattaaa
     4441 taccaaaact attcatctta tatctacttt tatgtgatag aaaatataca caattctgag
     4501 aaatatttac aaaaaaggca tattttgagt gtcttgaaat acgacacttt ataccaaatt
     4561 tggtgtattt gtatacaaat gccattgtgt attggtatat tttagaaaat gtatatgttt
     4621 ttatagaaat tataaatgct cattttgaaa aagatatgtg ataatacata tttctattaa
     4681 caagactttt taacataacc aaactagatc ttagtcctaa tctcatatac taagccgaaa
     4741 ccggtgaaaa atcgaataat ttttctatat aaaatgttta tagtaatcaa aaaaaaaaaa
     4801 ctacaacgat tttggtagat aatggaattt gattcctcgt tttgatccat atgatgagtt
     4861 tgtaatcctt tagaacaaat tattggatca atcacacact ctttctggtt ttagatctca
     4921 ttttctgata ttattttaat atatatcata cgagctatat taaagtttat ccacaataga
     4981 cggatctttc gatttatagt ggacaatata tgacttatat catttggttt atattcccat
     5041 ttttccttaa aatatgaatg accgacatag tatataatgg gaactgttaa ttgcgtgatg
     5101 gaaaaaatat gtttgattgt atggggaatt gcgtacgtat ttatgaaact aaggtgcaat
     5161 gttatgcatg ggttgttgga gtttatatat agcatcttta cgcatatata tgtattcgag
     5221 ttgctatttt attgatactg tgtagcgtaa taataaaatg aatactattt gataatggtt
     5281 gaactttgga ttcatgccta agtcatggac tataacaggt ttcatgactt tacaaaattt
     5341 tgtataaaaa tcagtaaacc cgcaaaatgt atttatatgt acatactact gttttgttat
     5401 taacataaag cagtgaatat ataatcgaaa acatcacaag gaaacatgga tacatatcaa
     5461 caatttgaaa aataataata caagaatttt ggacggaacc aatgttttaa gtatcgttat
     5521 gtgtttatcg tacattggga ctgtgcttat attataagaa aactgttatt taaccatgca
     5581 attggtgctc caacttaaga tcttgcccga cttcccccaa aacgtataac ttcgtacgtg
     5641 ttcaactgct agtttcaaat aaattgaacg gttctatatt tcaaaatcac ttttgttata
     5701 tttttgtatg ataatcgata tatctattta aacatgtgga tatacaaata caaataaaaa
     5761 aatagatgtt aaaaggatgg tgttgtgctt gacaaaaaaa aggatggtgt tgtaatattc
     5821 atgaaactgt atggattcta ttcttttttt tttttcaact tataacttta tttagaactt
     5881 aaaagtaatc gttgtttaca tatggactca gaaaataagg acaagattga aacagagacc
     5941 attgggtatt ctattcttct atttaaaact tctattgata tatttcacta atctaccgtt
     6001 aggcgttagt tacttagttc aaggtggaga aattggagaa aggtataaat cgagtatgag
     6061 ttgaattggg gcctctagtc tctagtgcac ccaacattac tttaattaac aaagacagct
     6121 aaacaaaagt aagataatta ttagaaaaat aatgattaca tatttaaata ataaatacta
     6181 ttttgaagtt aagttttctg aacattgggc catcattgtt ggctagaaac aaagaaaaaa
     6241 aaacgaacat ttgcccatca ttttatttgg tcatagactt ataatcaact aatcattgtt
     6301 ctgttcttaa tctaattatt agaaaatatc gcatagaaat gtaagcaaaa tactagagct
     6361 ggtgacaaga gtttagggat ttggtgagat gattattcaa ttgttacatc aaacttagtt
     6421 agccggacgg tcacaattta gtttggcctc atcaatccag ccacctttag tggtatatac
     6481 ctaatacttt aactagctaa atatataaaa tagttattaa ttgtatatga tttacaattt
     6541 tgataaatat tatactataa cacaattaga gcgtatcaca tcatttatca tctgggcaat
     6601 ttgttgacac aaaatttaat gttgacagga ataatccata tatttagggt taaaagttct
     6661 cactaacact tggacgaatc acttaacatc atatgtaatt ttgtttatga gaattgttag
     6721 cgtaaagttg tacttatttt tagtgaatca cgtagcatgt tatatattag cttaactttt
     6781 agtatttgtt tttcctcggc tctgatagca tgtagcactt acaaagccat gacaaatttt
     6841 acaaaggcta cattttactt gggaccataa caatacgtaa tgtggcgcta tacgtaatgt
     6901 ggataactgg aaaagagact aaaacacatc ataattcatc ctatttaggt gtccggttcc
     6961 taaataatag ctggaccaag ttattcaccc cacccttact gttttcatca aggtaaccct
     7021 tagggctaag acgacaaaac tttcttagct tataactata taaccaagtt cggctgtttt
     7081 gaaccgttgc taaattgtgt tgttctaata gatcgtttgg ttggcggttg gccaaaataa
     7141 aaatccttac tttggtaaac aaattataaa cgaatatatg atattggtac tctacatgaa
     7201 ttgtaactat ttttccttgg ctttggttat tccttagtcc ttaccgttta acaaaatatg
     7261 tgatgtgcaa attttaaact tcctcgcaca acgaacctga acttgatggt ttcatgcgtt
     7321 acaaaaaggg aaagaaaaag aacttagaaa aatattgttt catgcatgaa tcatgaatgg
     7381 gcttatgcag aaaatccaaa caccaataaa taaatgggcc tagaatactt ccattacttg
     7441 cctaatcgtt ctcttccact aaaagtttac atggtttcat actttcattc atgtaattta
     7501 actaaactat aatcactaat tgaatatttt caattaaact ttcggccatt agaaaaacat
     7561 cttgggttat gttgctatcg attggttatt gactattata tacagagtca aatagaaatg
     7621 ataatgaaat aaacaaaagt caacctcaga aaatttggcc actcaatttc cttttaaatt
     7681 gttatttatt aaaatatgtg aaagaagaac aaaaagatgt cgcaaaagac aagaaacttt
     7741 tggagtggaa ttggactcgg attaaaaggt atgaatgcct gagaaaataa atagcgcacc
     7801 aagaaacgat aataaattaa ttaaacaggc gtgattattg attaatactt taaattatct
     7861 ttttgaaatt aaaagttagg gccagtatgg aatcgtaacc ctttattgct aggtttcgtg
     7921 tcaccaaaca agtaagcatc aaatttaagc ttacgatata agtcaatatt acgtactaga
     7981 tcgtaagggg aaacaagaaa ctaaaatcga ctatcggttg ttgtaaaaat taatctccaa
     8041 tttctattag tattggttac ttatcttttt gtgttatcaa taggatcctg caacagaaaa
     8101 gatttgtgtt ttagatgttt tatgacaaat gataaatcac aactaattaa atagtgtttt
     8161 cttctgttat taatattcga aattgtgaat tcatgacctt aaaagttaaa agcttcttat
     8221 tatatagttt atatgttaca ccaatcaata tgcttacaag ttacaacgga tataattact
     8281 atttggttca tatatttttt cactctatca taattcaaaa ttactgaaaa ctggattacc
     8341 cacactgaga tttgctatgg agtattatat gaaaatatgt agattggaac aatgagtgct
     8401 tctgtgttcg gtaatttgaa accttacaaa ataaatattt taatattcca tattgccccc
     8461 ttacttttgg ttacataaat taaaaagata ataacgtgta tcaataatca cgcttgcata
     8521 ttaaattaac atatccaagt taatttaatt taagttgttt ggcatcgtgt gccaactttt
     8581 tataataatt ggacgcagaa aattaattaa aagaaataaa ccctactgcc cctttctaca
     8641 ccttcctctt tcgccctaag tttttttttg gtagatacga gaagctctat aatggtattg
     8701 atacaacatg caagtagaaa gcaatcaact atatgtgaat aatcagtttt tagtttagtc
     8761 ttttttcatc taaactcctt caatttcgca atgactatta gtatgtactt ttagtttcaa
     8821 tatcagaagt tttgttatcg gtcaaaaaca aaaatctaac cttttggtcg gcaaaccaaa
     8881 atctttatta aagctgggga gcaaagaaaa gaagttggtc aaacctaatg tagcaaggga
     8941 atcagccaaa taattggctt ctctcgataa accaaaaata aattatacta tgaagagaag
     9001 agaagacgac gtaaattttg ttatattgga tctagaacga atcatcataa aagattagct
     9061 agtgactatt gactccgagt ccgattctac tccttatgca cttatgattg atgaagcgtg
     9121 gagcttctag tatcgtcatg ccttctccca ccaatgcttg tacaagagaa tgaaacaaca
     9181 atttttaggc ctcattcacg gacttgtggc acccggccgc atacacgtgt ggcggaggca
     9241 tatcttggta acacaggttg gccaaatggt aaataccaag tctgatgaca atgtacatta
     9301 tgccagagat atgtctcctt gtggcggagg cataaattat tccagtaact ttctggaaat
     9361 aaaagtgata tttaaaatct ttgaaactta gattaatctc caaaatctat aatgttatct
     9421 agaatatcat ggttgaaaag gaaataatta ttactaataa aaagattaac catttttatt
     9481 attgtcgatc aattagttag tatatgatat atatgctgtt tagggaaact caagttttga
     9541 gttagttgtg tgactctgca tgttgtcctg tccaaagatt aatatgctag cttctataga
     9601 attttaactg attgtaaaat attccaagat ccatctagtt gccgaaaaat gtgacaagtt
     9661 catgtagagg tcaaacacat cttcaattga cgtacgatct tacgcagacc gcatataaca
     9721 catccttcgg tggcttatat ataactatat gtaatttaaa tgtaacgtag tggacgtacc
     9781 ccactagcat ataatattgt caccaccacc gatcgtatca tatatacact ttatattctc
     9841 taatgcacat atcctagact cttaaccaac aaaataaaag aaagaagcaa aaagaaaaag
     9901 ctcgaagata ggaaaatgtt aagggaagaa tgtactccaa gttcatcatg gtgggaagat
     9961 gttcaacatc atcataatga tcatgcaaac tcgattagtt cgacgtcttt ctaccataag
    10021 agtagtaata ataactcaca cgccaacgct agctgtgaag aagacaatct ctccgtctct
    10081 accgtacgcg cttcgaatcg tttggaccta accgctgaat cctccaatca tcactctctc
    10141 tcggcttcga atcagcctgc ctcctcctcc gatgagttgc ttcgcgacca tgtagtatct
    10201 tctcataatc atctatggag tcttgccttc ttgtaagcat ctatcaaaac acttaaattt
    10261 tatttatctt ttcgaaccat taacaaatct tctttagtat cgtgttctta cttacaattc
    10321 acataacggt tattgtggat tcaaagttta gtttaaggtt ttaggttcta cgctccactc
    10381 cataaagaaa tcatctagtt ctcactatta atactttcgt ttgtttaaaa agaatgaatg
    10441 ctccaggcct aaaaataaaa caaataaaaa cattagaaac aaaagagagg tctaaaagtt
    10501 ggtttacaaa aagtatatta gtagctcttt tgaattattg ttccccagta aatgatttaa
    10561 cgtttgattg gttagggtat gcctataatt ttgcacttat gattattcat ctttattatt
    10621 ggccactcga agatgtattt ttattcttat tttataatta aaagaagttt taatagttta
    10681 taaaatacta tttgtttttg tttttgcgtc tactggttcc aatatcatgt cttacaattt
    10741 taaaaacaaa gtataaacga caacgtaatt acttgaacaa tatacgaaaa cgttatcata
    10801 ccaaaaaaat atataaacga aaggtcaaat gcaaaccaaa ttaaagtacc acgttgtaac
    10861 tttttacaat ttcccaaaat tattttagtg gaagttttaa tttgtagagt ttcctaagta
    10921 aaattaataa tctagcataa cactaaattc attaaaacca aaaaaaaaat cgagcccata
    10981 tttaacttaa gttttgtaat actaaatacc atattcttac acacacattg acattaattt
    11041 ttaaaaaatg gacaggcctg gtagaagctt aggagatcaa atgatggatc atcatcatca
    11101 catagcatca agaaattcat caacaacatc agaattacca tcattcgagc cagcgtgcca
    11161 taacggtaat ggtaacggtt ggatctatga cccaaatcaa gttaggtacg atcaaagtag
    11221 tgaccaacgg ctgtcaaagt tgacggatct tgtaggcaag cactggtcaa ttgcaccacc
    11281 gaataatccc gacatgaacc ataaccttca tcatcacttc gatcatgatc attctcaaaa
    11341 cgacgacatt tctatgtaca gacaagcctt ggaggtgaaa aatgaggaag atctttgtta
    11401 caataatggc tcaagtggtg gtggttcctt gttccatgat cctatagaaa gttctagaag
    11461 tttccttgat ataaggttaa gtaggccatt aacggatatt aatccgtcat ttaagccatg
    11521 ctttaaggcc ttaaacgtat ccgagtttaa caagaaagaa catcaaacgg catctctggt
    11581 acgtatacgc tatcaaatat gtgatatcat tatcatagct tgctaacgac gtcgtttcaa
    11641 tttgcttatt atttgataat acgttgtact ttagaatgga tttaacgttg atatttctgt
    11701 tgcaatcttt aactttgctt aaggatgcta ccatgcatta aaatttcttc ccagcatttt
    11761 gtggcaaata tatattctat tttgaaaaat atactaaaat aaccacaaat aattttcagt
    11821 ttcgaagatg ccataagttt gagaaaattc tcaaaagtac caccacttaa gcttttagga
    11881 attatttcta aatgtaaagt ttgtggtagt tgaaatttcc tttttttttc ttagtaaagt
    11941 gtttttattt ttccttttgc tactatttgc atggattgtt tcttagcgta agaggtttct
    12001 agttcgcctt tagaattgtc atcctgcata tacaattcaa atccacaaaa caatgtaata
    12061 ttacaaatga aagtctatgt accgacgtat aaacccgaat ttggaagcta tttttgcagg
    12121 cagcagtgag actgggaaca acaaacgctg gaaaaaagaa gagatgtgaa gaaatttccg
    12181 atgaggtttc aaagaaggcc aagtgcagtg agggctctac actttcgcca gagaaggtaa
    12241 tataatctac ataatctcat tatgttttgt gtgtacctaa gtaagtctaa attcatgcaa
    12301 aaaatataat gtgtttctta ggataactta aaaaacaagt gatgaatcta ctttaaaaaa
    12361 aaaaaaaaaa actatacgtc gacaaacact gaatgtgaaa ataatcttta aaaaaaatgt
    12421 atgattcgta atgggacata tagataacaa ttgccctgat tttgtatggt aaacatatgt
    12481 aaataatttg tcactattat tttcatatga tttgttcatg ttatgatatt aattgtttga
    12541 atcataccgg ataaataaaa tcaaaattct aacattattt tcgaaaaata aatggcagga
    12601 actacccaaa gccaaacttc gagacaagat cacgactcta cagcaaattg tgtctccctt
    12661 tggaaaggta ctacaaaaaa agaccgtact ccttttcttt atttgttgtc atattatttt
    12721 aaaaatattt tatttttgta acagctttta gttttttttt ttaattttat aaatcatata
    12781 tagttcttct ctctttcaac gtttcttttc aaaaaataca acgaagaaaa tgaaacattt
    12841 cgtttgaaaa catttcagac tgatactgct tctgtgcttc aagaggccat cacttacata
    12901 aatttttatc aagagcaagt taaggtaaat tatatacata cacggtaaaa tttacgaaaa
    12961 tgaaggtaaa ttgttgcatg tctatgcaag catgactatc ttagttgact gttggtgatt
    13021 ttaacgaaca tgcagctgct aagcactcct tatatgaaga attcatcaat gaaggtaacg
    13081 tttataaaat attttcttca tgacgtttta gataatggaa tctcttcagc taattaatca
    13141 taatgtcata tgtatggttt taggatccat gggggggatg ggacagagaa gatcacaaca
    13201 aaaggggacc gaagcatctt gatctaagga gtagagggct ttgtttggtt cctatttcat
    13261 ataccccaat cgcataccgc gataacagtg caactgacta ctggaatccc acgtatagag
    13321 gttctttgta tcgttagtga ctagtatagc aaaaagtgtg tagagagaaa gatttgatta
    13381 aattatggta gtggtaaacc attccaaaca tcgatcattt tatagggagc aagcagtaaa
    13441 acgggagaag agtatgtgta cataaagtat atgcatatta atcattgggg tcacacttct
    13501 ttgatttgca attgttcttg cgtaacctaa aacattgtgt tatggtcata tatagaataa
    13561 tacattaata ttggagtttg aattagatat actacaatgt aataaaaagt agttaattaa
    13621 tggcatattc cttgttgatt tcaaccattt gactaggcgt tagccattca aatggtttac
    13681 tatgattttt atttcagttt agaattcatt ttgttaacaa acttatcttt aaattgattt
    13741 tttaaaaata aacttaagca acacaaattt tggagttttt tttttctttt acatttttgt
    13801 atagaataag taaaattgat tgttctcttt gcatcatttt tgtagatggt tttgattcgg
    13861 tttgaaacga tttaaccaaa taatagatgc cacagcatag taaatgggct tccgagagcg
    13921 tataaacgaa ttgggttttt ctataattgg gccaacgatg cctttatttt ataacatgag
    13981 acttaatgct acacaataca aacaaaaaaa atgtttccgg aaaaccgaaa atctgaccat
    14041 atatgttttg gaaaatgacc aataaactaa ttctatttgg ttgacacaag aaaaaaatat
    14101 gtaatcctat caatttatga aaaaatactg aaaacttata tacgaattgc aagtctaaac
    14161 tgtctattca atctgaaata cttcacttta cttaacaatt ttacaaactc ataaactatt
    14221 taagttttat caatagagta gatccaagca attctcaaag atataaaaaa gcatcaactt
    14281 aaccatataa agattaaccg aagtttataa gaaatttgca attcgttgaa tctatactat
    14341 ctaaaagtcg agattataag tttttgatga tattcacgta agattttaaa cgatcaatca
    14401 catttaaaca tctcattagt taacataaaa atgataagta tattgaatta tgtaagtaaa
    14461 ctaaagcatt ttcgcaaaaa tactctatta tagaagtata ttcaaattat aaatcgaaga
    14521 acattagcgc atcattccat gggcatgtat aatttcattt attcgcaagt ttgtattgac
    14581 ttgagtgttt ggaaatcatt aataactcta caccaacatc tcaaacaaat ttgatctttg
    14641 cactcgtgat gcatgtaagc atattcatca actcttcaac cgttagtctc aataatctaa
    14701 aaacttatac atatatgcaa taatcaaaat tatccgcaaa ttttaaaaat catgcacata
    14761 attctaatta accaaaacta gtatgaacac attatatagc aaaaaatagc taagtatatt
    14821 aaagatgcaa agagaacaaa aatgcgagaa agctttaaga aaccgaggtg aagagaagag
    14881 ttaaaagctt taaaaaaaaa aggagcagca ctcttgccaa ggccaaagtc tctgccatcc
    14941 atactctctt gtattttttc gttattatat ttatttaaaa aaaactattt ttttaccatt
    15001 ttttcatatc ttagagcatt ttcaatagag cgttattaaa tgaatattat ttattaaaaa
    15061 taaacatgtt ataaaaaaga gagagtaaaa aaaatgctct tatacaagag attcggtaac
    15121 ttaagttata tgaaacacat gttttctata tattggttta attttatttt aaaagtaaaa
    15181 tttaattata taactaaatt atattaaaat aataatattt ttatatataa gaaaaaaatc
    15241 taagagccat cgattgagga tgttcttata ccatgcactt ttattataca ttaatgtaga
    15301 taaatatttt acaataacaa tgtattatca tttcaaaatg gtattttatg tacattaaaa
    15361 ttaattattc aataaaagag tctttatagt gaacaaattg atttttcaaa gtctaaatat
    15421 aaatattctt tcaaattaaa ttagttttct ttagttggat agcaatatga ttgattttag
    15481 gataattgca tcatataatg tatttgattt gggcttaact aagtttattg catgggagat
    15541 tattattaaa aactacaaac ttgaagtact attataaaag caaaaatacg atttttttta
    15601 atatcttttt tgaaagagag aaatagagag tggcaatgtt gatataattt ttaagaactt
    15661 atataaactt tttaatctat aatctaataa cgcaacatta cacactttta aactttgttt
    15721 gttcttctaa tataaaattt aaatctgtgc atagcataat gacaccaagt atattatttt
    15781 tcctatgcta ataactacgt ttttaacatt aacaaatttc tatagatttc gaattggtca
    15841 cgagttttat ttagtaaaat gcaaatatac cgtgtgaata aagtataaac ataatcacta
    15901 tcattacaaa aattattatg ataaaattat cactccatat cttttcttat cattatcaat
    15961 ccattatatc ttcccaatgt catatgatat aaatatcaca ccataactac acctatgcct
    16021 tcgcaagata taaatatagg agtgataata tacgtaatta tgctataaat gatagtaaat
    16081 gttataaata aaagctacgt aaaacttttc aaaaatatga aattttaaaa atctttttaa
    16141 atagaaaaat cacatcttct tttttatgtt aggtagaagg aagggagaca tgagtcatca
    16201 tatccagaaa aggtaaatta accttagaga tccctccaaa caaactaatc ttcagggaca
    16261 cttgtcctca atgaaattaa atgcaccaca aacaaaagat caatagatat acactacaca
    16321 acacatctct aattttattt taactttttt ccttaacaga aagaaacaga taaaaccccc
    16381 tcaagaaata tctcagtcca atctttttgt tcaatgcaaa aggtaatcaa aaacttcaaa
    16441 ttgggtttgt tttgcccaat ggaaaaatca cgactaaatc tttaatactc catgacattt
    16501 tgtcacacac cttctctctt aaaattggat ctttcgccaa tggagaaata gatttgatct
    16561 ttctttgaac atttcgtttt ctcaataaaa gacattctct ctctctcttt ctcccaccca
    16621 cccaaccaac actttctctc tctatacgta gcgacaataa ttctggaacc tcctctacat
    16681 tacaaaaacc catttatata catacataca catacacata acattagata ttatatataa
    16741 acatttacac actcttcttc ttcacacaca cacacacact ctccaaaatt taagctccca
    16801 atcaaaatct ctcttagggt tcttcttctt caataaattg agtgactctt taattaccat
    16861 aaaaatccac agaaatggtt agagaaggtg aagaagaaga agagatgatg atgatgatgg
    16921 caacgaaacc tgcatggctt gaaggtttaa tggcggagac tttcttctca agctgtggaa
    16981 tccacgaaac tcgccgtaaa agtgaaaaga acgttttttg cttactctgt tgtctcagtg
    17041 tttgtcctca ctgtctccct tctcatcgct ctcatcctct tcttcaggta accgatttga
    17101 ttccttgaca atttcaatac ccatgttttt ttttgtgtgt gaattgtaat tatatttttg
    17161 tgatgaaatc tgtacttaca ctgaatcact gtgtacgtat gatttctcta agaaaattct
    17221 ctctttcata agagatgttt ggattgtagc gaaatatgta tatactcaca aacgttagca
    17281 aattgttaaa tttaaccata aaccattttt tttttcttgg taattttccc ggaaaattct
    17341 caattccggg actagtctgg agttcggttt aagattttcc ctgttaacaa aaaaaaaaat
    17401 gcaaatcata gagcttttgg aactttgttt tttaatggac ctttcattat cataaacttt
    17461 ttcttctccc caaaaatatg tttctttata atgttcatct acttaagcca tctttctaaa
    17521 tttctcataa ctatagtttt tcctctaaga ttgaattgta catgtttgat ttagttactc
    17581 taaacatatg atcatttctc taattatgtt gagaattgta gagtatgtat aaccaaccgt
    17641 acagtgtata gatttatatg tatcatggat ttatgtgatg atagtaattg gacttgaatt
    17701 gtctattgtg tggatttggt ttgtttctat atatagtatg tatctttttc tcatctttta
    17761 ttaattcttt ctcttttcaa attgcttggt tcctttaaaa tttgttgtct tctctgttca
    17821 acttctcttg tgctgttgct ttcaaagaac atcaaagctt tgaccaaatt ccttttcctt
    17881 cacttccctt aacttctttt caacaggttt ttgtttttat caattcatat tttttaatca
    17941 ttttccacta ttccccaaaa aaacattatt ggtgcaaatc tatccttctt gataatatta
    18001 taagatttat ttattaccct gttgtttgct tcaatagaga taagaaggat tttttttgaa
    18061 ggaattatga aatttacccc attagttaaa attgtggcaa ttaaatcctt tcgtttatga
    18121 attggcaggt gagacgatac gtataccacg acgtcgttcg gttgagtgat cttgagaagc
    18181 tcatagattg ttcatatgtt caggtgaatt ctactctttc taaagatttt gatttgatgt
    18241 ttaatttatt atactgatag agaatttgta tattcagcca tatacaatta atggagccaa
    18301 agtgatattc ttaaaccaaa gacaacaatc acgagctaag gtttcttcaa atgtttgctt
    18361 cacttgtgat agaatccttc aagaaccatt ccacttttgt tccctctctt gcaaggtaat
    18421 aatattgcaa caaaaatttg gaaattattt tacttttagg ttatccctaa ttgaaaaaat
    18481 aacttaaacc ttataattcg atttttttgt ccttcctagt gcaataaaaa catggaaatt
    18541 agttataagt tgttgacata gttgacccat gaatgaacaa aagtgagacc cattaactct
    18601 tgagattcac ttgttgattg tttttattct gtaaaaattg gaaaaaataa tagaatagaa
    18661 tgattgcttc aactttttaa ccatatgaca taaagttttt tttaaaacaa atcattacac
    18721 ttaagatgaa aaaacaaaac tttgggaaac agctgttttt tctatgcttt ataatcatgt
    18781 tcaaaaaatt tggattaatg tgttcatttg tttaatattc ttaaacacat gtgcaagtac
    18841 aaagtgggca ctctcctaag ttatgaacta tcatgtccaa tattagccgt atgcgttgtt
    18901 attattataa agacacaatt atgttaccta acaatgatta aaaaaaaatt gaatgcaggt
    18961 ggattattta tcatatcaag gagatgattt atcaagcatt ctctatagaa ttgatgaatc
    19021 agattttacg ttcgagggtt tgagaatgga cggacatgat cagctcggag agatatcgac
    19081 gatggaggat ggggaggata tactggtaat ttcagatgaa tctgagcaag gtaacaatag
    19141 tcataagaaa gagaagaaga agagcaagaa gaagaagcca gagagcaatt acttgcctgg
    19201 gatggttctt tcatcacttg gtaatagaag aaaaggtgct cctcataggg ctcctttttc
    19261 ataattataa accaatataa ccataggcaa aaatcatata tatattttat ataaataagc
    19321 attccatatt tatatatgta gcgtgtttta tttattaggt atatcttgta acgggtacga
    19381 taaaataagt agtactcttt aatcacgaaa atgtgtttac ttttgtgggg tttttttttc
    19441 ttgcttttgt gggtagtgtc aaattagttt cttacttgta ttcgttgatg aattattggt
    19501 ctcttcatga ataaaagaag ttgtatgtga ttttggtact atataaaagt atattcgtcg
    19561 taataagtgt agattaataa atctaaagaa aaggaagagg actcgtagtt tgggtaaatt
    19621 tcattgggag agggaagaga cgacgacagg ttttcacggg gacagctgaa aagtcttagc
    19681 tgcgtcatca attacaccag tcaccaacac cgttttttct actttactag tatgaaaata
    19741 aaatgttagt ttttttattt ttcttttcaa caccaataaa atgttgtgta ctttcaacag
    19801 acaacaagca ataagtttaa gattttaaag tggtatcaat ttatgtttag tgtgatatca
    19861 tagtaattag tttgataata cagaaatttt aaacgcttta caatattctt tttttttgtt
    19921 actgttattt tgattgacaa acctatctat aattaattga tttttaagag ttttgacgat
    19981 ttctattaaa gtgttgtttt ttcaattttg gatttatttt taaaaatgat gttagttcta
    20041 cgaaatcaaa aataatatgt aatataaatt gtcgtcataa aatattaaca tataatatat
    20101 catattgaaa ttttcactac aaaaaatcca agttaatatt tgaaattttg taaatctaaa
    20161 gtatgtaacc gtagaaacat tttgaaattt gtgtattatt ggagataaat gataaactta
    20221 tagaaaatgg tgattttctt ttttgcagaa aaccgtaaat tatataacac ggagtaacat
    20281 aaatgtatgg agcccaaaca tattcaactc ttgtatttta agagtatgtt aacacaaaaa
    20341 aaagtaggtg ttcttttgtg ggaattgttt atcttaagtt tgtccttttt acagtaggtc
    20401 atgtgtagag actgccacaa tattgatata aactatataa aatacattgg ttttctactc
    20461 ttgttagtga tagttttcac aatcgaataa gtggttctga taaatggttt tcttatgatt
    20521 tattcaatta atttgtagga actctatgtt tgttttactt gcaaatgtat cttaggatcc
    20581 cttcatcggg aactaaaccc acctcatggt ccggggattt tatcaatgtt tttttttttt
    20641 ttgtgtgagg taaggatagt ttcttatgaa taaacacatt tcaaaggaca attatggaag
    20701 tagatttaat cgttatataa agacgatatc aggatctttc ttacaccata aaattccaaa
    20761 ccggtttcta aaatgtttat cgacaaaata aattcatata taaatattag tatatctctt
    20821 gaatttaatt gtcagtaaaa atcattaaac cgtatacata tttttttaaa acctgtcttt
    20881 atttttattt ttctctcatt ttggtcattt taattgttac tagtacttag tattaaaaca
    20941 aaacaaaaga aacacttacc caacttttca gaacttccgt acaagaaaga catgatttag
    21001 tgatctaata attagtgtcg ccagtgaata ctgaatggtg atagacaaaa aatatcacgt
    21061 gtgcgtataa gacttagtga aaaaaattaa gaaacagttt actaattaag ggcaaaaaac
    21121 tataattaga gaaacgtatg aaagtaatat gcgtgagaaa taaaaaggga ttattcagag
    21181 attgatgagg ataaaaagca catggtcggt ccacatcttc gtattaggtt tccatatttg
    21241 taacaatcta tgcaacagtt ttgtagcata tataagtcca ttggcgtaca tacagtaggt
    21301 ggcaaaacgg gcatttgaca cgtgtctttc tctgccataa ataccttcat gttccttctc
    21361 ctccacatgc aaaatgcaat ggctttgggc ttaacatttt tttaagataa gtctattaaa
    21421 atattaacta gtatactaaa ttagtaagac ttaataatta tatgtattca taccagtaat
    21481 tgatacaaat gtttttttta ttggagcaaa cacagttttg ttagtattat actatactga
    21541 tcactttttt acaatccaga ttagttccta accatacaat gatacaataa aatatagtaa
    21601 ttgacttttc catgatttat cattattttc ttatcattac attttttaat gattttttct
    21661 gagactaatt taaaatattt ttattagctt aaaattcatt aatatggaaa acatgaaaaa
    21721 atataaacaa tttttaataa atggaaggag gaaatatttt tagaatacta ctagaaatgt
    21781 agaaggttta tatatatata tatatatata tatatatata tatatatata tatatatata
    21841 tatatatata tatatatgaa tttttcaaca ttcttttttg ttgatccata tgattttttt
    21901 attgaatttt tttttttcaa aactttccac agagctgtta ttgaaaggga aactaaaaac
    21961 atgattaagg aaatttattg tacggatggt agagtggtgc aaggggatga catcatggtt
    22021 gaggctgaaa aattctttaa agagtttctc cagctaattc cagaggattt tgtgggtgtc
    22081 gaggttagag agttgcaaga tctcctgcag ttccgttgta caaacagtga taatgagatg
    22141 cttacaagag aggtctcatc agaggagatt aaaacagttt tattttcaat gccaaaggat
    22201 aaatctccag gtcctgatgg atatacgtca gagttttata aagcaacttg ggatattatt
    22261 ggacaagaat tcactttgcc tgttcaatct tttttccaga agggttttct tcctaagggc
    22321 attaattcca tcatcctcgc gcttattcca aagaagttgg cagctaagga aatgcgggat
    22381 tatagaccaa tctcctgttg caatgtactc tacaaggtca tctcgaagat tattgcaaac
    22441 cgcttgaaac tgttgttacc gagatttatc gctgaaaatc aatcagcttt cgttaaggac
    22501 agattgctaa ttgagaatct gctgcttgct acggagcttg tgaaagatta tcataaagat
    22561 tcgatctcgg cgcggtgtgc tataaagatc gacatatcta aagcttttga ttcagtccaa
    22621 tggtccttcc ttacaaacac gttggtagcc atgaatttct ctcccacgtt tattcattgg
    22681 attaatcttt gtattactac ggcctctttc tcggttcagg ttaatgggga tcttgtgggt
    22741 tatttccaga gcaagcgggg tctaaggcag ggctgctccc tctcgcctta tctgtttgtc
    22801 atatgcatgg atgttctttc gaagatgctg gataaggctg caggtgtaag gaaattcggt
    22861 ttccacccga agtgtcaacg tttgggacta acacacctta gttttgcaga tgatttgatg
    22921 gttctctcag atggtaagac tcgatctatc gaaggaatac tggaggtttt tgatgagttt
    22981 tgtaaacgtt cgggtttgag aataagtttg gaaaagtcga ctttatacat ggcaggggtt
    23041 tccccaataa tcaaacaaga gatagcggct aaatttcttt tcgatgtggg gcaacttccg
    23101 gtgcgatatc taggtttgcc gttggtaact aaaaggctca cgtcagcaga ctactcacct
    23161 cttcttgagc agatcaaaaa acgcatcgca acttggactt ttcgtttctt ctctttcgca
    23221 ggtcgtttta atctgataaa gtcggttctc tggagtattt gtaacttctg gctggctgct
    23281 ttccggttac cccgtcaatg catacgagag atcgacaagt tatgttcatc cttcctttgg
    23341 tcaggttctg aaatgagttc acataaggcg aaaatttcat gggatatagt gtgcaaacca
    23401 aaagctgagg ggggtctggg tttacgaaat ttaaaggaag caaatgatgt aagttgtcta
    23461 aaactggtat ggcgaatcat ctctaatagc aattcacttt ggaccaaatg ggttgctgaa
    23521 tacttaatca gaaagaagtc tatatggtcg ttaaaacaga gcacgagtat gggctcttgg
    23581 atttggagaa agattcttaa aatcagggat gtagctaaat cgtttagtag agttgaggtg
    23641 gggaatggag aaagtgcatc tttctggtat gatcattggt ccgctcatgg gagattgatt
    23701 gataccgttg gtgacaaagg aaccatagat ctcgggatac ccagggaggc ttcagtggca
    23761 gatgcttgga ctagaagaag tcgtcggcgc catcgcacta gtctgttaaa cgagatagaa
    23821 gagatgatgg catatcaacg catacatcat agtgatgcag aagatacggt tctatggagg
    23881 ggaaaaaatg atgttttcaa accacatttc tccacaaggg atacttggca tcttattaag
    23941 gccacctcct ccacagtctc ttggcacaaa ggggtgtggt tccgtcacgc tactccgaag
    24001 tatgctctct gtacttggtt agctatccat aataggcttc ccacgggcga ccgtatgctg
    24061 aagtggaata gcagtggaag tgtatcagga aactgcgtat tatgtacgaa caactccaaa
    24121 actctcgaac acctcttctt ctcttgttca tatgcttcta cagtttgggc tgcgcttgcg
    24181 aagggcatat ggaaaacaag gtattcaact aggtggtccc atttactcac tcacatatca
    24241 actcatttcc aggaccgtgt agaaggattt ctaacccggt atatcttcca agccacaatc
    24301 tatcacgtat ggcgcgagcg aaacggtagg agacacgatg ctgcacccaa cacaccagcc
    24361 actgtgattg gatggattga taagcagaca cggaaccaaa tcacaatcat cagacaatcc
    24421 ggagataggc gttacgataa ggccttccaa gcttggctac gagctcgata ttgatcattt
    24481 ttaacagttt ttctagtctt agaaattagt cttaaatact tttaataacc tgctgcacta
    24541 gttgtaacaa agtacacttt ttcttttaaa tataatttaa cattaaattt ttttaaaaaa
    24601 atatataggg aagaaataga gatcttaata ttcgtttatt ggaaaagagg cataaggcgg
    24661 agagatgggt tcccattcac ccatacagac tttttcaaga accatgccaa ttcccacctg
    24721 actcctgacg tttctttttt aatttaaaaa actacacatt ttcataatat aatataattt
    24781 cattaaatta tttaggatgc acaccaaaaa taaagcaaaa caaaaactat agtaagtaca
    24841 tctttattga gttatatatt ttactcactg caaaatttga tataattatg aaaatttgaa
    24901 gttttgtata taaatgatac accaaaattt tgtggtcact ttcgataaat atatgtcaat
    24961 acaatatgag tcttttacac aaatacatta ctatatattt attaataagt aaatatgata
    25021 atggatatgt atcacctgga cagcctgtgc ttcaaggcac aagaggttcg aggtagtcgg
    25081 acagatagga aacaatagga cgtgtgtatg tgtcatacag cctttttagt tgcagaagtc
    25141 cactaagatc tctttctcta tcgtcgaaaa aatatctaaa tcaatattat ttatttatct
    25201 tataaagaaa aacatttatg taccttatat atataatatg tatacattct atgattttat
    25261 tatagtaggc acaacatgaa atggaaatta acattaatgc cgaaatacat accatatgtt
    25321 gaagatataa atcatattat tgtcgatcaa atatattaca tgcttagtta atttcctaaa
    25381 tctgtgatgt agaatttcaa atatgttttc tctacattat gattaatata atatctccaa
    25441 catatgatat gtaccctgca aaagcaacga tgagggcaaa caactaatgc agtggaacac
    25501 atgaagatga gatgtatgcg gaaaaccgtt tttgaagtat aatttaagtt aattagctag
    25561 atggccaagt tagtttaaaa ttggtaattc gagtggcaca tgaaaaatat agagaaaaaa
    25621 tcgtgtacat tttcatccac ttaaagaatt ttgcaaataa atctttctat agccattctt
    25681 ttccagtttg tactacgata aattttatag attattaaaa ctggaatgat atataagaat
    25741 attgtaagag gtttggaatg tccaaatttt gtggaatttc tgtgtctctt tgttctccaa
    25801 attttaacaa tactcaatgg ttgtaaaatt gacctctaat tgtttaacca cagttaagcc
    25861 tcaaaccaag tttctaggac tcattatttt cgtatcatgt gaatctgtga ataatgataa
    25921 aacatgaaaa taaatggtag tgatgtcatg taaagttgca aggagtttta tcgcaacaaa
    25981 atgacatgtc aatgaaatat tttaatataa aattttgatt tctttctcta tttatatcta
    26041 ataatgtcga aaagtttgat ataagaattg ttgtttaagg ttaaatcaga atattggatt
    26101 tgtcactaac attgtggcat gaagtagtag aaagtacaag ctgatgaagt tataacttga
    26161 aattgattgt attgaaagct tgtgtagtta gtattgtgca atgaagtttt cttgtcgtat
    26221 caatcaatct gcttatttcc gctaaattca catacttgct aagtcgaatc ttaataaaca
    26281 taataagatt tttaattata aaatagttaa cacaatgagt ttcatttgga atatttgttc
    26341 caagaaaaag aaagagagaa agagttgagg catatggtat gatagaagct tttgaccgtt
    26401 tactcaatca tttaggtaaa tggaacctac atgatgtcga tttctttgta atgtgtaggc
    26461 ttcactccct aaaggaccca cgtgattatt ttagaaagat atctagtaaa aatacaaaaa
    26521 atgagcagtt caaagtattt tgatttatct ttttattaag tttcttagta tgtcccctca
    26581 atgcacatga caatgactac ccaccttagt tataaactag aaacccctat ttttgagaca
    26641 caataagaga gataccaaaa gctttcaaga agaaaataaa cttattgcaa ggagaaacaa
    26701 attgcaaacg catataatgt aattgtaata cataaacaaa aactggagtg tcactccttt
    26761 aatattgcga gacttcaata attacttcta aagcatacgg catgggattt agaaacatca
    26821 agtcgtatgt ttgcttttat attaaccatt ttttgtgtat cacaatataa taaccatttc
    26881 tgtcattgta tctcttaaga aaaaaaaata tgtccatgta tctccactaa gaaattgtct
    26941 cctaagctta aaacaatagt tatatttata tttgctaagt aatagattaa tatcatcatt
    27001 gggttgtttc ccttattgtt gatcattgag tttgctttgg tgatcgaggt aagagaccgc
    27061 atatatgcat ggctttgact gagctatgtc ttaagttttg gtcgacatga ctaaatgata
    27121 gactatctag gattattgta tatatgaaaa ctcaaacgtt ttcaaattta aatactttga
    27181 aaatttgtta tataaaacca taattaacta atgaatttgt ttattaaaac ccccataatt
    27241 aacttatggt ttcaatttct ttgaatagtg atgaaaagtt catatttcca caagaaatgg
    27301 tcaatttttt ctttgaatag taagtaataa agataatagt aatataatgt gaagaaaaaa
    27361 ggagggttga aaatgatgaa ggtggtggtg cagagaggcc atagaaagaa aactagctgg
    27421 ccaatttact ccctgcagaa tctggcaatc tattagcctt tctttagatg ggaccttctt
    27481 tgagattgaa attgagagag gagagagaaa tagtcttctc cattttgatg gatctgactc
    27541 actgctccaa aagatcactc tcattattga aaacacttgt cagtcctttt ggcctcctta
    27601 ggacctccta ccgatcttgt tctgtcttct tgattataga gttcaaatgg tggcaatgtt
    27661 cttgatttaa ttatcagaaa actgcagttt aatcacagaa aattcgtcta catatcagtt
    27721 gtaattaatc aagtggtttt ttgtgaaaaa tacatttaat tttctatcgc cttatcttgt
    27781 acggtgatag tacttataaa tgtgtatatg gatgaatcat tatttatgat cccaaatcct
    27841 attcaaaatt tcaaaatctg agaggtccaa aatcccgaaa gtaaatttgg atccctcaaa
    27901 attaggttcg gatttgagta ttctaattta acatctagac ataaatatat atgtatatat
    27961 aataagtaaa ttatttctta catatgtttt gtgaagatac atatatagta tcttttattt
    28021 ataaagatac atatttagta atcaatgttt gttattttat gatatattag atttttaaaa
    28081 ttatttcagt atgttattta attatgttaa attcttttgt ctttaacgaa tttgattcta
    28141 aattttggat ggatatccgg aagctacata tccaaatatg aatatttgta ggttggattt
    28201 agattatctt ggatttgttg gtatatgata tgtttccatt cctaaatgtg taagcatcat
    28261 aaaattgcaa taaatttaac tatatcacag tctagtagaa gacaaactga gtgtattatt
    28321 cttttatcaa atatattttt gggaatgaca taatcttatt tgatatgaca acacatagga
    28381 tggtatcttc aatcttaatt gcactaatat ataataatta tataaaatga caaaacatat
    28441 gctgtgattg aaccaaatag aacattttga ccctatacta tagcttcttc cttacctagt
    28501 aatcaaagag ttgtgaactt ttctaacttt tcttttgccg catatgatat aacttatcgg
    28561 tatttcgcca aattgaagga tcatttcctc aagtcttgat aactcaaata aaagtttaag
    28621 gaaaagtttc atagatagtt atcacttaat actataaaac ttcatgacag cttttggcta
    28681 tcaaagtctg tttaagcata gatatggatc gtgtttttgc tatgaatagc aaaaaagatg
    28741 ataagattag tgataatata tggaaaataa aaggagactg aaataaaagt actgaagaaa
    28801 caaaagaggg ccaaatcatt gtccttctcc tttgaccatt ccccaccctc ctctctctcg
    28861 tcatcccatt tatttttctt atcattatta tatacttgct ttcgataaaa ccaaaagaag
    28921 gattgaagta aaagaagacc acaaaagaat tttaccttaa ataggattat ttttattatt
    28981 tttaaaatga gctattttat atctaagatt gatcctcata aaatatgaac tattacatag
    29041 taatggatgt aaacttacag aaaatttgtg atgtagtgtt ggttgagtcg ttcattaaga
    29101 tttcatgtgg tgaaagtaaa ttttatcatc ttgagtagca cataaactag atctttgtta
    29161 tgtgtgtaaa ctgttttact gtgaaagtgt ttgtaaaacc gtttattata ttttatttgt
    29221 tgcataaaat tataatttgg tgtataagca cttaacttaa cccttggtaa cccacttcca
    29281 aattagactt ccacgacttt gttttcacga aatatatttt tgcttatata ttaaaaaatt
    29341 gtttagacga aaatgcttat cgatattgtt catcacgttt tgtcatgttt ggtgatgttc
    29401 atgttctcgg ttatattaat gtgtaaccga aaacttacaa aagttaatga aaatttacaa
    29461 ttgttgtgaa ttacgccaaa gaattttgaa aatttggaga aatcattact tgtaagtcta
    29521 cataattgtc tttaattaac aagaagaaaa gtatacaatt tgttttgaaa tttcttaaaa
    29581 cctttttgcc aaatttgtat gagaaaatta caataataag tcatgactta tatcgaattt
    29641 gtagtgtttt ttttttgttt ctcgtttgta tcgggtacga tccagtggta gtgttacgat
    29701 acaaagagaa gaaggacaaa gataaaatca taaaaggata gagataagag aagttgttgt
    29761 gtatatacat aaaatgttct cattcattaa tgattgttaa gtgtctgtat ggagctgtaa
    29821 aaacagattg tactataccg gtcaaatccg gtcctactca ctatcatcat ctaactccct
    29881 cctttgtatt tgtttcttct tctcttatca ctgattttta ccactgtcct gtccttttcc
    29941 ggtttaatct cggtttggtt tagccaaatt tgaagtccca actaaaattc ttgttctggt
    30001 ttttattgtc tttatggtct agagaaatca taagaatctt cttaagacta gcccgattct
    30061 gtttcatcca tccatattgg gccaagaaac atgtccaaat cacattcttt cacaaaaaaa
    30121 aaaactatga gtaacattta gaatgaagag tgaaaacaaa caaattgtac accattttat
    30181 tttaactcag ttttattatg ctctaaaccg gaaaaagaac tcttaataga aaccaaactt
    30241 agcaccctta tgaatttgca ggaacacgag aatcaaagaa tctaacttaa aagcaaaagc
    30301 acaagataat cacaactcaa agcaatgtag tgtacagaag tcaagagtct ctctcacttg
    30361 tagagttgtt ccatgacact cttcagcctc accacatcaa cgcctacaat ctctgctttc
    30421 ttcacgccac ctttgaagaa ttgcagtgtt ggctgcattc atcaaattat cataatgctc
    30481 cattagatgg atctcaaaca ttgataatat tagagttcat atagatgcaa agctagctcg
    30541 tgcttgatcc taaaatgtaa agtatttttt gaaaggaaca gaggatgtta ccacagcaga
    30601 tacatttaac ttcccaatag catttgatag accgccctgc aaatatgtaa taagagatat
    30661 ctttgtcaac ggagcttaca atgatactca taacaagaca gcttatttgt gtgtggctca
    30721 accacaaaat ttctctacta agtgacttat gtcgcttttg agaatgtgat atcagtaacc
    30781 agttacagga agcataatgt agcaacatat ctcagactta acattagttg agttctccat
    30841 ttggttcgac atatcgacta ataaaaggca tttgatagca gatactctaa aatcttctaa
    30901 ccacagaaca gaacaattta caatgatggc ttcggtcgca tgatgacact tgtataaacc
    30961 tataaaagtc atgctaatga tgcaaacaca cctcgtcaat gtcgacctta tacgttgtta
    31021 catcaggata tttattactg agctccaata tcacaggaga gataagcctg cctagagcca
    31081 aaccatacaa aaattaataa cgccacacgt agaaaagatt tactatccag aagctttcat
    31141 ggaactaaaa cttacaaggt ccacaccatg cggcagtgaa atagaaaacc gatggcaaag
    31201 atccatctga aaaaaatgaa taacatcaag agaagataaa gcagagctga atcatactaa
    31261 gcaactcata taattctgaa gtagttaaca aaagaaacca atgactgttt gtttatttac
    31321 ctcgagcttt actcaatgca ctgttgaact ctgcttccga tttcaacact acaaagctgg
    31381 atcgatctaa atttcaaatt acagagatca gcaaaactcc tcaaacacaa ggtaccattg
    31441 taccaccatc aagcttaaag ctcatatttt tcgattcaat tcgtttctca acaaataaaa
    31501 aaaatcatct agacaatacc cttgaaccaa ttcatgtact atgcaagaac aattagaatt
    31561 aacacacaac caaattaagc aatttacctc cttctgcaaa acagaagctt cttcgattaa
    31621 gaagagaagt gtttaagaag ttgaattcgt ttgaaacgta aacagtagaa gcagctaaga
    31681 aagagtttct cccaatctgc aaaaacaacg agtttgggaa tagaatcaga gatggttcgg
    31741 aattgggggt ctaagatcag agaaagatga aaaacctgat gaaaattaga ccattgactc
    31801 ttcatagtat aaacacacca agcttcgatt caaaggtctc tccttttcgt cgatttaggg
    31861 tttctccagt tttccgattt cttttttccg ccagcgttct ctcccgccgc gcacggcgaa
    31921 gtgacaaact aaacaaaaat aaattacaaa ataaccctca caaaagctac gttttctaaa
    31981 tcagccccgt caaaaacagc atcgtttcgt aagggcacta ttgtacgcga aacgacatcg
    32041 tttagttttt tgccgcgaaa cgactttgtg aagaaacggc accgtttatt gacgaacccg
    32101 agaatctaaa aaggcgtagt ctttcttttt ttgtcgtcaa accccataaa ccctaaaagg
    32161 ctaaaagttt gaatcttcac gaaatgcagt ttcttggaag atcaatttcg aaatcgataa
    32221 gaccttcgtt aaattcaact gctagaaaat catgggttct ttcttctcag caatttcttt
    32281 caacttcttc tacggaaagt agtagccgta ctcgcggagg aggaggagga aacagagctg
    32341 agaaatcgtc ggaggagtgg ccgagaccga tggaggtacc gtaccaaccc aaaatcgcga
    32401 actctataga tttaattggt tacgttcacc aaccagttca gttcgactct acactcgatg
    32461 gaaaattctg ggcaggcaca gtcatttctc atgaaccttc ttctgattcc aagtctgagt
    32521 ctgattcatc tagtaacttc tggttagtct tttgaaagtt tgttgctttt ttgggtttta
    32581 gagttttgca tgttggtcta ttgtcgtttt gtaactctgt acttggctaa agtcaagtct
    32641 ttaagccatg atttgtgaag ttttgggttt tgattctgag ttttgttgat tgtcttgtag
    32701 gttggttctt ataaagttta agactttaag ccatgaaatg tgaatttatg ggttttggtt
    32761 ctgaattttg ttgattacct gtggatttgg ttcgtgtaaa gtttaagact ttaagccatg
    32821 aactctgaaa ttatggtttt gattctgaat tttgttgagt acctatggtc cattttgcta
    32881 gattttgggc tgttattgag ttgaaattga aatgatgttt gttaggatga tgcattacta
    32941 tattgttatt gataagaaat ttattgattt tgtgaacatc aggattccgg tactgtttga
    33001 aggggattta gctcatacgg ctaactctta tttgaagaaa aacgatcggg ttcatattac
    33061 tggacagatt ttaggagatg tgattcaatc tggagcaaat tctgaccaag cacatgttca
    33121 gttgtttaaa agctttcatg gtagcttttc acatcaagta atggttcgtg atctccacta
    33181 cattgaaggt tctaaagcca tgccaaaggt tttgccaacg ttggatcaaa atgaaggtgt
    33241 gctaaagcat tctggtaagc gtctagcgca tcattcccgt ttcttttttt tctttactgt
    33301 aatatcctta ctggtttggc tgtttaaaat tgattataac catgaacatt catcttcttg
    33361 ttcttagcta gcgttcaaag aggaagagaa tttggaacta atctttggtt tgatcttgtt
    33421 gataaaccga atgaatggtg tgattaccgt gaaatgaaac agaatggatc ggtaatgaaa
    33481 cttgtcttag tggttctatt tgttacaatt ctgtgataca tttggctaag gttctccttt
    33541 ctttttcttt cttgacatct ctgtctacag gttaatccta aacaccctga tttcaagaag
    33601 aaagacggga gtcaagcgct ttggcttaac aatgctccta cagagatatt gtccgagctc
    33661 aaagacgtga agtttgatat tccaaaatac gcaaaacaac caaagggtaa ggaaacagtt
    33721 ttcttaccaa tgaatctgca gtattctatg aattggaatg acaactaatc ttttcgtctc
    33781 tgactcggaa gatgcaattc gaattttctt taacaatctt gcttctttca acatgtgaag
    33841 ccggagagga atcatggaag gacttggtag ataacatgaa taagtggtgg gacaatagag
    33901 tggacaaggt gaaaattccg ttacatttaa ccaatcgttt tcacatatag gtaacatact
    33961 aatcatttat agttctaatc catgtagaga accccaaaat cgccggattt taagcacaaa
    34021 gaaaccggtg taggtctctg gctaagtgac tctccgagct gggtgttaga aaaactgcct
    34081 cccccaaaga gcaaaacaag tgacatctac ggtgtacaag agatgttcta accaatgttc
    34141 atgttgcgtt actcttaatt tttttcttac ttctacggat taggagaaat atcgtagtgg
    34201 gagtttgatc ttatgtgcat atattggatc gtagagtttg tcttgatgca gaatgaaaca
    34261 gagatggtaa cacttttttt catgaaaata tggatttatt tatttattta ccatcttgaa
    34321 ccaatatttt tgttcacaag attatttagt actagaagat tgtcctaaag tccaaatcct
    34381 gtctctttgg gccttcttag tccaaatcgt ccatgtctcc tatacattaa taagagagga
    34441 gaccgtgggg aaaaagttag ggtttatgct ttgagaaaca agaaacgtca tgagaatgac
    34501 gagacgtcgc actaaaaaga cagagatcag gaacgattcg gattcggttc gtatagacat
    34561 agtgatcgag atcgtgaaga gattgccttt gaaagatgta tcgaggtttc tccttgtgtc
    34621 caagttatgg tcagaaatca tccgaagtcc atatttcatc agatcgttcc cgttcttgtt
    34681 ctcgtcaatt cagccacatc tgctctatgc tctcaatagc ttagataaag ataaaggaca
    34741 ccacaaatgg ttcttctact tgtcttcatc aactttctca gcggggaaat gagttctttc
    34801 ttctctctct cgcaccaact gccaaatccc gaatcggcgt agctgcgata ttcattacgt
    34861 gagtggcttg atatgctttg gatatggtca gcaacaactt ataactaacc ctagaacagg
    34921 taagtccatt tacttaccca aagtgaaatc aagaagcaag atcatccaaa gctttttcgg
    34981 atacgatcca gtctatggcc aatataaagt actgtgcatg tcggaaagaa tgaatgatta
    35041 cttgaatgtt ccgtcttctg aacatcaagt gttcacatta ggaggagtac aaaaagttga
    35101 acaatcgtgg aggatgattg aatgtaacat tcatcaccgt cccaaaacta acagtgtgtg
    35161 catggatggg gttttgtatt atggcgcttt tacgggcggg gatatgttgg aatggtgctt
    35221 aatgagattc gatgtgagga ccgaaaagtt ggatctcgtt tcaagattaa acgagagtag
    35281 catacaatgt taccgcccgg ggcattctcc atctttgata aaataccatg ggaaagtagc
    35341 tttagccttt gaaacttcac ttcatacatt tgaattgtgg gttatggaag atgctgagaa
    35401 atggtcgaag atacgtttct ctatttgtca ttctatgcat ttatttggac aagacgacga
    35461 cgatgcattt ctcattacag gcaatattca cacgggtgag attatattcg caccttacga
    35521 ttgcgatgta agattcggta tgactcatgt tgtctattat gatctcaaga caaataggct
    35581 taggtttaga actgttgcgt ttgatttagg aactcttttc cctcagattt ctgtaatggt
    35641 accttttttc gattatgtag agagtgctat gcttttgtaa ggagattatc attaccatat
    35701 gttgtcccta agtcttttag acaatagatt aaatgtctcc tccaaatagc aaaacaagtg
    35761 acagctatgc tgagagcaat tgaaaatctc tttgccatac cttccaaaaa aatagaataa
    35821 aaataaacga tacgtataga aataaacgtt ggacatacaa caccaggatg ttattgttat
    35881 atatataaat taagaagtag taatatcagg tacgagatga acacaaatta caaacaaaca
    35941 ataaacgtat ataataaacg gagaatgtga tgatgattaa gcatatcgat ccatcattcc
    36001 tggttatgga gaatgtggtc atccgaatca gcaatcatct tctcgagaaa cttataaaac
    36061 ttggcgggtt ctgagtcttc ggtgcgtttc tcccacttca cactaacttt gcagacacaa
    36121 gcattttggg actcggggat gaattgtaga tttgggatat acaccttaag ctcctccatg
    36181 acttgaccat cgagcgcagt catcgtcacc gccatcttct cttcgtctat ctctgttctc
    36241 tccttaaact cttcctcctt cccatcttca tatataatga atgatgacca aacacattca
    36301 tttcttacta tactaaataa accctacttt ttccatatta aaacaaatca tttgtaatgt
    36361 ggataccatg aatgcagcgc actgactagt gattgatatg tggatactca tgaatgcagc
    36421 acatgtactc tcttcctaac cgattgatat tatttaggac tttttacaca aaaagaaaaa
    36481 gaaacactga ttagtgttta cttattttaa atacattatt tactctcaat aaaaaatatt
    36541 atataattat ggaccaataa ccattcataa attaaaatat tttcaatgag aattttttta
    36601 tgtttacaaa ttattaacat agaattaatt aaagacattt agaaaatcag tttttgtaga
    36661 acaaaaaggt ttagaaaata atgttttagg aataaatgga atagttatac atatatgaga
    36721 taatgagtag aaatacgaac caagattgta cttccatgtc ttgatggagc cgtgagagtc
    36781 ccaatcgccc tcgtggagga tgacaccttg gatgaggtgg ccgatagtgt cagggatgcg
    36841 atgggtctcg ctactccaca acttgtagtg tttctcggcc gatccattca gaggcacgtc
    36901 cgtcatgtat gttcccgaca tcgccattga tggattaatt aggtttcgac tacttctttg
    36961 ttgtgatgtc tcgggtgttt taattctttt tctctgatgc aattactttc gtcaagcttt
    37021 cctttatata cgcaagatca acaccaaact acattaacaa cgtaattgtt aatacgactt
    37081 ttcaaaattg tctgacagtt tcaatatatc taaacaatta tggtcacgta tttgtataca
    37141 cgttatcgtc tgtttcgatt gactactatt atatgagtac atttttgtta aagggtttgc
    37201 tatatgacga agactttcta tttccaaaac attttaagat ttattagttt ctttatgacc
    37261 aaattgaatt accattaaat aacactattc taagaatata tttttaagaa gctttcttat
    37321 aaaatacaaa ccatattaat gcgataattt tagagcatgt gtcgaattgc gctgtggatc
    37381 tcaagttgtt cagaaaaaat aatttgctta tatttcatgc gcttactttc tttggtaaag
    37441 aaagtctttt tttttttaaa atttatttaa agaaacccga ccagcaatta taaagaaaga
    37501 aaaagaactg ctggtcattt tctgactctc acaaaatttc caaaaatata tacaagtcaa
    37561 ctgtgtaaat gataaagtct gcattaaaaa ttagggtaat ttgcatgtca caccctttga
    37621 ccatgtttta ttttcagggg ttggcaaaat caaatgtggt ttttacgttt tgtcttttca
    37681 gctaaaattt gaccatttta cctttgctgc tacagttgag aaactattga atgtacggtt
    37741 tagttagtca ggtttagtta ggtacactgt tccggtttag ttggagatat ttttgtttca
    37801 ctttgaggag tgcggctgta cagttagaag ggagattttt tcctttaaaa actaaatgac
    37861 gtcaacattt aatggcccaa aaagtttaga cgtgattctt gtcacaatta atgcaaaatc
    37921 atcattatat gttataatat tataaaatta ttgataataa ttgttgagtt aaagatgaac
    37981 ccagaaacaa acattaattg ctaacgtaca ttgatgttga agatgtgttg atcttgttta
    38041 tttacgaagt ttggggccaa gacaagcatt atcgtgtaag taatgaagtt ttaaagattt
    38101 tttttgttat aatacactat gatcttcatt gtgttcgaaa tcaattttgt tttttataaa
    38161 aatatccaga atttttttat ttctaatttt gttagttgaa aatggtaaat gtgtagatat
    38221 ttatgtttat aagtgcgtat aacgaaattc tatttgtttt tgtcgatata atcatgtttt
    38281 cagttgcatt tattgggttt ctcctgaatt tatgatgcag ttgggtaatg gataatctcg
    38341 tatttactat ggtcggtgag tggaaatgca aagaagaaaa atggaaattt gaaccagagg
    38401 aagacatgtt tggtcgctgt gtacgtgtta aggaaaacat gacgtacacg gaatttgtat
    38461 gtacagtaag cgagactttc agtttgaagt ccatagagat caatcccata attagttact
    38521 ggataccgag agagatgttt gaagtccata gagatcaatc ccataattag ttactggata
    38581 ccgagagaga tgttagtgat gatagatact aaacgccctc ctgtctacat tgacagtcaa
    38641 gtgagggtgg gatacaattt tttttattcg tggtgggtat ccttctctca acttgtttgt
    38701 ctctatcatt acaactgtca agacactcag gaataatgtc tctaggactc atggtgacga
    38761 tgctgaaagt gaccgtgtgt gtgatagtgt tttaaatgtt gatgaaaata atgaggccgt
    38821 agattaggaa gacgacattg aagacgataa aacagatgag gatgaagatg ggggggggga
    38881 caacgaagat ggtgatgggt atgatgatta tcagggtgac gatggatcta tgagggaagt
    38941 accatcgatc ctactattga tggtagtgaa agtagtggcg aagattatga ttacaacaag
    39001 tggaacgatg aaattgtaga agaatatgga atagggaatg ttgaggagaa catcattctc
    39061 acacagctga ctgttcaaca tccaagggaa ttcagtcttc tgttggcaga gtgtacgtac
    39121 acaagtcagc gtgtacctgg cggagataac atttctcacc cgggtgaccg tacaccagct
    39181 gtgactccaa gaactatgtg tcaacatggt ttgtaccaat gtacgtacac tataaattgg
    39241 agagtgtttt taagaacaga aaagtcatac aacaaacaat gtcttatctc gcaatcaaac
    39301 aatctttttg ctacaagcaa cctaggtcat atcctacaag attggtgatg gtatgcgttg
    39361 atgatacttg tccatgacat ttgactgctc aagtcgtcaa gaattaagaa tatttcaaaa
    39421 tcacatcgta tgaacgtctt agaatatatc tcgcccactg ccaatattgg tttaatattg
    39481 tatcaataaa attttcttaa taatttaatt tacaaacaaa gatgtacgta tattattaca
    39541 catgtacata cattaattta ccaacaaaaa tatacgtaca ttacacatat acgtacataa
    39601 ttttcaatat gaggaacaaa tattatttca ccatctatat ctatttaact attatgtatg
    39661 tatggagatt attgagatat aagaatacgt aataaaatag cttgacttat tagaaatcgt
    39721 accatatacg ttcgactaaa taactttgtg tacgtacact gtaaattgaa tatacgtaca
    39781 cagaagaaat ttaatgaagg gtataattgt aatttttcag tcatcttcaa cctgtgtatc
    39841 cttttctgca aacctaattt tgcggccatc tttagctgtt ttctcaaaat ctcattttta
    39901 tacgttttaa ttactattta tatataaatc ttgtaaacct agagtatctt tagtttaaaa
    39961 agctaaattg tttgaatctg tgatttgttt ttgcattttg ttcatctctg aaaacaagaa
    40021 atttcttcct caattttgga gttcaatgga gagatgtcga aatatgaaga agtgaataat
    40081 gaagtttgaa cttctttcta cttctctttc aaatctctcc atctctttct cttcctcttt
    40141 ttcttcttct ttggtttctt cgtttcattt tttttttctt tttttcttaa aactaaacca
    40201 tagaaactaa accgaaacca actgctgtgg ggtttggttg atcccattaa gggtattttg
    40261 gtctaaaaac catttaaaag acaaatggtg aaaaccacat ctcactttgc caaatcagga
    40321 gagcaatttt ttttttagcc acttctgtga aaatttcttt aaaaattata gtgtgaaata
    40381 gttaaactaa gtccttcttt tttttttttg gtttaatgtt aaactaacta agtccttctt
    40441 gcgacatcat aagtttaata tagaggtgtc gaattaaact taggatgtct ccctttagat
    40501 gcagcaacat ctacaaaaca agatactcaa cgaactggca agcactattg cactaattat
    40561 ctccgtctcc agtcaatggc atgatcaagt cgatcgagag ctttattgct cgttatgttt
    40621 tccaagctac attatacaca atctggtgcg aacgaaatgg cagaaggcat ggagagagag
    40681 aggccgaacc agccgctctt ctaataaaat tgattgataa gcaagccatc tttcctcaat
    40741 cagagcaact gatgatctac gctatgacaa gagcctccaa atctggtttg catcgagtgg
    40801 ttgaaatcaa accatctata gttcatgtgt ttaaccttta atcaaaacaa acattgcaca
    40861 agttgtagaa aaatgtaaaa gcttcggatt taagcacata gaaacggcaa aacaagtgag
    40921 agccaatttt gcttcaatag gagaaacgta gtagtggcag ttttatctta aatgtataaa
    40981 ttgaaacaaa gtgtttttct cttgaagctg aaacatagct ggttcacttt tgtctcatgt
    41041 aaatatggtc atatatatgg attttgcttt atccacaagg tatcacactt tgaaataact
    41101 aaagtcaaaa atatgaatca agaaaatcaa taagccgcta catgtcactt ccaaaattat
    41161 aaaatatgag attcgaatct aagaggagtc ttaaactgtt aaacagagac gtgtttacag
    41221 tcaagagaaa tttataacat gggacaaatt ttattttatt ttatttaata gcgttacaaa
    41281 cttacaatga tcatattaca taaggaggat acagaagtag aagaagagct agtttaaaac
    41341 tcccaagagt ccaacactga ttcatgactt catcgtctct tctatgtctg cgcttccact
    41401 atacaaatca gaaccatcga ttattttaac ctttagtttt tccaaataat ctcttgagtt
    41461 taatttgaaa aataatattt tcaagactat atgtatacct aaacagtgac aatgatgttt
    41521 ctaagattta aaacacttta ttaccgaaat atatctcaaa atttcactct ttcaaaacgt
    41581 tatgttgcta ttttattttt caccacattt tcgaacatta gcataccgtt taatcatttg
    41641 aacactccat tgttaatcta ttattattat tacactagtc aaacttactt caaatttatt
    41701 gatacaaagg ggaatatatt ttatatagtt agtaaaattc tcaataatca ttaaaataga
    41761 ttttctttga catatttcca aaattgttag atttttattt tttttttacc ttctgaaaaa
    41821 tggtgaccta atgtacgacg aggtttgccg ggacatcgac ggtaacaatt ctgaaggcac
    41881 ttgatcggaa ttattcctgt ggtggcacaa tctgtaatgc aatcttcatg gcattgagct
    41941 ctcgtctctc cattgacatt ttccattgct attaccattg tcaccacaaa caccattatg
    42001 atcattgaat tccatttagc acccatatct ttaacttttt tgttgttgca agtgtttcat
    42061 gtacttaaga aataatgaat agctatcctc tatttataat cttttctaat agttatctaa
    42121 ttcttagctc ttatcgtctc ttcttcttat ttgttatagg aattgctctt cttttttttc
    42181 tggtcaaagt ttctttgtaa tagagactag ttactttttt tggttactct tcttctgttt
    42241 ttttctctat ttataatatt ttctaataat taagtaattc ctaactctta tcgtctttct
    42301 tcttatgtgt tatagggatt cctttttctg gtcaaagttt ctttgtaata gagattagtt
    42361 attttgttgg ttaatcttct tctgtttttt cacacagtat gtctatttta agttaattat
    42421 gtcagaagtg gggtttgaac ccacgccctc ttacgaggac cagaacttga ctctagcgcc
    42481 ttagactagt tacaatggtt tgttgtaaac cattttacaa ctggtgaaaa aacaaattcc
    42541 actataatgg tattttgtaa ttgaaaagta gctgatgtgg caaatttagt gttgataaat
    42601 tttaacatcc gtgaaagtag aagggagaag ataagtgtga caagtgttat attttgattg
    42661 gttgctttga tttctaatat ttttgtttca tcttaattat ataacttcaa ttatttcata
    42721 atatttatat atatttatat atatataatt tatataaaat tttataaatt ttcattctct
    42781 ataaacagag actattttca tttgatttaa atacagaaaa aaccattttt agacccaaaa
    42841 ataatgtata ggttaaaata tgaaataaaa atggtggggt aaggtgttgt aattttatta
    42901 aacaaaacta ttgtaagatt aaaaattatg taggtgttga ataatgatgt ggaagagaga
    42961 gaaaataatg tggagtgtta aaagtgaaaa agtgggtgtt ataaataggt aatcattgta
    43021 gatagtctta gactactcgg ccatcctaac gaggaccaga agtggaataa tatgattatg
    43081 taacttacta aacattttgg aaaaatatac aattaagcaa gagttttggg ttctttacga
    43141 aatattacac aagaaagtac cttttcttat aaacacaaga gagtaaccat tagctaaaat
    43201 gtacaattaa acaaacattg cacaagttgt agaaaaatgt aaaagcttcg gatttaagca
    43261 cagagaaacg gcaaaacaag tgagagccaa ttttgcttca ataggagaaa cgtagtagtg
    43321 gcagttttat tttaaatgta taaattgaaa caaagtgttt ttctcttgaa gctgaacata
    43381 gatggtttca cttttgtctc atgtaaatat ggtcatatgg attttgcttt atccacaagg
    43441 tatcacactt tgaaataact aaaataaaaa atatgaatca agaaaatcaa taagccgcta
    43501 catgtcactt ccaaaattat gaaatatgag attcgaatct aagaggagtc ttaaactgtt
    43561 aaacagagac gtgtttacag tcaagagaaa tttataacat gggacaaatt ttattttatt
    43621 ttatttaata gcgttacaaa tttacaatga tcatattaca taaggaggat acaaaagtag
    43681 aagaagagct agtttaaaag tcccaagagt ccaacactga ttcatgactc atcgtctctt
    43741 ctatttctgc gcttccacta tacaaattag aaccatcgat tattttaacc tttagttttt
    43801 ccaaataatc tcttgagttt aatttaaaaa ataatatttt caggactata tgtataccta
    43861 aacagtgaca atgatgtttc taagatttaa aacactttat taccgaaata tatctcaaaa
    43921 ttttactatt tcaaaacgtt atgttgctat tttatttttc accacatttt cgaaacatta
    43981 gcataccgtt caatcatttg aacattccat tgttaatcta ttattattat tacactagtc
    44041 aaacttactt caaatttatt tatacaaagg ggaatatatt ttatatagtt agtaaaaatc
    44101 tcaataatca ttaaaataga ttttctttga catatttcca aaattgttag attgtttgtt
    44161 tgtttttacc ttctgaaaaa tggttaccta atgtacgacg aggtttgccg ggacatcgac
    44221 ggtaacaatt ctgaaggcac gtgatcggaa ttcttcctgt ggtggcacaa cctagaatgc
    44281 aatcttcatg gcattgagct ttcgtctctc cattgacatt ttccattgct ataaccattg
    44341 tcaccacaaa caccattata atcattgaat tccatttagc acccatatct ttaacttttt
    44401 tgttgttgca agtgtttcat gtacttaaga aataatgaat agctatcctc tatttataat
    44461 cttttctaat agttatctaa ttcttagctc ttatcgtctc ttcttcttat ttgttatagg
    44521 aattgctctt cttttttttt cctggtcaaa gtttctttgt aatagagact agttactttt
    44581 ttggttaatc ttcttctgtt tttttctcta tttataatct tttctaatag ttatgtaatt
    44641 cttagctctt atagtctctt cttcttatct gttacatgga ttcctttttt ctggtcaaag
    44701 tttctttgta agagagatta cttactttgt tggttaatct tcttctgttt tctcacagtt
    44761 tattttaagt taatttgaga ttaagttaat ttgagatttc attggacaaa gaaaattaac
    44821 tcttgaaaga ataaaaaatt atgtcagaag tggggtttga acccacaccc tcttacgagg
    44881 accaaaactt gagtctaagg ccttagagca tccacattgg tcacttatat gtagatgtct
    44941 ttaaatataa aactataaat aataataata aaaaaattat gaatgttttt agtttgagat
    45001 ttgtgtttct gtagagacac tttaaacaca acaaaagtga aatgtcttta attttattat
    45061 ttatttatac taaaaacatc tataaaaagt tgtctaatga ggttgctctt agaccacttg
    45121 accatcctaa cggataacat aaccaatact aatagtatca ttatataact tactaagcat
    45181 tttggaaaaa tatataatta aacaagagtt atgggttctt tacgaaatat tacacaagaa
    45241 agtacctttt cttataaata caagatagta accattagat aaagtaaaaa taaataaaaa
    45301 acagagaatc tgaagatcgt agaagaaatc gagaaaacgc tttgtaccaa ttagaaaccc
    45361 tagcgagcgg aggaaggaga caaagaacga gacttttgag agattggaga tttcaatttt
    45421 gagatcaaat cttgaaatca acaaatagga gaaagattta gtgatgggta agaagaagaa
    45481 gagagctaca gagaaggtgt ggtgttatta ctgcgataga gagtttgatg atgagaagat
    45541 tcttgtgcag catcagaaag ctaagcactt taagtgtcat gtctgtcata agaagctttc
    45601 tacagctagt ggcatggtga ttcatgttct tcaggttcat aaagagaatg ttacaaagta
    45661 tgtgcctttt ctttttaccc tttccctatg gctctttttg ttgtgttagg ttgatttgga
    45721 atattagggt tgttgcctct atgatctttg ttcaagttct gatttttttt ttgctcttgt
    45781 tgtgtgtgat tgtcgtttga tttctgttag attgcgctaa ttgtgactgt tgtgttgtgg
    45841 tttgaatcgg ttgattgtgt atgtttgctg gaatttgaat cgtttttttg gattatctct
    45901 tgaatgggtt tggttaattt gtatatgtct ggtcataaac cctaatttct gattgcaatt
    45961 tttgtaaaga aacagtcttt tgcttttgct tttgcttgat aggtttttct tggaatttgt
    46021 ggtactgttc aatgtgtttg cctgttgaat ttggaatttg attccatgac actactaact
    46081 ttgaaattat ctacaatttt cacaccagag ttcctaatgc taaagacggt cgagattcaa
    46141 ctgatattga aatatatgga atgcaaggaa ttccacccca tgtcttgact gctcattatg
    46201 gagaagaagg tatgcatttg agatagtgag agtactgttt agattatgag caattgattt
    46261 agagaagtaa ggcgataaat ttgtatgtct cttcatcaag tgttgtagat ctattgcatc
    46321 tagtggtcat gaattcgttt tgattttgca tgcggctttt tgccttatca aagttattat
    46381 atattattgt tatgtttgct tgtttcatat ggtacctttt gaactgaagt catgttttct
    46441 gcagaggatg agcctccagc caaagttgca aaagttgaga ttccttctgc ccctcttggt
    46501 ggtgtagttc ctagaccata tggaatggta tatccgcctc aacaagtacc tggtgctgta
    46561 cctgcacgac caatgtatgt actaattata ctatactctc tctatggccg ttacttgttg
    46621 aattcttaga tgttgtctct gtttttaaaa atccgatcca tgctaaatga tggggaactt
    46681 tttttctttt agttctcttg atgcaaaagg ttcttggttt ctttagtttg tctctgtcct
    46741 agaacttttc tacttttgtt cttctataag accactataa cacccgtagt aaacattttt
    46801 tgaaatagat cgttatctaa gatattgttg cacttaacca actatgaccc ataaggttct
    46861 tagtttccct agcttgttct cgtgattttt caggatagaa ctttgtccta gaaccattct
    46921 tttgctcctc ttcaagacca caataacacc tgtagtaaac agttttttga aatagttcat
    46981 gatcttagat attgtaatat gtatggctat tgaccatgat aaaatatttc gtgttagcag
    47041 gtattatccg ggtcctccta tgcgtcatcc tgctcctgta tggcaaatgc cacctcctcg
    47101 tccgcaacaa tggtatcctc aaaatccagc tctttctgta cctccagctg cccatttagg
    47161 gtatcgacca caaccacttt ttcctgttca aaatatgggg atgactccaa ctccaacctc
    47221 agctcctgcc atacaaccat caccagtcac tggagtaact cctcctggaa ttcctacatc
    47281 atcacctgca atgccagttc ctcaacctct gttccctgtt gtgaataaca gcattccttc
    47341 tcaagctcca ccattttctg ctcctctgcc tgttggtggg gctcagcaac catctcatgc
    47401 agatgcttta ggatcagcag atgcttatcc gcctaacaat tctattccag gttcaatccc
    47461 aagttcgtag aatcattgac ttacatttgg tttagctgtt ttgtatcaaa ttgtaatatc
    47521 tttttcatgt tttgttgccg taggtgggac taatgctcat tcttatgcct ctggcccaaa
    47581 cactagcggt ccttcaattg gtccacctcc tgtaattgca aacaaagctc ctagcaatca
    47641 gcctaatgag gtctatcttg tatgggatga tgaagcgatg tctatggtta gtttattcct
    47701 aatttcttat gcatcatgtt ggaatggtta caattggaaa agtttcgagt aatgaaccat
    47761 ttggttttcc aatctgacgc aatgtgtctg tatctgcagg aggaaagaag aatgtcctta
    47821 ccaaaataca aagtgcacga tgaaaccagc caggtaagtt ctgatttacc ctttttaaag
    47881 ttaagaagag tttgcttttg caagtctaac ccattcggta ggctttattt atacatttct
    47941 gttccagatc ctattgtttc tgtgctaaga ggtaccaccg tattattcag tttataattt
    48001 cttcccttag aatatgataa gaaggactta ggcaagaaac ttgagcattt tgaatcaatg
    48061 ttcgaaaggt atcatttgta gcttgcaata gtaggtagtg agaaacatag cgtttgtatc
    48121 tgtttgtttt tcattatatt tcctgtctat tgtattgtat taaaaatgtg gtgattggtt
    48181 ccacaagatc atactctaca ggtttggttt caaacccagg tcagctcttt ttatattctt
    48241 aactctgcaa agtttggtac ctttgcacaa tctcactgcc ttggggaacc aaaacaatac
    48301 gcacttaact ctttcaaaat aaagcatcca acttcttaac tcaacaccaa gtttgtttct
    48361 tttggtttgc agatgaactc gataaatgca gcgatagaca gacgaatctc agagagtagg
    48421 cttgctgggc ggatggcgtt ttagaatttg gcaccaaacc aaaccagcgt caaagaaaag
    48481 gcgatatgga tgaaggcttt gttacaacaa caagtcttca ctcacttttg ttcagatact
    48541 gaatttatga tctgatttta agttattaac tttccatctg ttgtattctt tagccaggtg
    48601 agttagttta ccattacatt gtttagggat ctcagagatg ttttttctca gaagtttagt
    48661 cctttttttt tttggtcgtt ggagacttgg aggaagaact ttgtctcctt ttcttctgaa
    48721 ttgatcaaag tattatatta tacagattca cccaaaatgt ttgcaccatg ttgttcaata
    48781 ttttgccaaa acaaaattga ctaatattcc ttccattaac tgtatattca aactccaatt
    48841 gatacgatta gtatgaattt ttgttgtatt gctactttgc tagtagtaat tatatcgaat
    48901 acaaagttag ggactacgtt ggatttgtca aaaagtgagg ggcctatctg taatattgag
    48961 ttactttgtc accacttccc caaaacatca aaacctctaa aaccctcgga agcctcttct
    49021 gttacatttc gttcaaatct gtacttctcc gagatcgcta cttcgccatt gttacaaaaa
    49081 tgaaagcttt tagatctcta cgtatactaa tttccatctc acgaacgacg acgaagacaa
    49141 cacctcgtaa tccccatcaa gcacaaaact ttctccgccg attttactca gcgcagccga
    49201 atctagacga acccacttcc atcaatgaag acggatcaag cagcgactct gttttcgata
    49261 gtagtcaata cccaatcgac gattccaatg tagattccgt gaagaagccc aaggaagcaa
    49321 cttgggataa agggtacaga gaaagagtaa acaaagcctt ctttggaaac ttgacagaga
    49381 aaggtaaagt gaaagttgca gaagaagaga gttctgaaga tgatgaggat agtgttgata
    49441 ggtcaaggat tctcgctaag gctctcttag aggctgcgtt agagtcacca gatgaagaac
    49501 ttggtgaagg tgaagttaga gaagaagatc agaagtcgct taatgtcggc atcatcggtc
    49561 cacctaatgc aggaaaatct tcgctgacta atttcatggt tggctcattt ccttaatttc
    49621 acattcctgt gatttggtct ctgagaatca attgagacat tgtgtatatg tttatgtagt
    49681 gctgctatga ctcttgatta gtcctaaagt tgcaattttt gaagtgattg tgtatctttg
    49741 tttattgcat cttgatgaga gttatgctta gtgtttcgtt atgtccaagt gtaggttgga
    49801 acaaaggttg ctgctgcttc acggaagact aacacgacga cacatgaagt gttaggagta
    49861 ttgacaaaag gagatacaca agtcgtaagt tttctcttat atatctgttg catatgtaaa
    49921 ctactcgtta tggttagttg tggagatcag ccattcgtag attgaatttt tgatatttgt
    49981 gaaccttgca gtgtttcttc gatactccgg gtctgatgct gaagaaaagc ggatatggtt
    50041 acaaagacat caaggctcgt gtgcaaaatg cttggacttc tgttgacctg tttgatgtcc
    50101 tcattgttat gtttgatgtc cataggcatc tcatgaggtt agtcgtttac tagtttttgt
    50161 actttgttag ctttacataa gttatctcgg aactgagagt agtatggtta tgagcatcat
    50221 catcaagtgg ggtatcttag ggtgggatta ttatttctag cttctctgtt tcgatatctt
    50281 tcatatcttg ttcatctctc cgagattatc cataagcttg agaaccgtaa accgatggga
    50341 agacacatct atttctttct tttgaagaag gcatcatgac tgtggttttt cattaattac
    50401 aagtagaaat agagttctct tagacttatt ttgtagtttg tgaattctgt tttctctttg
    50461 atttatctag tcccgattca agagtggtac gcttgatcaa atacatggga gaagaagaaa
    50521 atccgaaaca aaagcgcgtt ttatgtatga acaaagttga tctggttgag aagaaaaagg
    50581 atctattaaa ggttgctgag gagttccaag atcttccggc atatgaaagg tggatatata
    50641 tataccagac tcagtttaaa aacaattacc ggggaagtct tcgaattgat tgaaatgtgc
    50701 tttttccctg tttggttttc tagatacttc atgatatcgg gacttaaggg atcaggagtg
    50761 aaagatcttt cccaatactt aatggatcag gctgttaaaa aaccatggga agaagatgca
    50821 ttcacgatga gtgaagaagt cttgaagaac atttctcttg aagttgttag ggagagatta
    50881 ctagaccatg tccatcaggt aataatacaa cctctactag tataacattt tgtatcagtt
    50941 tccgtctatt ccaagatgac aaattacagg attgattgaa acaaattgta ggaaatacca
    51001 tatggtctgg agcaccgtct agtggactgg aaagagctgc gtgacgggtc tcttagaatt
    51061 gaacagcatc tcatcactcc taaacttagc caacgcaaga ttcttgtagg caagggcggt
    51121 tgcaagatcg ggtaagagca tacaagatcg ttcataattc attcttttga ctaatcaatg
    51181 actcaaggat gatcttatgt tgatgctaat tttgcaggag gataggaatt gaggccaatg
    51241 aagaactcag gagaataatg aaccgcaaag ttcatctcat tctccaggtt aagctcaagt
    51301 gaaaccattc tcccaagggt tatgtttttg agtttgatgg atttaggatt ggattgtacg
    51361 caattagaaa tctgtctgta tatgttgttg acatgttgtc aaagattaga catttgacat
    51421 tagaaatata aacttactac atacagacag taataagata aaagaaacag aattttgaga
    51481 aaacaacaag cagtcttaac gtcagaagtg gaaaccacaa gtagtctctt tatcttaaag
    51541 tctaaaaact aacagactcc aggaaatgga agtgttaact gatcaagaag actaaccacc
    51601 ggtgtagtaa gcaccgggtc ataagcaaaa ccctgcaaga cctctccgtc tgaaccgcca
    51661 cctgagctac cgccaccact gccggagtaa ggacacggtg ggacccacag ccagcttttt
    51721 ctcactatat caaacagcaa ctgcaacgag gttcctctta acacaatcat tacaaactct
    51781 tgatttccga cacactcgaa tccttttcca ccttcttctg ctgcaaactg tgtgtagagc
    51841 ggctgaggca tccgttcgat ctcgacccat gtggcgttat cttgttgcaa actccaaagt
    51901 cgtaggcttt tgggaacgtt caacttgctt ttctcaacag ctgctacaag aataagcctc
    51961 cctttgctct ctaacaagct tggagatctg agaaatctcc tcatcggagc ttgaatcttg
    52021 atccaccggt ttccagtaac ttcataggac aaaacgctaa aagggctata gttcatacag
    52081 taaaacttgc cttgcacgta aaccatctta ccagattcca agctacaaag ccgtggcaaa
    52141 gaagaagtca tcgcccagag ggaaaagaat ccgccggcgt cgacatggaa actctccgat
    52201 gagaggtttt tcacagcgta aggagatatg agatcatctc cagcgacagt aacatcaata
    52261 gaggttggtg ttaccgagag acctatcgaa gggaaaagcc ttggccttga tattggtggc
    52321 aactgactca cggatccgac aagagggtta cacaagagaa tggttttaag accagcttct
    52381 tcggagaccc aactcactaa ccctcctgat gatcctgaag gataaaaccc tgaagggata
    52441 taagcaaaag agagacggta ccatcggatc tcattaggat caaacaaaaa gccttcagct
    52501 ttattggaat catcatcgtt tgttcctcct ctcttgtaaa tgtaactctt tagggttttg
    52561 tgtttgaaga agaggaaaca gttgtgtcgg agaggaagta gttgtagata tgtctcgagg
    52621 aaggtgttgg agaaaagtag actgtagaat ctcttgcaga cgcaacgtgt ccggaaaaac
    52681 gccggaggtg gaagaaaagc aatgacgcgg tcaagaagag gaggtggtag cttgctccaa
    52741 atccgaccgt ccatccattg accggagctt gagtctgtgg tggtgctcgt tgttgtgcta
    52801 ctgttgctgc tactggtaaa tgtgtaagag aaaggtaagg ttaaagatgg gttattgatg
    52861 aacacagttg aatccatttt agctgaaaaa tgaaaagatt tggtgaaagt ggatttagag
    52921 tttattttct tgtgttggga atatgtgaag ggcttttgag gagggttttg gtgaaagtta
    52981 tgcaaaaccc attgtaggaa aagaggcaaa gatcatatgt aaaagttttg aagaaagaga
    53041 caaaagtgtt tggtctttct ctgtgagctt cttgcatggg tttttgatat gttcttgact
    53101 tcaatagagt aaggtggcat atacttatat ataaagaaca tttggtataa aacaaacaaa
    53161 ggtaatggat ttatacaaat agaaaacata tattatattg aatagaaaaa gaaatagtgt
    53221 ttctttattg ttaaaaaggt atagtagtaa gtaagtagtg acacaccaac caaaaaaaaa
    53281 ataactcaga aatttatgtt tattttctat caacgtaaaa gattatatat gttaatgttt
    53341 tagttgatag cttagcttac agacgttttt ctatttgtgt gctgacaaaa agagattgga
    53401 agtaaaaaat cagttgatat atgttgttat tttctaaaca gaaataataa aatacgtcta
    53461 aaaaactaaa ccggtcaagt ggccaagaca agagaaatag gtttaattcc aaataatcta
    53521 aatttcacaa gaaaattgga tatatatttt taatattaaa gtgtgtttcg aatatatata
    53581 acggatgtac tttgttatca tacgaaccta gaacatcaac aagcacaagt atccaaaagc
    53641 cttgttataa ccccagtttg gtgataatta ttgactaaca aaattttgtt tgtatatgtg
    53701 tgtgtttggg taaacgtgaa aatggtggca gaggaagtga tggtcttaaa gttgagagct
    53761 tcagagttat cttgtcaatg cccagcatcg aaattattaa tttggagact actccaatac
    53821 ttttcacact tgatcacatc ttcaaatctt ttttctttct ttctttttcc tctctaattt
    53881 gtaatataca acttttatta catgcacgct tctcaacttc tataatggtc agtcaaattg
    53941 tactcgtgga gatcaaccca agaaaactag agattattaa gatcattttt ttacttatat
    54001 attatatcaa gccaattaga attactttat atgttaatat atatgtgtgt tttattctaa
    54061 ataaattagt tggttctcta atgtcataga agtgcattta ttctaaataa ttttgttgga
    54121 ggagaccaca ttatcttatt cgaactcaac acaaaatttg acaatatcta cttttttagt
    54181 ttctaattat ttgatgtttt gagttatttt tacttgttcg accaaaatta atgttttata
    54241 aaaatattgt tattattttt gcttgtgact aataataaaa aaagaaaaat aaaattacta
    54301 aactaacaaa aaaataattt tataaaaata gaaaacatat tttttattaa tttctatcta
    54361 aaatccaaaa catcaaataa agaggaacat agtgagtatg gttttaaaag actccaacaa
    54421 taaaacttcc atctaggaag aaaaactgat aacatgtata acacacaaga atgttatttc
    54481 taaacatgag aaatagatat acacaaaatt taatatgaat tatgatgcat ttttgtcatg
    54541 tgatccagtt tgttcctaaa ttatagcaga aatagctctt agtttatccc ctttttttaa
    54601 agagtaaaca aacaaactat atgttagtat gttaccctta tttgatgttg ttgcaattta
    54661 atgtgaaaca attcattata tacactatat atatatatat agtgattatt ttttcttata
    54721 aattgtaaac tctttcaaac tctaaaacct ccaagtccaa gataatgaac ttcttgttta
    54781 gggaaaataa aactagcttt catacaaatc tcaaatatat caatttacat ctaatttgca
    54841 aacaaaagaa ttttagacat cacaaaacat ttacaactca atttctaatt aattctttat
    54901 ccagaaaaaa aattcttata ttaatcattg ctagctataa tcaaggttta gaaataaata
    54961 aaaggagttt ggattttttg agattagggt tagagagaca tcatgactga aaataaagaa
    55021 gaagaaagag tgaagagtag agtcagatca aaagtccaat cagggtttct tatttaaggc
    55081 attgtttacc gtgaaaataa taatacaagt gagaatatct gaagctgaca agtcgcaaaa
    55141 gggtaataat attctctatt tgcagtaact caagaggctt cgcttttgtt tgtgttttga
    55201 tgctaaagga agtctctgaa accaaacagt gtcttgtttt tatcaaatca tctatcttcc
    55261 catttcccaa ctaggttttg tttaactttg aattacgctt acaagtcgta cccataataa
    55321 atagtctgat ttaacattaa agcataaact tttaatgaag catctctttc taaacttaat
    55381 aataaaacat aatctgattt tattttgtcg cccacattaa ctgattcgaa actccattca
    55441 tgccattatg tagttttatt tacacacatg tgttaattgg tacgtagtag agttatggat
    55501 ataaatttcc ggcccaaagt ggaaattgat attgtaattt gtaagaagaa ctagtttacg
    55561 gccagcgtta tgcgcggaca aattagttag aatcaattaa ataattatat tttgtaaatg
    55621 tctttacatc attagaagat caaacaattt tgtaaagcat aatgcatata ttaaaaagtt
    55681 tggatatttc ttgattaatt gaaatcgggt ctaatagtta tagtggttaa acctctgaac
    55741 atatttcatt agtttaacag aactggtata tgacatgaga actttacaca cgttcggtta
    55801 taagtacgac atgcaaactg aaaaccagat attttaaacc gtttttgtga cattatttgc
    55861 gtctagtaca tatgtgctta tgtgtctaac ttgtttcctc cacgtaccaa ggcataccac
    55921 acctatagaa aaatgcaaaa ccatttttag tatagttacc gacaatcact catcaacttt
    55981 ccaaaagaaa acaaatagag ttaaattcaa agaaaaacgt ttatttttat tttgaatata
    56041 atttaacatt aaattcaaaa agataaaagg tagttgtgtc cagaacttga cttgagatca
    56101 atttgattga ggtactaatt ttcgagaggg atagaaaatg caattattat gaagaaaaca
    56161 tcaaatacag aaagacaaaa aaaaacattg taaggaaaaa ataagaaatt attgaaagac
    56221 acatctatcg tccaatttgt tctttgtata cgctaataac tataaagaca catctataca
    56281 tgccctagct tgttcaactg caaactaata agccaaatta tagatttgga aaataacacc
    56341 atattacgaa ttaagaaaca aaggcttata acattgtcta acataaaaga atataaattt
    56401 gaatgcatgt gaagtagatg actgaccttg ttgtttgtat tctcccgcaa aatacaaatg
    56461 ccaaaattaa tgtcttcatc gctgtaaact gtatttaata aaaaaattct aaaattttgg
    56521 tatatcagca aagattataa ttatgtatgg tcgaggaaaa ttggatatca tagttgcaga
    56581 aaaaaattaa aaccgtggag atgagcgata gttttttttt gggggaggtg ttgttcaatt
    56641 gtagaagtgg ggcaattaaa acagagaatt cttaaaacgt gaaaaagaag agttgctaag
    56701 atgtaggaga atatcttttt ctttttgtgg aaacttattt tttttccaat aacaaatgaa
    56761 aattgatcta aaaaaagtaa aacatcaaaa aatgagactt atgtcacatg tcgaaaggag
    56821 aatgtatcag ttattgaaaa agtgactgtt gatttagtat aattagatat atatttaggg
    56881 actttatctc gaggattatt acaatatgct ccttgttctc tagaacatct ttttctgagt
    56941 tctttttttg ggtaaatttt cagtttaaag tttgttacta aagctattaa cttattcaat
    57001 caaggaacat acaaatgatt ttataaataa aaactaaaac tatggtcagt tatgtgattt
    57061 tagattactg cacacatttt ctttctcata catatatagt caatagtcat atatgcatgc
    57121 atacgtttat atgtacgtac gtacgtgtat gttaatgtat tgtctgttca tcaaattcta
    57181 tcttagctct aaaatctatg gaaatgaggg ggtaaaaaag ttgtagctat catattctag
    57241 aactcaaaag taaatattaa ccttcacgaa accgccactt atggaaaaaa gttaaaaact
    57301 ttttcgaact tggtagtttg ggttatcttc actcttcaag caaaccttat tttgtttttc
    57361 accttttgac acttatttta acttttcacc tagatcagta gtaactcaac tggcccttac
    57421 ttttacttta gtagatgaat ctagcaatgt atacaatata aataaaggta tataaagaat
    57481 ttgaggataa atatagtgga ctatattttt gatgaaattg agagttgact tacaaatgat
    57541 tttttttttg tagttataca aataaaatgg taaatataag tatataacat cctccaaatt
    57601 catttgttgg aaataatctc acttatcccc gcgtatcctt gaaacgttat atggcgtaag
    57661 tgaaaaacga atacatttgt aatctctccg gtaacatcct tgaacgataa gtaaccatct
    57721 tcccacttaa atactgggat ataactctaa atgtgagcta atttgccagc gaaggaaaga
    57781 tctatgttaa ataattcctc gacgaattat ccgaaaacta taaaatgcga aaatttatga
    57841 ggtagaacct gtcctaatta ataattaaag agatccaaca tttggaatgg ttaggaattt
    57901 ggaagaaatc caaaattttg agggtttacg atgacacaag tgaatgagtg tattgcgtta
    57961 attatttttt caaaactata gacatacata aaataaagaa acgtacgcaa tcaaattcgt
    58021 ttttatttat ttatcaaact cacatatata tgtttagttt ttattaataa atcgatgtta
    58081 agggagtggg tttgttcgtt ttatttatcg ttgctgacta aggtaacgac taacgaggtt
    58141 gggatttttc tactaggtca tatctcagtt tgaaaatttg ttgtgtatgt gaaatatatg
    58201 aaaacctttc gaaattgaaa ttgggaatga gagctaaatg tttttttttt ataaaattgt
    58261 gggaatttcc ttttatattt ttaaacaccg ggggaaaatt tagaaatggt gattgaattc
    58321 ggagggacaa ggaaacatac atagacacaa gtagagcata tatgagataa tcagattgaa
    58381 tgaaacagta gctacaaaag ctgtcatttg ctcaaattca agatttaaga gaaaaaggtc
    58441 aaatatagga agtagaatgg aaaaaaaaaa aatgaatcat cggaaattga attaatcaat
    58501 gttcttatgt taaagagctc gaccacgtac catttttgta acatcatgaa gctttcctcc
    58561 gttttatatt atgtcatgtg ccctttccct ccaaaactga actaagaaaa accttctttt
    58621 ttcttgttta actttatatg taacgacagg aagactgaga ttttatacac taggaaaaag
    58681 acttgctttg atagtgacaa atgttatatt gttggcgtaa gtctttgtgt atctaataac
    58741 ttggtcgtta agaaaccatt gcctcaattg agtcaatata atgactgaat atgaattagt
    58801 ataattgatg tttaaacagt aaagtcatat gaatatgaat tacgaagata tcagtttgtc
    58861 acaaagataa tgttttgaca caaaaatctc tggcagagtg gtaatacgcc aagaaagaat
    58921 aagcaaaata gaaaagaaat gttgaattag gaatgtacga gccggtttta tgcctttaaa
    58981 ccaacatcaa acagataaac caaaccaaac caaaccaatt tatgccctag gtttcgaact
    59041 ctataatatt ggagtctctc cgttcgattg acaaatacaa cgatcatgaa tagagaaaga
    59101 aaaaactcta gattccatcc caattgatct ctttctcgac ttcttctcga gattgcctac
    59161 aaagtcagtc gggagatgtc ttggcgtttt gtatccattg taacatatct agtaaaacat
    59221 ttctgttggt ttttgagtct ttaattacga gaaactgatt ttgatgattc ataactgaac
    59281 ccaaaaaaaa gaagagacta ctagcgaact ctctataagc ttgaaaggtt aaccatcaca
    59341 tctatcttat tggcggaaat gtatgaatta gtgaagaaaa aatgactaca tagttgaaac
    59401 tggatcccaa atttcactca agacacgact cttacaaaca tccatcatta gattgtcaat
    59461 tgtgatttgt gtacgacccg agatatgaca aagaatgctg atcggtttca tgcttttaaa
    59521 ccgaaaccaa actgagtaac ccaaaccgat aaatgccata gccccaaact ctataaagtg
    59581 gagtctctcc gtccgatcaa caaatacaag gatcatgaat agagagataa ctttagaatc
    59641 ctttaccata acattagata actactttca ttttttatat aaaaacataa aaattatatg
    59701 taacaaagat tttaatatat aagctacctt tattttttat aatcagatat taccaataca
    59761 tttataaacg aattatttcc aaaacatata atatcaatta aattaaataa attatacata
    59821 tttagaagat tctaaaaata aaatattact taaatttaat gagaagattc caattttttt
    59881 tcttaaaata atgaaaataa taactaattt atttatagaa cttatatata tgtttaatat
    59941 caatcaatgt atggataatg atacttttag tagaaaatat cactggttca aataatataa
    60001 aaaagatatt acattgcata atacacaatc aaatttcaga tttcaaataa caatacaata
    60061 aattttgtaa tttactacaa taaattttgt ttaataacaa tatatcaatc aaaagatcat
    60121 atgactactt acagtggcgg atctagaaac aaaatttgta tggggcacat attaaaattt
    60181 acaatattaa acttatactt taataataaa atattacgtg aatataattt ccacccttaa
    60241 aatatttaaa tttgaaatct aaaaaagaca ctaattttaa tgaaataatc taaatatact
    60301 taagtacata tattagaaat atttaatttt gaaatagcat agttacaact cataatagaa
    60361 aatgtaaatt attaataaaa tattacttaa agtttacagc atctaacaat atcacacagt
    60421 ttaaagttta tactctaaat cattggtatt aatactaaat taatgacata aaatatgtta
    60481 aagttaaact tgaattacaa agataaatat aattgaagga acataatttt atataaagaa
    60541 aacaataaaa tcaataaaag aactgcagtt aataataaag gagaattaaa acatgtagga
    60601 actagaaaga gactaaaaga ggacgtggac aaaaaaaatt gagcaaaata aagtgattaa
    60661 agaggctcga acatgtcgct caggaactta acctggggta ctctatgcca aatgagccaa
    60721 gagatatcaa taagtaatga tcaattaaaa ctgttttaac aattagtata gggcacgtgc
    60781 cctacctagt ctcaacatag atccgcccct gactacttat gataagcatg tttatatggg
    60841 tatgtatata gtggaacata tatgacaatg attttttata tacttattat gaacattcac
    60901 acgttaatta ctcatattaa ttagtatttt ttattttctg ttgtatataa aggataaagt
    60961 tgtatatata caatctgaat acgatatctt attgcatcat ttcaagcata ttataatttt
    61021 atgaaggagt agtgaaataa aatgcctaac ataatattat atgtacaaaa aatgtataaa
    61081 actagaaatt gataaattgt agagaatttt agacgcgata attactttct tacgggtaag
    61141 tggttctaaa ggtatcgcaa tatcgtagac tttgaacatg aaattttcaa atgaaacaaa
    61201 aaatatttct ttataaatca ataaattaat ttatcgataa attaatactt ttataaatta
    61261 gtagaatttg tcggtcccaa cattattaat ttatagaggt tttactatag atagaaagag
    61321 ggtcactgat agatcttgag acatgtcctg catagaagag aaataaaaaa attcaaaacc
    61381 ccttaaatcg gtatcaaaca tacataaaca gtctctctca tttaataaga aaaagtaaaa
    61441 gtaaatcgtt accaaacaga gaactaatct ttcgaaacta gtttatgaga aagaaacatg
    61501 cacacaagcc aaaaacgaac cattaaaagt aaaaacaaaa gagaaatcat gaatgagacc
    61561 ttaaaacaaa gctttcacaa tgacattctt aagaagataa acacagagaa gccttgcaag
    61621 aatcaaaaga aaatttaagt caagtatctg tctgactgtt catcctaata aaagtgttac
    61681 tagttcttaa ttctcttgtg aaagatgaga acaagagatg gagaaatttg catactccat
    61741 gactagagtg cttatgactt tttcaagttg ctgcttcacc aggagcgtag agttttcaaa
    61801 ggacaacgac aaaatcacca acttcacttg ttttccccac ataatggaat ccattttcca
    61861 aagttccaaa ccatgtaatt gccattgaac tatttttaag tataatatat atttggattg
    61921 ttaaaagccc atgcgtcttg ggccttaggt ttacctcctc cctaagatta actaaaatca
    61981 tctaattagg ttatcaacac tagtgagagc tgtctctgcg atttgtatcc tcaaatatct
    62041 ttttccgtcc gatcatggat agtggaaaaa cttttgattc catttctaat gatctctttc
    62101 tcgagatatt attgagattg tctacaaagt caatcgatag gagtcgttgc gtgtcgaagc
    62161 aatgggcgtc tatactttgc agtcaagatt tcaccgagtt gttcttgact aattatctct
    62221 ctatccgtaa ctgaaaaatt gagatggagg aagataaaat gtccgttacc ccatgaacct
    62281 ttttggaaag agatatgcat caatggggtt ttgtattact ctggctagtt cagctcatgg
    62341 atatcttctg atagtttctt ttgattttag gtctgagaaa ttcaatttta tcaatgcatc
    62401 aagcttcctt ttttcatcta caaaattgat aaactacaaa ggtaaattag gtgggattga
    62461 tttggcgtat aatcatggtg gtgtatatcc cgttgagtta cgtatgtggg ttctagagga
    62521 tgtcgagaaa cacgaatggt cgagacatgt ttactctttg ccggagacca ttgaatttca
    62581 gcagtgtaac tacaatattt gcgttggtgg gatgaatgct ataggtgaaa ttgttttttc
    62641 ggagtcatat atatctacat ccaaaccgtt ttatgttttc tacttcaatc ccgaaaagaa
    62701 aaacacttta aggtgttaaa atccaaggtt ttgaagatta ccttaatcgc agagtttatg
    62761 cctttgtaga ctatgtagag gatcttagtg ttaacgatgc aatgcaactc aagtcaagct
    62821 ctttacaaaa tggctgaatt gctgaaatat cgttaccaag aggccaaaac aacaacaacg
    62881 ccggcataca tttcgtcacc tctgcaagtc tgctccgtct gtgaagaaca accatcacaa
    62941 ccgtcattga atcatttgct aacatgctat atcactctgt tggctttgct attttatttt
    63001 atttttgttt tttgcttttt tttttgttat atcattcggc agacctagct attttcttga
    63061 ttaatcgtgg gttcttgttc atggaaaaat ttgaaacact gatccttaga taacgaaaca
    63121 aaagacaaga ttcatggagt tttgaagtag gacaagcttt taatatatct tgcaaacgag
    63181 atcataattt tacgccataa aaggtgatat tttctttaat tatctctcta tccgtaagtc
    63241 ttgaaaaaat ggttcacatc cactaacaaa gatgctgtca tcacatttcg cagtgacatc
    63301 tagagtttgt gaattgttgt ttcaaagcaa tacaaatatt tttcaagagt ctaactagga
    63361 atttccttgg aacatacttg ggtctagcta tattggttta ttagtagtat cttgagaagc
    63421 ttattcaagg aatcaagaga accgaaggaa aacgttatga gactatttag agtagaaccg
    63481 aaagaaagaa attgaatatg actgagaaca tcacaaagtg acaaaaaaaa acagtgacaa
    63541 gataatgaca tgaggttgtg aaagagttgg aatctatatc tatggcttca acttcaatgt
    63601 cagcttgtaa ttcaactcca catatataca tagaaatgtt tataatttgg ttaaaaagtg
    63661 ttagttatgt gacttaattg tcgtttacaa tattatattt attttctggt taattatcat
    63721 gtccaaattg tgagagcaaa ctaatgttat atcctacatt gcgttttcaa aaaaacaagg
    63781 ggcagaaagg ccttttgaat tctgttgatg tttaaatata atataaagat atcagtgaag
    63841 attgaggatt agaggtttct ttctattgag atctgttgag caatgccttg aacaatcata
    63901 ccattcgcca attacgtaac aacaatgaaa gatttatgct tcgcttaaac taaaaaaata
    63961 attgtaccac agaattgaaa attttgcttc ttttgatagt ttctctaaac ctactgaaaa
    64021 actaacaagt cagtttagtt ttcttcatga tttttttttt tttttttttg gttaaatatt
    64081 aaatttcatg agcttctttc tggtatctat tcatcacaat agttctcgta aaagattaga
    64141 cctagagaga tttctaaacc aagaataagc agagaagaaa actaaactga ctttcctccg
    64201 tttaagtgtg tcctacattg taaacgtatt gaaccaagaa ttttgtttaa aatgtaacga
    64261 caagagagtg aggattttag ttacgaggaa agggacttgc tttgatcatg aaaagtgtta
    64321 tattgtttgg tgtaagtgtt tttttttgta tattcaataa cttgattgtt aagaaaccat
    64381 tacctcatca gttgctcact gattgaatag ttgaattgat gtttgaacaa tggagtcata
    64441 ggaatatttg aagattaaga aaccattttt tctgttgaga tttgatgagc aatcattacc
    64501 actagacact tcatgagtgc caataatgaa agatttatgt ttcacttaaa ctaacaaaca
    64561 tgttgataca cgaatcaaac aagtacgaat agagtctcta gggaagatga agaatcagtc
    64621 acttgatcac gagctttagc tgaggtagac ggactacaag ctcgacgttg aggaacgagc
    64681 taagtgcttt aaatcgatct gatcttgagt aggagttgat tgttggtaga cgagcttatc
    64741 ttgaagacga gctgatcttg aagacgagct gatcttgaag acgagttgat tgcttgttct
    64801 ttctccgttg atgggtccaa aaagttgccc ttcgccaaac ttgccattct actatttagt
    64861 cgtccgtata ataggatatc ccgaggtgat ttgtcgagaa tacccttaca ttgacaaggc
    64921 ggtcgtcatt acgggccgga gtaattgttt ccgagattgg gcttcctgaa gattgtagtg
    64981 ggctgatcgt tctgtttctc agattggaca gaatcaataa agcccaatct tacccattaa
    65041 caaaacacat caaatcctga tgcaaaagaa ttgtacactt tcattcttta attgtatttt
    65101 ctctaagaac atctccaact catctctatc tttgtctcta tactctattt ctacctctat
    65161 tttactccaa cccatttcta tttttatctc tatttttttg cctctatttt ctcttctaac
    65221 aaataaagat ctctattttt aaagaattat tgtagtgaaa gtagaaatct ctattttttt
    65281 ttctatttta taaaaataaa ataaaaacaa ccattggaga tggtctaaag ccttttcaaa
    65341 aatattcttt ttagtgtttg ttcatcaatc attatgatat gtgtgaactg tgatatatat
    65401 atattttttt ttatcaacac taagaaaata attatcaaat atgaagccat caatttcttt
    65461 ttttttttta aacctcatcg gaccaaattt atcttgccat ttttttattt tttatttttg
    65521 tcaacagaaa ttttatcttg tcattgaaat attatttttt tacgatcaac actttttttt
    65581 ttttggacaa caattttcta tcaacactaa agcccatata aattaggatg gttaattagg
    65641 tttcaaatcc accacctcta atgtcatcat ctagttaggt cgaatagatt ttcacagatc
    65701 ttcgccgtcc gatcaccaaa atacgccggt taaaatgaag aattggatcc cgaatgatct
    65761 catttacgag atactctcga gattaccagc aatatcagtt gcgaggtgtc gttgtgtgta
    65821 aaagcaatgg agatccatcc ttcgccatca agttttcacc gagttgtttc tagcaaggtc
    65881 caaggctcgt ccacgtctct taattggtgt acaacaagac ggtgagtgga ggttttactc
    65941 aacgcctcag tctcagaatc catgtgagaa taagttgtct cctgccgatt tccatatgaa
    66001 gttttctaaa ggcataagca attattcttg tagttatgcc tctggtttga tttattttga
    66061 tggtatgtgc atccgaaagg aggatgagga tgcaaagcat gttttatgtg accctctcac
    66121 aggaaagtat gtgatcttac ctgaacttag agtaggtgat tcgtatagct atttagggtt
    66181 tgatccagtt gataaggaat tcaaggtatt gttcatgact actcgtaata atatagcttg
    66241 gaaggatcta gatcattata ttctgacatt gggaactggg gaattgaaat ggaggaggat
    66301 ccgatgtgct tttacccatg agcctgtgtg ggaaaggatt tgtatcaatg gagttttgta
    66361 ttactcagct atgaattctg atggaaatta tgtgatagtt tgttttgatg ttatttcaag
    66421 ctcgttgacg cagaatgccg ttctagattt aatggattga taaactataa ggggaaatta
    66481 tgtgggatta ttttggagta tgctagtcat gatggtggat ctaccgttaa gttgagtatg
    66541 tgggttttag aggatgtcga gaaaccggaa tggtcgaaac atgtctactc gttgtggacg
    66601 gagagtcaag tcgttaaggt taaccataat ctttctgttt ctgggatgac tgctaccggt
    66661 gacattgttt tgtcgacaaa atatgcatct cagccgtttt atgttttcta cttcaatcca
    66721 gaaaggaaaa ctctgcaagt cccaagtgtt gaagtcgagg gtcttggagc taatcgtgct
    66781 tgcatgtctt attacgcctt tgctgactat gtagaggatc ttagtgttaa cgatgcagtg
    66841 cgacaactca agtcaagccc tttacaacaa caaggccaaa atatcgttac caagaggcca
    66901 aaaccacgac aaggccaaga tacatctcat gacctctcca agtctgctcc gtctgtgaag
    66961 aacaagtatg aattcttagc agacaggctc aatcactctg ttagcttagc tattttattt
    67021 tgtttgtttt tccttctttt tagctatatc attcggttgg gttgggttag ataattcatt
    67081 tcttatgatt acaaatttac aatatatttc cttgtggttc ccctttggct ccaaatctgt
    67141 ctgatccgaa atatttcctt gatgaatcgt gggtccttaa ataacgaaac aaaatataag
    67201 agtcatcgag ttttgaagta aaaggtgata ttctctacaa tttatctgtc cttaagtctt
    67261 gagcaaatgg ttcaaatcca ttaacaaaga tgatgtcgtc acatttacca ctgaggactt
    67321 tccttggaac acacttcggt ctaaatcagt ttatagattc agtgacagtt ttatatgaat
    67381 cggaatcatt atttttaggt taaaaagtgt taggttaaac ctattgatct ttatttagca
    67441 tctgaaacag agtctacaac aaaaagtgtt aattgtagaa taggaagctt gatattattg
    67501 tgaagagatt acaagtatat atagagtcat acaatgagga gactaggtta aaagtaatta
    67561 caacctaatc cgtaattatc tattatttac atattaatct ctctgtttcc tttctttttt
    67621 ggacgaacag aaatttcctt ttttcgttga atatattaaa aaatttatac ttatatacat
    67681 ttccatcgtc ttggtcaact ttgtcaaaga atccaatcct gggattgaag aaaccataag
    67741 gtgtaatcac atccataaca tgaacatgaa gcttgaacct gcaagagtta tatgtgctct
    67801 ctaagaataa tttacaataa taaaataagt ttaaaatcaa atttaagtac atgaaaacct
    67861 agtttctcat aaacctatac atgaacaata tatagacgaa tctccacata tttaactata
    67921 tattgttcat gaatgcatga tctcttaacc tggacgcatc atacgtcttt gtaagatgtc
    67981 aagtctctga ggtaggcaaa tctagtagtc gttgtttttt agaaatgctt tcttattgtg
    68041 ttaaaaggta aaatctgtgt ctatgtgata attttatgtt agcaaaatga atactactgt
    68101 gatttaacat gtggggaaat tttattttta caaaatgttg tctatatttt acggatatat
    68161 aatcttatat tttaattata tgattttcca ttttagtatt ttttataatc aaataaatag
    68221 ttagattttg ttgcatgttt attgtatttg caaattaatt tcaaaaacat caaatttaat
    68281 tattataatt aaatttgtag tttttttttt tgtcgacgtc taaactagat tgactcaaac
    68341 aagccaattc ttcagttatg atttccatgg aatacaaaca caaagaaacc ttacaagaat
    68401 tcataaaaga aaacactgaa gagaaatcag gtataatcac tgaaacgaaa ctagataaca
    68461 tatttgggta tgaaatcaga gctcttcaag atcaccaaac gatgcaaaag gagagtacga
    68521 acgaatttca accagctaga tgcagaagag aagtagaact aaggtttctt tagcgttagt
    68581 agcatgtaac aattgcgctc tctgcacaat atatgaacaa tatatcgacg aatctcccca
    68641 tatttaacta tatattgttc atgaattcat gatctcttaa cttggacaca ccatacatct
    68701 ttataagatg tcaagtctct gagataggca aatctagtag ccgttgattt ttagaaatgc
    68761 tttcttattg tgttaaaagg taaaatctgt gtctatgtga taattttatg ttagcaaaat
    68821 gaatgctact gtgatttaac atgtggagaa attttatttt tacaaaatgt tgtctatatt
    68881 ttatggatat ttaatcttat atttaaatta tatgattttc atttaagtat tctttataat
    68941 caaataaata gttagatttt gttgtctctt tgttgtactt gtagattaat ttcaaaaaca
    69001 tcaaatttga tttttaaaat tttgtagttt tagtagtaaa aagtaaatct ctatattaca
    69061 gtaaaatctc tataaattaa taatgttggg actgcacaat tttattcatt tagagaagtt
    69121 ttaatttatc gataaatatt aatttataga gagatttttc taatttagta acttttcaaa
    69181 attttctata ggattttttc attatagaaa atatttttca aaaatcaatt acaaataaaa
    69241 aataatatca tgtttagaaa aaaacaccaa aagtttttga taaaataaaa tactagaact
    69301 aaaatttaaa taagaataaa tacaaattta agcaaaaaaa tattagaatt atatttcaaa
    69361 aaaaaatctt acatataatg tatatatata attgatatat ttatacaatt attaatttat
    69421 gatattgatg agaccatata tttacatagg actttcgaaa aagttattat cttattaatt
    69481 tatcgatttg tgtcactttt taccctagtc ctaactccgg aaaaatttat taatttatag
    69541 aggttattaa tttatcgagt attaatttat agaggtttaa ctgtatttta ttatatgaat
    69601 ctgaatcatt attaggtgac gttattcgca agttacatac atgctagata gtcttttgta
    69661 tatatatcca ttacctcagt tgctcaatga tcaaatagct gaattaatgt ttaaaacaat
    69721 gaagtcacat aaatacatga acgaatataa tagtgaagct tgaaaaatta aaaagccatt
    69781 ttcggttgaa atttgattag caaatcatta ttaacatcat aacaatctat cttccaaacc
    69841 atgttttttt ttgttgccat tgaaaattat tttttcgatc aaacactaaa acccataaag
    69901 taaatataat tttagatggt taaaggccca tactaaaacc atgttttact tattggactt
    69961 aaataggtgc aaatacacca tctttaatat catcattcat ctaattaggt agtaagaaaa
    70021 tttaggagag atttcacatt tccgatcacc aaaatacgac ggcaaaaatg aagaattcga
    70081 ttccgattga tctcatttac gaaatactct cgagattacc agcaaaatca gttgccaggt
    70141 gtcgttgcgt ttcgaagcga tggagatcca tccttcgcca tcaagttttc accgaactct
    70201 ttctaacaag atccaacgct cgtccacgtc tcttaatcgg tgtacaacaa gacggtgagt
    70261 ggagctttct ctcaacgcct cagcctcaga atcgtcacga gagttcgtct cttgtagtag
    70321 ctgccgccga ttttcatacc aagttttctt cagggaaaag cagacatcag tgcacctatg
    70381 cctctggttt gatctatttt taaaaaatgt tcatcccaaa ggaagatgag gatgcaaagc
    70441 gtgtgttgtg tgaccctctc actggccagt atgtgatctt acctgaactt agagtaggtg
    70501 gttcgtatag ctatttaggg tttgatccga ttgataagga attcaaggta ttgttcatgg
    70561 atacttgtga ttttatagct tcgaaggatg aagatcatta tattttgaca ttgggaactg
    70621 gagaattgaa gtggaggaag atccaatgtc cttttacaca tgagcctttt tgggagagga
    70681 tatgcattaa tggggttttg tattactctg cttactattc tgattctaat ggaaggtctc
    70741 atctcatagc ttgctttgat gttaggtctg agaaattcaa tttcatagcc acaaaacatc
    70801 ggtacgatca gttgataaac tataagggga aattatgtgg gattaatttg gagtatgcta
    70861 ggcatgttgg tggatttcct gttaagttga gtatgtgggt tttagaggat gtcgagaaac
    70921 cggaatggtc gaaacatgtc tactctttgt ggacggagag tgaagtcgtt aaggttaacc
    70981 ggaatctttc tgtttctggg atgactgcaa ccggtgacat tgttttatcg atggaagatg
    71041 caactaatcc gttttatgtt ttcaacttca atccggatag gaacactctc caagtccaaa
    71101 gtgttgaaat ccaaggtctt ggagctaatc gtgatcacat agcttgccat gcctttgttg
    71161 actatgtaga agattttagt gttagcgatg cagtgctgca actcaagtca agccctttac
    71221 aacaacaagg ccaagataca tctcatgacc tctccaagtc tgtgaagaac aagcaactgg
    71281 acaattatga attcttagca aacaagctca atcactctgt tagcttagct attttatttt
    71341 gtttgttttt ccttcttttt aactatctca ttcggttgtg ttgggttaga taattcattt
    71401 cttatcgagt aaataacgaa acaaaaataa agagtaatcg agttgtgaag taaaaggtta
    71461 atcggtgtac tacagggccg aagtatcgtt atcaacaagt caaagccaca acaacgccgg
    71521 catacatctc gtgacctatg caagtctgcg ccgtctgtga aaaacaagca gcataacaag
    71581 tatgaatcat tagctaacat tctctatcac tctgttggct aagctatttt catcaactgt
    71641 ggagacattc gtgaatatgc ctaatagttt gtaaatcttt gtcaaaagtc tcaatcggct
    71701 cttaagctcc aatcccaatt ttttcttgat catggccaaa ttaaaaagct tatccatgga
    71761 taaaaaaaaa agtttcatgt agttttgaaa taggactagc ttttgatata cctggcaatg
    71821 tttagcataa ctcttaagta aggatctttc tctccataac tcttaggtaa actggttcac
    71881 tttcaatgac aaatatgctg ccataacaaa tcttttatga gactaccgct aggactttca
    71941 tggatatgtt atggtgacta tttagagcag aatcggaaga aagaaatcca agatgatcct
    72001 cgttttcttt catggcttag aacatagcaa actgatctaa agcaatagtt tggatccaca
    72061 ggtctagtgt cagaggttgc aatatagcag caaacacgta cgtgagctct tcagcagtta
    72121 gcaccgcaga cagtccttta aaatggaaaa gcgcaataag attaaccata ccatgagctc
    72181 taaccactga aaacgcagcc aaaagattaa tggaaacagt gacaaaaaca gccaaaacta
    72241 tattcacaaa tgaaaagtca gttcaagaag aagacataaa aagtcagttc aagaagaaga
    72301 cataaaaagt cagttcaaga aggagacaga aaaacaccta acaacaatct gaccccaagt
    72361 tagagctctt tgagtcaatc ctcttccttt cgaattttca attaaccagt ttcgatccca
    72421 ttgaaatcct tagcaaccaa accccaaaaa caacttagct tttctactgc ccgccagcaa
    72481 ataatcatat tacggggaaa atgtcatcaa aagtatcaac ttacgaaaaa cattagttaa
    72541 cttcatgagc ccatccatat gcttttggat gcttacatta tttttccgat tacacgagtg
    72601 ttattggtta ctaatttaca aagagtttcg atgacttcat taaaatccta caaagtaaat
    72661 aaatgaaaga ttataaacta ttgttagaga gttttttata atcttgttga ttagtttttt
    72721 ataatcttat aaagtttttc aaacaatctc tatattttga taatattttt catgactctc
    72781 tatgatttga ttttgtgaaa aagtgtggaa agttatgaac caataacata ataatttaaa
    72841 tcattaacaa tcagagattt ttttgcttta attgaataac acaaaacttt tacgacttta
    72901 taaaaatatg aatccaataa ccccaaattt taagatttta gattactttt aagttaacaa
    72961 atcttaaatg aataatacaa aactttaaca tacttctata ttatacttca ctaaaattct
    73021 ttgaaatcat aaaccaataa caccccctaa gaagaaagtt aatataaatt tatatgattt
    73081 aaaggcccaa tatcacctct aatatcatca tcatccgtcc gatcaccaaa atacgacgga
    73141 aaacatgaag aattcgatcc ctattgatct catcatcgag atagtctcga gatcgacagc
    73201 aaaatcagta gcaaggtgtc attgtgtgtc gaagcaatgg agagccatct ttcgccgtaa
    73261 atatttcatc gaattgtttc taacaaggtc caaggctcgt cctcgtatct tatttgttgt
    73321 acaagacggt gagtggagcg agtggagctt tctctcgctg cctcagcctc agaattcgtc
    73381 tcttgttgta gaatccgccg atattcatat gaagaagttc tctgcaggca taagtggatc
    73441 catttatttt acctatgcct ctggtttgat ttattttaaa tgtatgcgta tcccaaagga
    73501 ggatgaagat gaaaagcctg tgttgtgtga tcctctcaca ggaaagtatg ttatcttacc
    73561 tgaacctaga gtatttggta tgtatagcta tttagggttt gatccagttg ataaggaatt
    73621 caaggtattg ttcatggctt ctggttatac agcttccaag gatgtagatc attatattct
    73681 gacattgaga actggggaat tgaaatggag gacaatccaa tgtcctttta cccatgagcc
    73741 tttgtggaca aggatttgta tcaatggagt tttgtattac tcagctatga attctgatgg
    73801 aaattatgtg atagtttgtt ttgatgttag atatgagaaa tttaagctcg ttgacacaaa
    73861 atgtcgttct gaatttaatg gattgataaa ctataagggg aaattatgtg gggttaagtt
    73921 gaagtatgct tatcgtgttg gatttcccgt taagttacgt atgcgagttc tagaggatgt
    73981 tgagaaagat gaatggtcga catatgttaa ggttaaggtt aagcagaatc tttccgttgc
    74041 tgggatgact gctaccggtg acattgtttt gttcatgaaa tttgcgtcta atccgtttta
    74101 tgttttctac ttcaatccgg aaaggaactc tctcgaagtc caaagtgttg aaatccaagg
    74161 tcttggagct aatcctgatc gcatagcttg caacgccttt gtagattatg tagaggatct
    74221 tagtgttaac gatgcaatgc tgcaactcaa ctcaatccct ttacaacaag actgaaatat
    74281 cgtaaccata acaatgctgg catacatcta gtgatctctc caagtctttg aagaacaagc
    74341 atcagaacaa gtatgaattc ctagctaaca ggctccatca ctctattggc ctaactattt
    74401 tgtattcttg tcttatttat tttgtatttt tagctctatg actctattgg tttagctaaa
    74461 attgtcacat atataagatc agaacgccta atcaatagtc gaataattca ttggttatga
    74521 ttacatcatc cttccctttg gtttcctctt tggctctaaa tctgtctgat tcgatttttt
    74581 ttcttggtta atttatctca atgtccacta ataatgatca catttcccag taacagaatt
    74641 tataaattgt tgtttgaaag caataatagc tttgaagaga ctaactacga ctttcattgg
    74701 aacttacttg gtctaaatcg gttgactggt aaaggctcct tgagaagttt attcagggaa
    74761 tcaagagaac ttttgtacaa cattatgaga ctatatagag cagaacccaa aggaaacaaa
    74821 ctgaactgag aaatcacaaa gtgatctgga gcatgatttg gatccacagg tctagtcaca
    74881 aaggctgcaa tgtaatagca aacacgtgag atctacggca ctgcgacaat cctttaaatg
    74941 gagtcaaaac gaacaagtcg acgaggcttc ccaacgaagt ctgtgttacc aggagctcta
    75001 accacttaaa ctacagccaa aaggttaatg ggacagtgac aaaaacggtg agaagaataa
    75061 tctaaggatg tgaagaagga gttgtgttga tgtaagaatc acacaagtac gaagttgtct
    75121 ctaggaataa atgaagaatc cgtcgaggtt aacaagccag cgattagatg agaatgtaaa
    75181 gacgaagtgg agtgaagacg aggcgagata atgaagacga agcgagttcg aatgttgtac
    75241 ttgcgtcctt tctttgtcct ttctccgtca gcggaaattg cgcatatcct ttcattcttt
    75301 ctatttctgt atttatagaa cattctttct agggcttttc ctctgttgct ttacactttt
    75361 accctcttta ttctctttca ccgtacacat gtcattctct tcctcattcc ttctgttcgt
    75421 tgaatctagc tttgactcac tctgggtttc tcattctgtt aggaaatggg ctcggtttag
    75481 ccctttacaa tctgggcccg aaccgacccc caacaagttg gaatttatat gtggcttcaa
    75541 cgtcaatgtc aacttgtatt tcaactcctg aaatatccat agaaattttt gtttcaactc
    75601 tttttcttaa caaatagcac aaaggtaaac tgatgagctc tcaacatttc tcgtgtctgt
    75661 tcatcaacaa gagagtaaga ttatgcatac gaggaaagga acctgatcat gacaaaatct
    75721 tatcttgttt tgcgttagtg ttttgtaaat ccagtaactt gactgtcaag aaaccattgc
    75781 ctcactcaac cctttttcgg aaaaaaagaa aagaaacctt tgcctcagtt ttggtcaatg
    75841 attgaattgt tagagttgat ggttaaacaa taaagttcat tttttatgtt gagatctgat
    75901 gaaccacata tatccactag ccgcttcaat accaacaatg aaaagatata tatgttttac
    75961 ttaaactaaa acaaaacaca tcaaaatctt gatgaaaaca gaaacacatc aatatcaagt
    76021 cagtcacgta atactattat tttttttgaa aacaaatcaa cactgagaaa ataaataaac
    76081 attgatggtt ttaacgggat ctaaattctt cgtgtagaaa attgaaatct tatttaaaag
    76141 ctcatgtagt aatactgttt ttttttttgt tttgttcaat ttagttattc ttatatatgc
    76201 tctaagttcg tgggagaatt atatatgcct ttgtgtaaaa ttacaataaa acatttcagc
    76261 ttaggtggtt aagtaacgaa attcgaattc cagatttttg tatgttctaa aagaacactt
    76321 attaagtact aacgagagtc atatatgaat agatgaatga agatatcagt gaaacatgga
    76381 gattgattag aagtttgtac ttcattttct cttaagattt gatgaacaat ccacttcact
    76441 aactaacaat gaaacattta tgctttactt aaaactaaac aaacacatca aaatcatgat
    76501 gcgaaagaat tggacacttc tgattcttta atttattttc tctaaaacat tttcaagaaa
    76561 ccaattcata ggtcttcttc atgaccttct ttctggtaat attaagtcca tcacgttttc
    76621 gatcaaaact gaataaaaag taaaaagtta atataaatgt tgatggtaaa aaacccgtat
    76681 gcttcttggg cttaactagg tttaatttaa aaacccacct cccctaacag catctactta
    76741 ggtcgaactg tttaggagtt ttcacatact ggtaatgatg aattcgtttc cgaatgatga
    76801 tctcgtttac gagatactct tgagactgcc agcaaaatca gttgcaaggt gtagttgcgt
    76861 gtcgaagcta cggaggtcca tcctcagccg tcaagatttc accgagttgt ttctgactaa
    76921 gtcctcagct cgtccacgtc tcttatttgg ggtcaaacga gccaacggtg agggcctctt
    76981 cttctcgtcg actcagcctc ggaattcata tgaaaagtcg tctcttgtag tagctgccga
    77041 ttttcatact aagttctctg aagttataag ccgagaaatt tgtagctatg cttctggctt
    77101 gatctatctc tctgatatga ggatctcagt gaatgatgaa gatgtagtgc gtgcgatatg
    77161 taaccctatc acgggaaagt atatggtctt aaactgagaa ggtatgtaaa gtcgtatagc
    77221 tatttagggt ttgatccgat tgacaagcaa ttcaaggtat tgttcatggc ttatccatct
    77281 ggtcctgatg atcataaaat tctgaccttg ggaactagaa gaatgaggtg gagaaagatc
    77341 cattgcccct taactcatga tcctttttgt gaagggatat gcatcaatgg ggttttatat
    77401 tacttagcta tccaaattga tgaacccttg gttaaccaaa ggtcttttgt gatagtttgc
    77461 tttgatgtta gatttgaaaa attcacgttc attgacgtag attgctttta tcatttgata
    77521 aattataagg gaaaattagg tgggattgat tggaaacatg gtaacgctaa tggaagtcgt
    77581 acctttgagt tgagtatgtg ggttcttgag gatgtcgaga aacatgaatg gtcgaaatac
    77641 gactgcactt ttcttgagta tgaagtcatg ttctacaata tttctcttgc cgttgggatg
    77701 actgctacat gtgaaattgt tttgtcggag aagtttgcat ctaaatcgtt ttatgtcttc
    77761 tacttcaatc ccgaaagaga aactctccaa agagttgaaa tccaaggatt ggagaatcat
    77821 tgtagagttt acactattac agaccatgtc gaggatctta atgttaacga tgcaaagcaa
    77881 ctcaagtcag gcccatttat cactacgaaa tagcctaaag cacaacaacg tcgaagttgg
    77941 ctgaataagc tttataccat aagagtctag ctatttcggc tgacagtgtg acttgtcatt
    78001 ttacaagttt tgtgtcaatg tgtgagctcc atcactctgt ttagcatgtt cgtcctgatt
    78061 agcatgtcct aattgtgtta cacattactt tggagttgag caaataaatg ttttatctac
    78121 attgcgtttt cataaaactc tttgttttct tcgtagtcaa tgttaaaaaa ttcttttaag
    78181 atctatagta ttcttgtttt ctttgacatg tttctacaaa attattgtta gttccaaaat
    78241 ctaaacttca aaattgcata taatatatct aaacaataaa aagaatagga acaatatcca
    78301 tgacaatgaa aagactttaa aagggtgttt ttcagaaaaa acaaatacat gaattttttt
    78361 ttccaaactc ttttccataa agcagaggaa agaatttgga tcgtcctgaa gatatatact
    78421 tttctcatta ttacttctga gttctgacat tccagatcag aacttcaaat cactcttcct
    78481 gctcctaaac caagcatatg agaaacacag gttaactata aaagaaaaca caaaatggct
    78541 ttggtaagac gtttcttggc tgcaaagaag attattggtg gctctgtagc gaaactgagg
    78601 aaagaaactt cagcaatatt atgtttcttg cagtgtacgt cagataaaac caaaagaaga
    78661 agaagcagag acgcatattt tgaagatggt tacatggcga aaaacaccaa atgaagtgat
    78721 agaaatcgcc atgtaaagct gaacccattc ttagatctga accgatactg gtcatatcca
    78781 gcctctacta cattgataaa ctataagggt aaagtaggtg tgattaattt gacgcatgcc
    78841 tatgaacgtg tatttcccct tcagttacgt atgacggttc tagaggattt tgagaaacag
    78901 gaatggtcga catatgtcta cactttgatg gctgagaata tagtcgttaa gtatgtttcc
    78961 gtggttggga tgactgctac aggtgatatt gttttggtga aaacaaatgc atgcaaaccg
    79021 ttttatgtgt tctactttaa tcccggaagg aacactctcc taagtgttga aatccaaggt
    79081 gttggagaag accacaaatg cctcaacttt catacagttt gcgcctttgt agaccatgta
    79141 gaggatcttc agtttagttt taagaattga aagagacacc agctagaatc ccagcagaac
    79201 agaagcgtac ttaaagatca ttaagggagt accgttgctc acctgcaatc agatagtgag
    79261 gcgttaattt aatgccttgt gtcttttagg tgacaaaatc tgattgcctc ttttgctccc
    79321 cccaagtcag atgaaatatc tttctatttg atgcgaattt attcttcaga aattatgttt
    79381 tttcttctat aatcagagcc atgctgaagt tttcttcata atatttataa cataaagcct
    79441 catttatgtg agctttaatt tgcactatat tggcttacca ttttgttcta gtttatatca
    79501 tagagtctaa ctattatatc atagagtcta tcgtgccagg tgaaggagca cacatatgtt
    79561 gcaatgaagc aaataacttg aagttggatt tgaaatagag atattcgtga acatatgaga
    79621 cgtgcatgcg cttatttcta ttttcccgtg acacatcaag attcgataca ataacttaat
    79681 caaagtcaga ataaataagt gaaagagcaa tcaagtgaat acaaatgagt tttttttctt
    79741 aataggagaa attcgtgagc ttttttgaat gtgacatctc aagattcata tatacctctg
    79801 caatgacatt attagagacg cttaattaat tagcgaaagt gtacaagaac tcagattaaa
    79861 agtagatttt gattcaaatt tcaagaaaca gaaaatagat tttggtaagc ggtttttagg
    79921 ctgcaaagaa gattttggtg gctctggacc agaagagaaa agcaacttca gcaccaaaag
    79981 tttttcttgc agtgaagtca gagaaaaacc cagaagaaga agtagaaata cattgtgcca
    80041 gtctcttact tgaactagcc ttcgtttcaa actcttctca ctaatgccga gatataatgt
    80101 ggataaaaaa tgtgagccgt aagccgtctt cgtatcgaca atccccttgg tgtgtgattg
    80161 agctgagacg gttgcgaaca ttcttgtcaa tgagtttgat gagccgatcc tgtgaagaat
    80221 gcatgtcttc gagcattccg ttcacgttca agtcattctt cttgctgcta cgccaagcag
    80281 atactcctca ttgacgtgtt gattatgtta cttgagataa aaattacaac tgtacaagag
    80341 aaaacactaa tctataaaat aaaataccgg taaggttagc ataatcatca gagaaagtga
    80401 gaaactcacg tatatttaga tggttaaagc ccatgtttct cgggctttat aggttagcgc
    80461 cgaccttgaa ctttacgaga tttttccgta tataataaac ttcagcaata ttatgtttct
    80521 tgcagtgtat acgtcaaata aaaccaaaag aagaagaagc agagacgcaa attttgaaga
    80581 tggttgctct ctgttacatg gcgattttta tcacttgact attcatctta gtatcactgt
    80641 agccttcgtt cctctttcga gagcttcttt aggtttctta tgcctttcag tttaattata
    80701 ctggtaactg aatataatat agccatagaa caaatgcaaa agttttagca accattgagg
    80761 aattttaagt acagagtctc tgtcaatttt tttccaattt tacttaagat tttagggtcc
    80821 aaaaatctct gtaattaaaa acagtattaa ctaaagccaa tttttataaa tcagcacaag
    80881 gtcttcaaaa agtttgagcc ggccctgttc ctgacatact ctcgagattg cctgcaaaat
    80941 caatccttag gtttcgttgc gtgtagaagc tatgggagtg agggagtcca ttattcgtcg
    81001 tcaagatttc ccccagttgt tccacacctg gtcatcctct aatccacgtc tcttgattgg
    81061 gattgtacaa gaaggggagt ggagcttctt ctcctctcct tagcctcaga atcactaggg
    81121 aagtcgtctc ttgtagtagc cgccgatttt catatgaaat tctccaaaga cataagccca
    81181 aacagttgta gttatgcttc tagtttgata tatttcccta ttatccagat ctcaaaggag
    81241 tgggacgatg aagtgcgtgc gatatgtaac cctagcacga gacaatatgc gatcttacca
    81301 cctgacctca gaacaacgta ccaaaacttc ggtccccttt taggatttga tccgattggc
    81361 aagcaattca aggttctagt cttcaactgt agagtcggaa atgaattggt ttatcatatt
    81421 ttgacattag gaactgaaaa tgtgaggtgg agagagatca tatgtccctt tacctatgaa
    81481 cctcgttgga aaaggtcgat atgcattaat gggattctgt attacttagc tgttaactct
    81541 aatgtatctt ccagtgtgat aaactataaa ttgataaact ataagggtaa attaggtttg
    81601 gttgatttgg agaaggatta tgatgctgga tatctccttg ggttacgtat gcaggttcta
    81661 gaggatgtcg agaaagggga atagaagaaa tatgcctaca ctgtgagggc tgatgagaat
    81721 aaagtcttta acaacaatct ttccgttgtt ggggcaactg cttcaggtga aattgttttg
    81781 gcgaagaatt atgcatagaa accgttttat gttttctaat ttaatcccga taggaacact
    81841 ctccgaagtg ttgaaatcca aggtgttaga gaagaggaag aatggtttga cgatcataca
    81901 gttcattaat tactttgtag accatgtaga ggatcttagg tttgatggta tgaagacaac
    81961 atatgttgca ccatctttaa gcccaccaga acagagcaca tcatcatcaa gtgaggaccc
    82021 ttgctcactt ggaacaagat catttcgtag taggtttgag agcattaaca aattaatttg
    82081 atgctttctg tcttttagaa gatgattgaa atttactaga tttaaaacct gattgcttac
    82141 cttactcagc tgaaaaagct ctctaattga tgcaaattgt atttgtactc tctatctgta
    82201 aacattaagt tatgtcaaag aatttcttta gaaattatgc ttttatgaag atcctgtcaa
    82261 ttttcatttt catctaaagt cagtaatagt ctaattgagg atttagaagt agtaaagacc
    82321 tttggtactg tcggaaaaaa aagcacacac atatcaagta aataaaaatg aaatttttat
    82381 caagagagat atgtgagttg ttggcccagt ggtaaatttt cccggtgtag gtgcggggtt
    82441 cgaggcacat taagacagat ctcttctcca aaaaaataaa tttaacatga tgtagatctc
    82501 tcactgagaa atataaactt ttgcgcttga atttttaaat attaagattt tttggtccgt
    82561 gacacgtcat ttgttctctg caatgagatt agataacaaa ctcttctttc tttctctctg
    82621 catgtaattt ggggcttcca aaaataaaag taaatacttc gattagaggc tgcaagaaat
    82681 tatgtgtttt aaaatagttt tttttttctt tcgccgacta actttgagtt aactagtttg
    82741 agctcagtgg tcaactatta agctggcttc aattaaatcc ttaaaagtag aaatgaaaga
    82801 ttttaaatga ttgttagaga gttttttata atcttgttga ttagtttttt ataatcttgt
    82861 aaagaatctc aaacaatctc tctattttga taatactttc catgactttt catgacttca
    82921 ttttgtgaag aaaaatgtaa gaagtcatga accaataaca taataattta aatcattaac
    82981 aatcattaac actcaaagat tcttttgttt taattgaata acacaaaact tgtaatgact
    83041 ttataaaagt atgaatctaa taacccaaaa tttatgaaga ttttagatta ctttttacaa
    83101 atcttaaatg aataacacaa aactttaaca tattttaaat aaatcttgat tgaataacaa
    83161 cagattatac atgataattt aaatcactaa aactctttta aaatcataaa cgaataacat
    83221 cccttagttt attcacccaa aaaatcaagt ttaacacaag cattttttta gaaaaattct
    83281 tgttcattca cccctcttta ataactaatc aaaatacaat aatatgccat ttaacactat
    83341 atttaagaat aaatcaaaat taaaattaga aaacaaataa ggaaatcaaa tctgtatatt
    83401 tttaattaaa gaagattaaa tatcagtgta tgtttataaa taagaatttg agtttagatt
    83461 tgataattaa acaaaattaa atgtcggttt gggtttataa ataagaatta gggattgtaa
    83521 tgacaagttt taggattgtg tctttgaaca gagatatttt ccataatcca gagattcacc
    83581 aatttgcgat ttctcgcaaa cacaaggacg atcatgaata gtgaagaaaa cacagattcc
    83641 attcctattg atctcattct tgatatactc tcgagattgc cttcaaagtc aatcgcgagg
    83701 tgtcgctgcg tgtcgaagct atgggaatcc atgattcgtc agtcatactt caccgagttg
    83761 ttcctcacca ggtcttcatc tcgtccacat ctcttaatcg ctgtcgaaca agaaggggag
    83821 tggaaattct tctcgttgcc tcaacctaaa aattatcttg ggaagtcgtc tcttgtagta
    83881 gccgctaatc tccatctgaa attctttgaa gacaaacgcc cacaacacgg ttgtagttat
    83941 gcttctagtt tgatctattt ccctaatatg acgatccgaa agaagggtga cgatcacttg
    84001 ggtgtgatat gtaaccctag cacagggcag tatgggtatg tgatcttacc acctttactg
    84061 gatttcaaga gcgtgcctta cggtaaattt ttagggtttg atccgattga caagcaattc
    84121 aaggtattaa tcccgatatt cgattttgat aaacatcaaa cggatcatca tattcttaca
    84181 ttaggagctg aaacagttgg gtggaggaag atccaatctc ccttacgcta tcttcctcat
    84241 agtaatggaa caatttgcat caatgggatt ttgtattacc tagctaaaat taattatgca
    84301 atggataaaa atgtgctagt ttgctttgat gttaggtctg agaattttgt gtttctacgt
    84361 cttaacacat actgctcttc tactaaattg gtaaactata agggtaaatt aggcatgatt
    84421 aatcaagagt atgttgatga tggtggtttt cccctaaagt taagtgtgtg ggttctagag
    84481 gatgtcggaa aagaagaatg gtcgacatat gtctacactt tgagggatga taataaagtc
    84541 gatcaggtta aatataatct ctccgttgtt ggggtgactg cttcaggtga aattgttttg
    84601 gtgaagaaga ctcaaacact taagccattt tatgttttat actttaaccc cgacaaaaat
    84661 actctcttaa ctgttgaagt caaaggacta caccggggat tgtatgccgt acacagaatt
    84721 tacgcctttg tagaccatgt agaggatctt gagtttaata ttatgaagac aacatatgct
    84781 gcaaaatcaa aattctctca ggaagaccgt ttttaattac ccgcaacaag atctttgtaa
    84841 gcttgagagc cccaacaaat tcaatgctct gtgtctttta gatgatgatg atgatgatac
    84901 ataggttcta tggttgcttc ccaagtaaga taaaaagttt cactatttga tgcaagttgt
    84961 attctctctt tgtaaaccat tgaaaattta atgaagttct ataagaaaat atgttttaag
    85021 atttctgtct attttatttt ttattcagag tcacacacat caagatccat aattaaccat
    85081 tgttcccttc tatgagataa caaacgttac ttgctttctc tgtgcaagca ttttatttat
    85141 ttggactccc aaaaataaaa gtaaacactt taagagaaac tcggattaaa agtaaagact
    85201 tattatattc agaaaaacta gttgaaccag cgtttgatta attgttgctg cctcttcaac
    85261 atatacagtc aatgcctctc catctaactc tgctctacca acccgccatt gtagctgatt
    85321 ctgaagccat aaatttaaaa gccaaaaccg ctgtgccggg aattgttaca aacacagcaa
    85381 atctagtgag tgaaactgca caagtcttgg ctttgataca accaaattag acacaacagt
    85441 ttcatagact gaacacattg aaaagggttc tcccactgag ttgaaaactg caataaaaac
    85501 tgatactaaa accattacaa gagaggctgc ccagcctact acttactgat ggcatagatg
    85561 tttactggta ttcattggga aataaccggt ttgcaacacc tgaagcgccg ggactggaca
    85621 gggacgggta taatcaatcc aacaagccat caaattagag atgatgataa taaatatggg
    85681 agaatcttaa caatgtttaa acaatgaata aatgttttcc tttacaatct taatcaatct
    85741 atataaagtc atcttattat ataaagtagg atggttttca aagctagtaa ttcatatgat
    85801 cgcgaaaaaa acactctcca aggtgttgga gctaacggtg aagcttttga gaccgattgc
    85861 agagttaggg ttcactctca tatcgagcat cacattggag atgaagatga agatggctat
    85921 ggagatagag gtgaatatga agattgatat gcagatggag atggctatgg agatgaaatg
    85981 gttatgaaga tggctatgga gatgaatatg aatatcatga agaagacagt tagggagagg
    86041 tctgtggata gctgaatcat atgtccttca tagacttttt tgattaatca agctttcata
    86101 tttttaaatc gtatgtcttt tcagatttaa aatcaatata tttgatgtgg ttgcttcaat
    86161 tgggggtcaa acgtggattt ggggtgttct ggtaaaagtg gtcacagttc ttgtggaaga
    86221 ttcacaatta tatatataac aagctgcaag tctctttcaa gttgctgctt cagcaggaga
    86281 tgagagtttt cgaaggacaa caacggaatc accaatttca attgtttttc caattccatc
    86341 gccgaatccg tctttccaaa ccatgttctg cccaaagtat atctgcatca tatttaaatc
    86401 taccattcaa aaccctcgta ttcatttgtt atgacgataa accggaccac ggtctttctt
    86461 tacctttccg tgtggtttac tctttggctg taaaactttg tctgacctga aagtcctcaa
    86521 agtctcaatt ggctcttgac ctccaatacc agtttcttga ctaatcgtag gtacctgatc
    86581 atggacggat taaaaaaact tatccttaaa agaacaaaac caaaaatgaa gaagattctt
    86641 catggagttt tgaactatga caaggttttg atataccttg cagcgagagc ataatttcac
    86701 accgtgaaag gtgaaaccgt ttataaggat ctctgtccat aagtcttcag caaatggttc
    86761 acatccatca acaaagatgc tgtaacattt cccagtgaga gttatcaagt gttgttacaa
    86821 agcaataaaa acagtgaagg ctttctgaag catacttggg tctaaatcgg ttgatcggta
    86881 caggctcctt gagaagctta ttcagggaat caagcgaacc ctggaaatag cacgagactg
    86941 tttaacgcag aaccgaaaga aagaaatcga atttgatcct ctgacctgtg atataagcaa
    87001 gaatggatac atatccgaga acatcgcaat gtgacctgga gcataatttg gatccacagg
    87061 cctagtctca taggctgcaa tataacatgt gacttgtgat gaaatatgca ccgccaaaat
    87121 ctttcaaagg agtcaagctt aactgattaa gacaggaaaa aagtttatga gacctgaatt
    87181 aaaacgaaca agtcgacaag gcttcccaac aaagtttgta aaccactgag atgcttcttc
    87241 tccttcatct agtgcggagc cagaccactc ccaaactgag acaccgtctg ctattttgtc
    87301 gggtttagct agggagacct taagggcatc cataccagga gctctaacca ctgcaaacac
    87361 agccaaaaga tgagaaaaag accaacttca ttaaaacaaa aagccagctg aataagaaga
    87421 cataaaaaca atctgaccca tgttagagct cttctcaggc tcccagtcct ctccaaacgc
    87481 atgcttaggc atttctactt caatcaaaga aagctttggt tccactctct gagtcaatcc
    87541 tcttccttta gaattcacaa tcaaccagtt tcgatcccat cgaaatccta agcaaccaaa
    87601 ccccaaaaaa aacttagctt ttctaatttt ccccaaacaa atcacaccaa aataatcaca
    87661 tcagctctca caatgacaac ttcattaaac tgttttggat tacttcacac ttaatcattc
    87721 acattccaag tcttatacac ttttagagaa tcattgagga cagcacaaaa atcaatcttt
    87781 ccacttaata actttcagag actcagagtc acactaaaga caacttagac ccaccaacaa
    87841 ggagtctcac tgaatgatga tgaaccctta aacaacgggc taatcgaaaa tatcgtaaga
    87901 agacttaaac ccagatgaag aaacagctct aatatgaaac ccaagaagga aaaatcgaat
    87961 tcgaaaccaa aaaatgagaa atttttctcg aaactagttt ttgttgatac cggtgggagt
    88021 gagagctgcc tgagacagag aaattcctcg acatgatttg atcggataaa cgaacaaaga
    88081 cgatactctc gcagcgactt cacttgccgg cgacggtgac aacaacggcg acaaagtatt
    88141 ctccatctct tctttttctc taacgttgac ttctcccgaa gaacttaatc ttacaattag
    88201 tatattttca tttatgtccc caaatttctt atgtttttct attaaagcct caaactttgt
    88261 ttatgataaa aatatcctta ctgttacatt tccccaacca attcattctc tgtatgagat
    88321 gaccaaagag ctgtttgatt taccactttc aatacaattt cctttttaaa tcttaatgca
    88381 tatatcttat ctacaagaat gaaaagagtc aataaaaatg acccaaaaag aagtattttt
    88441 caagattaaa caaagaaatt ttttcatctt tagctctctt taagaaaaat ttcatctttt
    88501 caagatttat aaaattaggc tgcagaagtt aatctcagct gttggtgttg agattcacca
    88561 gtcattggat cggttgtgtt ttggctctct aatggcatgt actgagacat aatcgccatg
    88621 atttctgaat ccatataaga ctgcattttc gttttgacac aaaataatga tcattagata
    88681 gataatagat tcatgatgat gaatgagttt gaagattaag taaagagaag aaaaaaaatg
    88741 tttggagaaa cataccctga gacgatactt gtagaatacg taaccaccta cacatatgct
    88801 tgcaactgca gctagaatca caaatgtagg gaaccatccg attcttgatc cgcttctctc
    88861 tgcgagaaac gaaaaacaaa gaaatgagaa tatgattctt ggattgtttc aaaaagaatc
    88921 tgaaaagttt tagatcttta ctgaccaata caagtgtctt gttctttcat gtagagacga
    88981 tttccagagc atttgcattc aaagcctccc catttgttct tacagttgca tccatcacat
    89041 tgacaagctg attgctcctt acactcatca atgtctatat gtcgtagatg aatcagttta
    89101 agaaaacatg atgagagatt ttgaattcta gagaaaataa aagttttcac cttcacattt
    89161 aagaccatct cctttaaacc ctggagggca gcgacatccc gatgtctcca agttctgaac
    89221 tcaacaattg gagaaaattt gtaagtttca aacattatgg cattattact gaaaaggcca
    89281 taacacagta gagtaactaa ccgagcaagc cgagaaagtt aagccctttt tggtttcaga
    89341 ccagcaacct ccttggttaa tcgagcatct tgcagggcca taagctgtta taacattcaa
    89401 gtcagaacac aaaatgttta taatgaagtg tttctacaag atatcaatgt agaagttgaa
    89461 gaacgtacgt tcacatgatg tatatccatc tcctttatac tgtacaccat tcacaacagg
    89521 gcattcacag actcttcctc taaatgtgtc ctgatagaat ccatttttag gtataaaact
    89581 aaccaaatat ctataaaaat gtagtccctt aagttcatcg gttctaagta ccttgcaagc
    89641 tgttacattg gacttcttgt cctcccaaca ccctccattt gcttcgagac attcatttgt
    89701 ttcaatatct gtttcaacag tgtaaacaaa acaagacttc tttagtacat tctattacca
    89761 cacatgaata taagcttaca agggaatttc tataacctcc acttagacag atcccgggtt
    89821 cggttctttc cttgaatcca gaacatatag ccttaagtac tgcatttctc tcaagtttac
    89881 ctgagcaaca aaatcaggta aagaacttaa gaatcctaac ttttcggtaa ctgatttaca
    89941 atgagaagga atgaaacaaa ccgcggtatt gagcattgtt gacgatcaat gttggcaaga
    90001 ttgtgacatc tccgcggtca ccttgtccta cctataagta acaaagaaaa aaaatctcag
    90061 tgaatcggtt taaaaagacg gtaaaatata gacgcattta agaagagagc caagacctga
    90121 agtgcttgct cagctttcaa aacttcattc tccacattag catcaggatc accaatacat
    90181 ttcttgatct tgtcaagtgg caaacctgag aataagagaa aactcaagac gctgaatgtg
    90241 aagaaagggt actaaaaatt attgtgatgt cccttaccta gagattcaac aactctctct
    90301 gcacattctt tgctatactt cttctccttc attgaacatc taatgtgaaa atcagtcaca
    90361 tagtcccacc aaacccaaga ccggttattc tctttagcta ctttatgaac acacaactgt
    90421 ctcaagttct cgaagacaat gtctttacca tcgtatccat caccaaagtc ttgttcaggg
    90481 tcaggagcac aatacctccc ttggtttata cactgagact tacattgatt gctagaaaca
    90541 taatctttag gacaaaacca tgtaatgtaa tgaggtgtga acaaagagta tcctcctttt
    90601 tcaagaatct gcgcatgtcc tttgaagttt tttacgaaat tcatctgctc atcacaccgt
    90661 gcaccacact catcgttcgt gttagtccat agctcatact caactctctc atccggatga
    90721 ggtaatgact cactccagtc tatcttcagg actacttcct cacctttctt aagagcttgc
    90781 ttgagagtat tggcgaaaga aaagtctatt aaagccgatg gaatgttgag tttctctata
    90841 aagtcatcag cttctttgga ttcctcaggt gaatccattg ttatcaatgg ctcatcgacg
    90901 ttatcagcta ctaaaactgc tgctacaccg gattgttgac cgttccatac ctttaatgca
    90961 aagtaacact ctaatgcaaa acaaaacaat gaatcaaaac caaatattta ccatttctgt
    91021 cacatatgta aataacagaa ctttctacat ctacacagaa atatggaaca aatcaaatag
    91081 aaagacttgt ctcaatctca atgaacttaa aaagagaaag cttttaagtt cttcaacaaa
    91141 ctaaattaag attgagacaa gtctggtata ccagaaagtt ggaacattac caaatttgaa
    91201 gtaatatttg gatcaaaagg agattgaaag atgtaaacta agacttaaaa gagagagctt
    91261 taaaggttaa gacaagtctc ctatgtaaat gacaaaactt tctatctctt aaccataaat
    91321 ttggttgatt atataacttg caaaagaatt tggatgaaag atgtaaaact aagtcataaa
    91381 agagaaatct tttgctatat tatacaacaa aactttcatg taaatgacaa aactttctat
    91441 ttctaaccaa aaacttgcaa tttggaacaa tttgaatgaa acagttacct ccacgatcga
    91501 tgatcaaaat ggtaggacga gggaatttgg gtttgaaagt tttgtcaaaa gagtcacatc
    91561 cataagctcc ttgaccggcg taaacgacgg agccgatcat gtaaccaccg tagttaggaa
    91621 caccgaagtt agcaatggct gcgtcgtgct tagaccgcat tgccaaaggg tttagaatcg
    91681 tcacgctact cttctcaacg atgaatctcc cgaaaactcc gttgaccacc atagtcaacg
    91741 ctagaaacag agccaaggtg gctcctttat gaatcaaaga cattgtttct gatcaataaa
    91801 aaaacagagt ttcaaaactt gtgcttcgaa tttcttttgt gggttttacg tttgttgcat
    91861 gagaaagtga gaaagcaaat cggaaagtaa tgattttttt cgatttttct taaacagagt
    91921 ttgagagaaa aaatgaatga ctctgttttt tgtccttgtg gagaaaaaga gatgtgagcg
    91981 taaagtaaac gggagagaaa gagatgactt gacagagtca gcggaactaa ccatgtctct
    92041 gcaactactg attcaacaaa cttctctttc tttcattttc tcttctctca attttaaaat
    92101 gatttacgag aaaaaaaaaa aaaagtatta acgttttctt agaatgtaag gcaatcgtga
    92161 gatcctatca tttttattca aagctctaat cttgaagatt aatcaagtgg caaaacgtta
    92221 aaaaggtatg ggtggcttaa gtttaagtcc acaagtttca atttttatcc ggacacatca
    92281 tatgtaaata cttttgaatt tataatgata acaaagatca agactatgct tacttcattg
    92341 actttttaaa atgcaaagtc tattgaagta gcatttgggt taagttagaa acttagaatc
    92401 atccaaacga cgatgtgaca attactagga gacatgaata gttgcttaat caatattgat
    92461 tagtttaatg aattatccaa cctaattgtt aactttacca ctatttatta ccaatatatt
    92521 taaggcagac caagaatatg atgtgttttt ttaatagatc atgatgtgtt tattttaata
    92581 taagttcagg gaaatggtta caaacatgca atttttattt agctgagaga ctatgtctct
    92641 aagtgtaaaa tgattagaat gaattatagt tagtactaaa tatttatatc ttctacttgt
    92701 gggatgagag aaaattatta tattcagtga acaatgattt tgattaatga ttacatgtca
    92761 atccataatt taaattgtct cattggttgg agactcatgc cagctttttt tcatatacaa
    92821 caggaagata gaaatgtgta tattttattt tatcgaattg gagtttctac tttctacaaa
    92881 tggagataaa atggtaacaa aaagtagcaa gagactaata caatgatgtt caaaataact
    92941 ttttcttcac gtcatgcaaa tgaatagaat agacaacaaa catacattgc caaatgccaa
    93001 gaacgttcaa attacgctac aaataccaat aagaattcac aaaaacgtct ttttcatttc
    93061 aaagaagcca attaacacta atgttaccaa gccatatcaa aagtgggaac tggaccaagg
    93121 ctaaaaacag aagaaggtag tgatgtttgc tcgaatcgta acttcttact tcagcaaaca
    93181 gaacacgttt catcgtcttc accaagaaaa tcccagtgca tagacaagtc catggcatca
    93241 acgcgtagta cgagtatccc cacattattt tggcaaagcc cgcaagacac agaccagcaa
    93301 aagcataccc tccgtatgcc acaatatcta gtaatggtgc ctctccacta ccaagtgata
    93361 gaagtgttac tttcaggagc attacttgca aaaaccaacc aaccaatcct ttcacaaaca
    93421 gccaattcaa agcttccggt gtaaacctag agaccaatca ggtttgaaat ggattaataa
    93481 tcactctgtc cacaacaatc attcaagacc taagacagaa aactatttag agggaatcat
    93541 agggagggag acgaagcaca acacttactt tccattaagt cccaatgaaa gaccagcaag
    93601 aacaacgtag gtaccaaatg ccataaaggg aatgtacaag tctggagcat tgatatcata
    93661 tattggaggc ttgtatgaga gcctaccacc aactggttca gatattctgg tccagtgtcc
    93721 ctgagggttt gaagcagaac ccacaatagt acaattaaat ggctgataat aagagaaagt
    93781 cccaaacaga agaagaaaag agaagactag cttacccggt gtaggaaagg aaacagaaca
    93841 accttcagtt tattcctcac atattgatca ttcacttgga aatagtattg cggatcagag
    93901 aagtaccggc ttatctattc cattgcgata acaacaagtt caaaaccatg aaaaccagat
    93961 attacgtgtg atatggaatc ataaagagtt cacttacatt gctctgaaca tactcagagc
    94021 tcgatcctaa aattctctcc ccatacgctc ccaaaccacc acggataaaa cccgagccag
    94081 ctccagtgaa aggattacca aatggaccag gctcagggtt tcctggaggt cttggcatcc
    94141 ccggttgagg tcccatgtta ttatacatct ctgccatcaa accaaaacaa tcacatcttt
    94201 atctcaaacc aaaccaacca cagtcaatac acatctccaa cttctaaact cttaactctt
    94261 gaaaccaaac agtattatca acatttactt cttagattcc acagaatctt cttcaaaatt
    94321 tcaatttcaa tttccacaga atcttcttag atcctaatat cgattctaaa gtcataatct
    94381 caattcgtaa tcacttccat tgctttttcg aatttcaatc acgacaatgc ataacaaagc
    94441 aaagccaaaa ctagatctat gattcaacca gaagcattca agttcaataa cacaatcaat
    94501 ccaaacctaa aatctatcga aatttatcaa atctaacaaa agaacaaaga tctgattcgc
    94561 taatcgagaa acaacaacgc atacgaaata gcaagacgaa gagcaaaatt ccactaccga
    94621 tccacaccaa atcaaaacta acccggagat aaagaggtag agagctcaaa gcttcaacga
    94681 gaaagttaga gttttcttca aatggaaaca atggattctc ctcagaaatc aaacagtgtg
    94741 atctgcacgc agacgaagaa gggtattatc gggttttcca ttcgaagcgt tcttctctat
    94801 ttatttgggc ctaaattggg ccaataattt tccgaatagg ctctaaactt ggataggata
    94861 catttaaact cgtaaccaaa cagaaccgga gcaattcctt tgttcctcaa ttaggtttag
    94921 actttataaa agaagtccga cgcagaaatt aaaacccctt ttgcctcaaa accctgattt
    94981 caaatctccc caagcacaac aatggcgaaa tcaatgagat gcaagagggt gaagagattg
    95041 agagcaataa gaagagaaat agtggagaag gaatcattca ctctaacgag agaagacgcc
    95101 aaatccgccg ctattgaagc cgcactcgct gctccgaagt taccagttcg tcaagcccca
    95161 gtttctccgt ttatggaagt tgcgacgcct tcctctgagt ctgcatctgc ctccactaca
    95221 atcgccaacg atagtggtat gcctcctcta aatttgcctc tttgattttg tacgatttgg
    95281 ttttagataa ggtaacgctt gaagaatcga atttaagcta agctttagaa tctgaaattt
    95341 aactgaatca ttcattttag ttgaaatctt tgaaggagct tgttagttca ttactcttgg
    95401 gaaggttgtt actctaagag aaacgtatcg ctctaaaagc tttgtttggt ttctttatat
    95461 tgaattttgt gtgcatctac aagtatatct ttgaaagttt tggtattaag ggtttgttct
    95521 gttttgggat actattgttg tttgcttgta gatgaggaaa tggatgatga gaagaaaaac
    95581 aagtcgctaa aacctattgg gaagaagttg aagaagaagt ttaagctggg gatgaagaat
    95641 cgtcgtagta agggtgtcct tcgaggcaaa cgaaactaaa actggtcttg gctttcttct
    95701 actgggtttg ttttctactt gcataattta tgttctctct taattttggg gttcttcaat
    95761 gtcttagaat atagcatctt ttgtactgtg ttttttccat gagtttcagt actatagaaa
    95821 ccctaaaaac gtgatcgcgt ctgaattgtg tctcccatct ttcatttttc ttgcaccaaa
    95881 agctatcatc acaacttgat ttagagttaa cgtttagggt tattaccatt aacatcatga
    95941 accctttgac ataaattgat catgttggac tgatattaag tattgtcttg atcaaatagt
    96001 gacggtaagt gtagaactca tgtaaatcga agttgcaacg aaaataattc acagtttttg
    96061 ttcttgttca tacaacaaat tacaaaattg caatagaaaa gagctcaaaa accaaacaag
    96121 aaattatttc aagaaacaaa agatccttct catgagggat gatgattata atttagtaag
    96181 ctctggagtt agatttgctg caaaccttcc tgatctctcc gacacgatct tcaccagtga
    96241 gaactccaac gttgaccagc ttagccatgg acacagcaaa ctgctgtctg aatatctgag
    96301 gtgattgctc tgcgaaagtc tttacaagcg gagcagtcct tgggtcctta acaagctcct
    96361 gatcagtcga caaaactccc atatgcttct gaagattaat gtagtactga ttatcgaaca
    96421 ctgctggagt tacagggtcg agatcgacgg tctcagaggc ccagcgacac ctgcgttgca
    96481 agtaatcagc gtattttgcg tcaatcgaag gatctgaacc actggttgcg ttgtagttgt
    96541 aaagcctcga ctggatggtg ccacaggacg cttttccgat ggtgtgggcc ccggaaagga
    96601 caactaggtc gaggacgttg agaccgtatg actgaaacgt ttcgagaagg gcggtaacat
    96661 cacgacggcc tgaagggact ttctctacgt ctctagcgta agagtgtttg gagtcacgac
    96721 gaccgtagac gttgggccag taaggaccac caagttggac ggtggcggca cggctggctg
    96781 atgttaggat gtcggcgcag gatactttgc cggggcatga tttctccatc tcggacttga
    96841 tatcgtcaat tagctcgaag cctcttagtg ttttgctagc cggagatctt ctctctgtcc
    96901 cttcgtagtc tagaagaaca gacgcatcac atccctgaaa gttgtgttaa ttcatgtaca
    96961 aaaatgtcaa gttgttatct tttaaaatgc ataactatat tagatatgcg caaaacactc
    97021 agatgcgttt atacacagaa taaagtgcgc aagtccgtct tcaatattaa gaaacttata
    97081 tctatatact atcaatgttc caagtatggt ctagatagac ggaagaacaa ttctaatctc
    97141 taatagagta atagtgaaac ccatttttag aacaatgtaa atcatatatg aatcaaaaca
    97201 ttggctatat ataattgaac gattaattgc aataccgtga cgccacaatc gtggaagata
    97261 aggcggagga gggcgggacc aagggaagag tcactcttag tccattccct cactttcgta
    97321 acaacgattt tctcaaaatc tggacaaatc ctatcataat aattcaacga taataggttg
    97381 tccaaaggga acaatgactt tgtatcatca tcgtcatcgc ctccgtatcc tcccgctcca
    97441 ggtaagtctt ttcggccagc cgataccggc caagccacga gaactccgag tatgacaacg
    97501 actgagacca cggccaactt cattattttg ctttcttgat atctctctca atttgattgg
    97561 ctttgatgaa tttgtttgat gagaggtgtg ttgtgtagta atttatatat acaattgggt
    97621 ttggaaacta atgtgatgct tttacgtggg aggcacaact ttaagatttg aatattcgag
    97681 tgacttgcct gcatgtcgta tataatgttt atgatatata attttttttt gatcaaatga
    97741 tatatattaa tagtataatt ttaaaaaacc tttttacaag agaaaaaatg atataatgat
    97801 ctttacatta ctgaaatcag ggttttgact tatttggatt agattaattg taaaatttat
    97861 ttgtcaacaa cttccattga tttaattttg tttgtttttt ggtcggttat gtgagactat
    97921 tattatttta ttttgttgtc tacaattaac atacgtatat atacactgga tgatgacatc
    97981 aaagtatgtt ttcgagtaat ccgtaaagca aaatgtgata tatcgaaatt aacaaatttt
    98041 ttgcacaatc attaataatg aatttgctca gatcctctaa caaaaatagc gatattacct
    98101 ctgcacattt tttagcacgg aaaaataggt ccattagaga catgttgaca aaaaaaaaaa
    98161 aacaattcac cataggctac gtttattgaa aattgatgca tctcaacaag ttttcaaacg
    98221 ttcaaatttt gagttttttt gaactataca acaaattctc actagtcaaa accttaaact
    98281 ttttcatata tttttctagt ttttataatt tatatttctt acaaataatt gtagaaaact
    98341 caatttttgg gtcatgaaaa tcgccaacag tgtgaaaaga ggccaaccaa aagcagttga
    98401 ttctctagaa ctcattgtta ataactgaaa tatatgtatg taaactaata tttgctagaa
    98461 ttataaagga gaaaagagta caatcgaagt cggaaccaac gccggccggt cggaaaaatc
    98521 acagaagaaa aatcgtatca atcgcttttt caatcgtcca tcttctttat ctaccggata
    98581 atacttccta atacttaaac tttaagaaaa aagattgtca gctagctata cgaagtgtgg
    98641 aagaatacat tatcacatat gccgcaacta atataaacga tacccagtta cctgaaatat
    98701 atatacgaaa tatatgtcgt atgtgccaat atcatagaca ctaagtctcg attaatcggt
    98761 cgttttactc tatcgttgac taatcgttaa ctcatcggga tccgaaaatg atcggttgtg
    98821 aaccttatta ttggtttcaa ttatcgttat tttgtataga gactattttt tcttaaatcg
    98881 ttttataaga gtcacaaatc acaactcgtc ctaagttctc tctctattcg actaacccaa
    98941 gcacgacatt gaccactatg cctgggccta ttgaccacac tacaataaaa tcgcacacta
    99001 catgaaactt gggttgaaca tctaattttc tctaattaaa ttatttttac tttgcttaaa
    99061 agtttttgtt cctgtcagtt atacaattta aaattgtttg ttatctttag ttcttcaatt
    99121 tgatttatga tgtggcataa aatccagaaa gtgcatggtt cccactcgac aacggctaaa
    99181 ttcctcaacg gctccttttt gactctagca tatttaggag ccttaattat taaataattt
    99241 aatcaccctt taattagtat aacaatccaa tgttaatttt ttcatgcatt acacaattaa
    99301 atgcttttac cagtataatg acatgtgtta tacaatatct ttcaaattca attttgtcca
    99361 aaattataag tagctttttt atttttctat aacaatttat cacttttggc cacataaggc
    99421 ttttctttct ctgtattctt acacctcatt ctttattgcc ttgttttaca gacacgttcc
    99481 ccagtttaag ggacaaaaca gagccatttt aggactctta acatttataa gtcctcttac
    99541 taaatagata agcacaaata ctgtttggtt ctgttttgct tcttcatcat catcgtatct
    99601 ccaccgtttg tttgttgttg ttctgtttct ttaacaggaa aaaaaaacag agagaaaaat
    99661 ctgtctcttc actaacacaa atccattttc tcttcttctt gtagagagac agagaaaaca
    99721 gagttgtcct ctaacttctt tcgatcgatt caaaaactct aatgattatt tgattttatg
    99781 ttcgtttgtt cgattcttag atcgtaaaaa aatggtgtct tctcctcaga gattcggttt
    99841 aatcttaaga gatcgtaacc aaaacgctgg cgtttttcaa aagaatctga aatctccggt
    99901 gaaagaggtt ttgaaatctc atgtctccga tgagaattta gttgattctt ggatcgaaac
    99961 tcacaataac aagaacaatc gtgttcttga atctccgtta gaatcgaaga gaaacgacaa
   100021 tcttgtggct tcttctttgg ttcagatatg ggaggcgagg ctaaaccgat ccaacggtgg
   100081 aaactcgccg agtagcagtc aatctacggc gagtagtagt agtcggagcg attcaggagt
   100141 tagtgttcaa gattccggtc tttcagaatc ttcatcaatc gatggagatt ctgaaattgc
   100201 tgatcgaacg gtggagattg aatctaggtc acatggtttg gtttctgatt ccggagaaag
   100261 taaatgggga cgagtcgctg acctaattcg gaggcttagc aacgaagaca agaaacgaac
   100321 cgctggagat aatggcagcg gcggtggcgg tggactcgag attatcagaa cgccgaggcc
   100381 ttattgcact tcgtcgtcat cggagaaaag taattttccg gtggttagtt tctctccgaa
   100441 gatacgagga cgacaagcgt ttaccgattt tcttatgcaa atggaacgtg atcgccaccg
   100501 tgaattggat tcgctttttg aacgcaacgc agtttctagg tttactcaac gtggtcgtct
   100561 ccaggtaaat tatattttca ctattttgat aaaaataact aacatatttg tgactttatt
   100621 cataatccac taaatggttt ttctaattac attatttaac cagtcaatgc taaggttaag
   100681 gaacctcaat cgctgtcttg tgattcaaga tagaaaccgg tctaacgcaa aaacaaccgg
   100741 attaaaccga attgaatcag gctctgctgt tctgcattta aggttttttc agattctctg
   100801 ttttatgttt tgagtttagt tcttagggtt tactttcttc agattttcaa tctttgattg
   100861 gcaacgcagg gagaaatttc atgcgaacgt agtaaactct gcggctgcaa cagataagag
   100921 gaagaatcat caacgatcca ctgagatgaa caacaaatcc gtagaagaaa cagaaggaac
   100981 tactaccaca agcacgaggt taaaggatgg tggtgttact ctcgaagctt ttttcgcaga
   101041 gcggttgaga ccccgtaacc gcaagataga ggaagcaacg ttatgtaagg aagaagaatc
   101101 tgtaagtgga acagttgatt cacaaaagaa ttgccttcag ctgcaagaaa caagagaagt
   101161 agaagaaact tgcaacgatg gcaagtctga aaagaaagaa gaagaaaata ctagcccgag
   101221 tgaatattta tctcgagaat cgcggttgag acagaatcaa gacgagaaca atgtgggaaa
   101281 gtatatgcaa gaaactcgag aaacagaagg tctagttcat gagagtaatg agatggacca
   101341 gtgccttgat caacaagaaa catcctattt gaatagatgg ggagaacaag aagagtatgc
   101401 agatgagcag tcttattatg gagaatataa cgacgactgg cttagtgaaa tagctaggcc
   101461 tcggagttac tgggaggaat tgaggaagtc acggtacctg gaagtaatga acactaggtc
   101521 tgagaaagat gacatatgca gactccttga gcggtaagta accatcaaaa ttgacaagct
   101581 catgtttctt aatggttaat aactgactaa gaaaatgaat ttccctgctt aatacagaag
   101641 aacggtgaca gatttcctcg acagcgggtt gcgagagaag atcgataatc tcatgatgtc
   101701 ccgtgtacag acacactcgg ataagcactc caaaaaatgg gaattgcaac aagaagaaga
   101761 ggaggaagta aattttgaaa ttgatgaaga aatcaaagaa gagccattaa gaggaggtga
   101821 agagcaagat gatagagatg acttgagcca atcgtcgtct tcacatatat ctgcatcgtc
   101881 tcctgcagga tcatggagtt ctcaagacac tgatgttact tccactcctg ccttggttgt
   101941 tcagaatcct cagtcacctg tgagtgttta tcgatttctt gttatactat agaaactcgc
   102001 aaccgcacta gtggtaaact cattgagccg catataaacg ttttcaggaa atggagctga
   102061 taagcggtat gagatcacag atccaacagc ttcagcaaga aatgtcagta ctacgagatt
   102121 ctgtcaaaac gtgtttagat gctaacgcga gcttgcaaca caaggctcac caagaaaacc
   102181 caatgaaacg aaaatgctgc gtctgcgacg aaacacaggt cgaggcggtt ttgtacaggt
   102241 gtggacatat gtgcatgtgc ctaaaatgtg ccaacgaact acattggagt ggagggaaat
   102301 gtccgatttg cagagctcag attgttgacg ttgttcgtgt catctacgat acaagaaact
   102361 gaaatcaacc gttttgaaaa cgctgaagaa ttc
//