LOCUS       AB734108                2049 bp    mRNA    linear   INV 05-JUN-2018
DEFINITION  Camponotus japonicus CjapMCMCBP mRNA for mini-chromosome
            maintenance complex-binding protein, complete cds.
ACCESSION   AB734108
VERSION     AB734108.1
KEYWORDS    .
SOURCE      Camponotus japonicus
  ORGANISM  Camponotus japonicus
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Holometabola; Hymenoptera; Apocrita;
            Aculeata; Formicoidea; Formicidae; Formicinae; Camponotus.
REFERENCE   1  (bases 1 to 2049)
  AUTHORS   Ishida,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-JUL-2012) to the DDBJ/EMBL/GenBank databases.
            Contact:Yuko Ishida
            Research Institute of Luminous Organisms in Hachijojima; 2749
            Nakanogo, Hachijocho, Hachijo island, Tokyo 100-1623, Japan
REFERENCE   2
  AUTHORS   Ishida,Y., Tsuchiya,W., Fujii,T., Fujimoto,Z., Miyazawa,M.,
            Ishibashi,J., Matsuyama,S., Ishikawa,Y. and Yamazaki,T.
  TITLE     Niemann-Pick type C2 protein mediating chemical communication in
            the worker ant
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 111, 3847-3852 (2014)
  REMARK    DOI:10.1073/pnas.1323928111
COMMENT     
FEATURES             Location/Qualifiers
     source          1..2049
                     /db_xref="taxon:84547"
                     /mol_type="mRNA"
                     /organism="Camponotus japonicus"
                     /tissue_type="antenna"
     CDS             197..1954
                     /codon_start=1
                     /gene="CjapMCMCBP"
                     /product="mini-chromosome maintenance complex-binding
                     protein"
                     /protein_id="BAO48218.1"
                     /transl_table=1
                     /translation="MTSIEVRNWTTEYYVTNQLSCQQMLENSDILKEIPLLNNVQLHD
                     ITDKQLVRFRGMVQDMYDPEYFFKQYEVKNTKTGESDIRCGMYTDAARCLSDEEVFFD
                     SNKNEHSERQTYIVMSIPGLNKWAKEQSKCTETNVQKFNSMTHNDNMKNKRSLDDTDI
                     EKMDCSESVAKKEKILTNDSDMNISNARSKVQSILSEEHILNFPIPIDGGKVCIVKIY
                     DGTILKLNQVIDIIGFISLDPMLNTINCSEDEMNEVNTHNPPASLVPRLHAIKLIALT
                     KSEIVNVPDIISKAQLIRSDLHIMLSQLLFGDHLAADYLICHLLSMIYMRRDFFCLGA
                     FPLNITNFPASRLKTFPKEFYNFLTLLVKKSHFLEVTLENLNELALIPKKDYECNRLT
                     SGILQLSDSTHLVLDETSLSTGELSVTGKENYKALSDLLMFQKLTYDFKYYSMEYETD
                     IPILIFSDVKSFIPCPIQVKLNIDTESETIYSQVIEAAYQYLNDETRLTNIRQYLEVF
                     RHTDFVFNEEITKIIQDDFVEMRSVNKNISMDNLHSLMVFARLMSLSYGQTTLDIECW
                     KKTVQLEMERMSRLPQRGR"
BASE COUNT          769 a          274 c          350 g          656 t
ORIGIN      
        1 gattacctct cataggacat gttataattt atgtcaatat tttgccgcca aatcttacta
       61 cataatttcg gtcgaaggat cgaaaatacg tgaaaattat attttgtttt aaggttttta
      121 atcttcattt atatttaatt aagtttaatt attaatcaaa ataatacggt atatcaagat
      181 aatacgtgtt cttaaaatga catcaattga agtaaggaat tggacaacag aatattatgt
      241 tacaaatcaa ttatcttgtc aacaaatgtt agaaaattca gatatattga aagaaatacc
      301 tttattaaac aatgttcaat tacatgatat cacagataaa caattggtta gatttcgagg
      361 gatggtccag gacatgtatg atcctgaata tttttttaaa caatacgagg tgaaaaatac
      421 caaaactggg gagagtgata ttagatgtgg aatgtacaca gatgcagctc gatgtttgtc
      481 ggatgaagaa gtattttttg attctaacaa gaacgaacat tcggaaagac aaacttacat
      541 tgtaatgtct atacctggct taaacaaatg ggcaaaagaa caaagtaaat gtacagaaac
      601 aaatgtacag aaatttaatt caatgacaca taatgataat atgaagaata aaagaagtct
      661 agatgatact gatattgaga aaatggattg ttcagagtct gttgcaaaaa aagaaaagat
      721 tttgacaaat gatagcgata tgaacataag taatgctcgt tcaaaagttc agagtatact
      781 atcagaagag cacatattaa attttcctat cccgattgat ggaggaaaag tttgcatagt
      841 gaagatttat gatggaacaa ttttaaaatt gaatcaggtt attgatataa taggttttat
      901 atcattggat ccaatgttaa atacaattaa ttgttcagag gacgagatga atgaagtcaa
      961 tactcataat cctccagctt ctttggtacc tcggttacat gcaataaagc tgattgcact
     1021 gacaaaatct gaaattgtaa atgttccaga tatcatatca aaagcgcaac tcatcagaag
     1081 tgatttacac ataatgttga gtcaattatt atttggagat catttagcag cagattattt
     1141 aatatgccac ttactctcta tgatatatat gaggagagat ttcttttgtc ttggtgcatt
     1201 tccactaaat ataacaaatt ttccagctag tagactcaag acatttccaa aagaatttta
     1261 taatttttta acattacttg taaagaaaag tcactttttg gaagtgactt tagaaaattt
     1321 gaatgaatta gctttaattc caaaaaagga ttatgaatgc aacagattga caagtggtat
     1381 tcttcaatta agcgatagta cacatcttgt gttagatgag accagtttaa gcactggtga
     1441 actaagtgtc actggcaagg aaaactataa agctctttcg gatctgctta tgtttcaaaa
     1501 actgacatat gacttcaaat attattcaat ggaatatgaa acagatatcc caattttaat
     1561 tttttctgat gtaaagtcgt ttatcccttg ccctattcaa gttaagctaa atattgatac
     1621 agaatcagaa actatatata gtcaagtaat tgaagctgca tatcagtact taaacgatga
     1681 aactcgatta acgaatattc gccaatactt ggaagtcttt agacatacag attttgtttt
     1741 caacgaagaa atcacaaaaa tcatccaaga tgattttgtt gagatgcgaa gcgtgaataa
     1801 gaatataagt atggataatc tgcactcatt aatggttttt gctagattaa tgtccttatc
     1861 ctatggacag acaacactag atatagaatg ctggaagaaa actgtacaat tggaaatgga
     1921 gagaatgagc aggttaccgc agcgtggaag ataataaatt ctaggggaag aagcaacaca
     1981 agtatttatt ttgtttcata tatgttcata tatgtttttc gaaattatat aatactgata
     2041 aaaaagcta
//