LOCUS AB451439 588 bp mRNA linear HUM 02-SEP-2008 DEFINITION Homo sapiens PDGFA mRNA for platelet-derived growth factor alpha isoform 2 preproprotein, partial cds, clone: FLJ08166AAAF. ACCESSION AB451439 VERSION AB451439.1 KEYWORDS Gateway cloning system. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 588) AUTHORS Kawamura,Y., Nomura,N. and Goshima,N. TITLE Direct Submission JOURNAL Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases. Contact:Naoki Goshima Biomedicinal Information Research Center (BIRC), National Institute of Advanced Industrial Science and Technology (AIST); 2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan REFERENCE 2 AUTHORS Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R., Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T., Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C., Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M., Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K., Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A., Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y., Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T., Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H., Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T., Imai,J.-I., Watanabe,S. and Nomura,N. TITLE Human Protein Factory: an infrastructure to convert the human transcriptome into the in vitro-expressed human proteome of versatile utility JOURNAL Unpublished (2008) COMMENT This human Gateway entry clone was constructed by recombining an attB-attached open reading frame (ORF) fragment with attP sequences of the Gateway donor vector pDONR201. The ORF sequence in the entry clone is flanked with attL1 sequence (100 nt) - spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) - spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the translational initiation codon (ATG) and is also flanked with spacer nucleotides (TATG) - attL2 sequence (99 nt) downstream of the ORF. This is an F-type clone that deletes the stop codon for C-terminal tagged proteins. DNA sequences of the entire ORF and flanking regions were validated by sequencing. Clone structure of the ORF and flanking sequences is as follows: 5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3' TATG acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaac gaacaggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence. attL sequences are described in lower cases). Clone information: http://www.HGPD.jp/ This clone was produced in the "Functional Analysis of Protein and Research Application" project supported by the New Energy and Industrial Technology Development Organization (NEDO), Japan FEATURES Location/Qualifiers source 1..588 /clone="FLJ08166AAAF" /db_xref="H-InvDB:HIT000487652" /db_xref="taxon:9606" /mol_type="mRNA" /note="Vector: pDONR201" /organism="Homo sapiens" CDS 1..>588 /codon_start=1 /gene="PDGFA" /product="platelet-derived growth factor alpha isoform 2 preproprotein" /protein_id="BAG70253.1" /transl_table=1 /translation="MRTLACLLLLGCGYLAHVLAEEAEIPREVIERLARSQIHSIRDL QRLLEIDSVGSEDSLDTSLRAHGVHATKHVPEKRPLPIRRKRSIEEAVPAVCKTRTVI YEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRK KPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR" BASE COUNT 133 a 173 c 182 g 100 t ORIGIN 1 atgaggacct tggcttgcct gctgctcctc ggctgcggat acctcgccca tgttctggcc 61 gaggaagccg agatcccccg cgaggtgatc gagaggctgg cccgcagtca gatccacagc 121 atccgggacc tccagcgact cctggagata gactccgtag ggagtgagga ttctttggac 181 accagcctga gagctcacgg ggtccatgcc actaagcatg tgcccgagaa gcggcccctg 241 cccattcgga ggaagagaag catcgaggaa gctgtccccg ctgtctgcaa gaccaggacg 301 gtcatttacg agattcctcg gagtcaggtc gaccccacgt ccgccaactt cctgatctgg 361 cccccgtgcg tggaggtgaa acgctgcacc ggctgctgca acacgagcag tgtcaagtgc 421 cagccctccc gcgtccacca ccgcagcgtc aaggtggcca aggtggaata cgtcaggaag 481 aagccaaaat taaaagaagt ccaggtgagg ttagaggagc atttggagtg cgcctgcgcg 541 accacaagcc tgaatccgga ttatcgggaa gaggacacgg atgtgagg //