LOCUS       AB451427                1125 bp    mRNA    linear   HUM 02-SEP-2008
DEFINITION  Homo sapiens GPER mRNA for G protein-coupled receptor 30, partial
            cds, clone: FLJ08141AAAF.
ACCESSION   AB451427
VERSION     AB451427.1
KEYWORDS    Gateway cloning system.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1125)
  AUTHORS   Kawamura,Y., Nomura,N. and Goshima,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases.
            Contact:Naoki Goshima
            Biomedicinal Information Research Center (BIRC), National
            Institute of Advanced Industrial Science and Technology (AIST);
            2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan
REFERENCE   2
  AUTHORS   Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R.,
            Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T.,
            Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C.,
            Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M.,
            Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K.,
            Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A.,
            Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y.,
            Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T.,
            Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H.,
            Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T.,
            Imai,J.-I., Watanabe,S. and Nomura,N.
  TITLE     Human Protein Factory: an infrastructure to convert the human
            transcriptome into the in vitro-expressed human proteome of
            versatile utility
  JOURNAL   Unpublished (2008)
COMMENT     This human Gateway entry clone was constructed by recombining an
            attB-attached open reading frame (ORF) fragment with attP
            sequences of the Gateway donor vector pDONR201. The ORF sequence
            in the entry clone is flanked with attL1 sequence (100 nt) -
            spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) -
            spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the
            translational initiation codon (ATG) and is also flanked with
            spacer nucleotides (TATG) - attL2 sequence (99 nt) downstream of
            the ORF. This is an F-type clone that deletes the stop codon for
            C-terminal tagged proteins. DNA sequences of the entire ORF and
            flanking regions were validated by sequencing. Clone structure of
            the ORF and flanking sequences is as follows:
            5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct
            tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3'
            TATG acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaac
            gaacaggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence.
            attL sequences are described in lower cases).
            Clone information: http://www.HGPD.jp/
            This clone was produced in the "Functional Analysis of Protein and
            Research Application" project supported by the New Energy and
            Industrial Technology Development Organization (NEDO), Japan
FEATURES             Location/Qualifiers
     source          1..1125
                     /clone="FLJ08141AAAF"
                     /db_xref="H-InvDB:HIT000487640"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="Vector: pDONR201"
                     /organism="Homo sapiens"
     CDS             1..>1125
                     /codon_start=1
                     /gene="GPER"
                     /product="G protein-coupled receptor 30"
                     /protein_id="BAG70241.1"
                     /transl_table=1
                     /translation="MDVTSQARGVGLEMYLGTAQPAAPNTTSPELNLSHPLLGTALAN
                     GTGELSEHQQYVIGLFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLA
                     VADLILVADSLIEVFNLHERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALA
                     RAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLE
                     VTLGFIVPFAIIGLCYSLIVRVLVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPEN
                     VFISVHLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDK
                     LRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV"
BASE COUNT          184 a          401 c          304 g          236 t
ORIGIN      
        1 atggatgtga cttcccaagc ccggggcgtg ggcctggaga tgtacctagg caccgcgcag
       61 cctgcggccc ccaacaccac ctcccccgag ctcaacctgt cccacccgct cctgggcacc
      121 gccctggcca atgggacagg tgagctctcg gagcaccagc agtacgtgat cggcctgttc
      181 ctctcgtgcc tctacaccat cttcctcttc cccatcggct ttgtgggcaa catcctgatc
      241 ctggtggtga acatcagctt ccgcgagaag atgaccatcc ccgacctgta cttcatcaac
      301 ctggcggtgg cggacctcat cctggtggcc gactccctca ttgaggtgtt caacctgcac
      361 gagcggtact acgacatcgc cgtcctgtgc accttcatgt cgctcttcct gcaggtcaac
      421 atgtacagca gcgtcttctt cctcacctgg atgagcttcg accgctacat cgccctggcc
      481 agggccatgc gctgcagcct gttccgcacc aagcaccacg cccggctgag ctgtggcctc
      541 atctggatgg catccgtgtc agccacgctg gtgcccttca ccgccgtgca cctgcagcac
      601 accgacgagg cctgcttctg tttcgcggat gtccgggagg tgcagtggct cgaggtcacg
      661 ctgggcttca tcgtgccctt cgccatcatc ggcctgtgct actccctcat tgtccgggtg
      721 ctggtcaggg cgcaccggca ccgtgggctg cggccccggc ggcagaaggc gctccgcatg
      781 atcctcgcag tggtgctggt cttcttcgtc tgctggctgc cggagaacgt cttcatcagc
      841 gtgcacctcc tgcagcggac gcagcctggg gccgctccct gcaagcagtc tttccgccat
      901 gcccaccccc tcacgggcca cattgtcaac ctcgccgcct tctccaacag ctgcctaaac
      961 cccctcatct acagctttct cggggagacc ttcagggaca agctgaggct gtacattgag
     1021 cagaaaacaa atttgccggc cctgaaccgc ttctgtcacg ctgccctgaa ggccgtcatt
     1081 ccagacagca ctgagcagtc ggatgtgagg ttcagcagtg ccgtg
//