LOCUS       AB290160                9310 bp    mRNA    linear   HUM 02-FEB-2008
DEFINITION  Homo sapiens mRNA for MYO5B/KIAA1119 variant protein, complete cds.
ACCESSION   AB290160
VERSION     AB290160.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 9310)
  AUTHORS   Kikuno,R.F., Yamakawa,H., Nagase,T. and Ohara,O.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-JAN-2007) to the DDBJ/EMBL/GenBank databases.
            Contact:Hisashi Yamakawa
            Kazusa DNA Research Institute, Department of Human Gene Research;
            2-6-7   Kazusa-kamatari, Kisarazu, Chiba 292-0818, Japan
REFERENCE   2
  AUTHORS   Yamakawa,H., Kikuno,R.F., Nagase,T. and Ohara,O.
  TITLE     Multiplex amplification and cloning of 5'-ends of cDNA by
            ligase-free recombination: Preparation of full-lemgth cDNA clones
            encoding motor proteins
  JOURNAL   Unpublished (2007)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..9310
                     /clone="hf00569y2"
                     /db_xref="H-InvDB:HIT000409105"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /organism="Homo sapiens"
                     /tissue_type="brain"
     CDS             106..5655
                     /codon_start=1
                     /note="myosin VB, MYO5B variant"
                     /product="MYO5B variant protein"
                     /protein_id="BAG06714.1"
                     /transl_table=1
                     /translation="MSVGELYSQCTRVWIPDPDEVWRSAELTKDYKEGDKSLQLRLED
                     ETILEYPIDVQRNQLPFLRNPDILVGENDLTALSYLHEPAVLHNLKVRFLESNHIYTY
                     CGIVLVAINPYEQLPIYGQDVIYAYSGQNMGDMDPHIFAVAEEAYKQMARDEKNQSII
                     VSGESGAGKTVSAKYAMRYFATVGGSASETNIEEKVLASSPIMEAIGNAKTTRNDNSS
                     RFGKYIQIGFDKRYHIIGANMRTYLLEKSRVVFQADDERNYHIFYQLCAAAGLPEFKE
                     LALTSAEDFFYTSQGGDTSIEGVDDAEDFEKTRQAFTLLGVKESHQMSIFKIIASILH
                     LGSVAIQAERDGDSCSISPQDVYLSNFCRLLGVEHSQMEHWLCHRKLVTTSETYVKTM
                     SLQQVINARNALAKHIYAQLFGWIVEHINKALHTSLKQHSFIGVLDIYGFETFEVNSF
                     EQFCINYANEKLQQQFNSHVFKLEQEEYMKEQIPWTLIDFYDNQPCIDLIEAKLGILD
                     LLDEECKVPKGTDQNWAQKLYDRHSSSQHFQKPRMSNTAFIIVHFADKVEYLSDGFLE
                     KNRDTVYEEQINILKASKFPLVADLFHDDKDPVPATTPGKGSSSKISVRSARPPMKVS
                     NKEHKKTVGHQFRTSLHLLMETLNATTPHYVRCIKPNDEKLPFHFDPKRAVQQLRACG
                     VLETIRISAAGYPSRWAYHDFFNRYRVLVKKRELANTDKKAICRSVLENLIKDPDKFQ
                     FGRTKIFFRAGQVAYLEKLRADKFRTATIMIQKTVRGWLQKVKYHRLKGATLTLQRYC
                     RGHLARRLAEHLRRIRAAVVLQKHYRMQRARQAYQRVRRAAVVIQAFTRAMFVRRTYR
                     QVLMEHKATTIQKHVRGWMARRHFQRLRDAAIVIQCAFRMLKARRELKALRIEARSAE
                     HLKRLNVGMENKVVQLQRKIDEQNKEFKTLSEQLSVTTSTYTMEVERLKKELVHYQQS
                     PGEDTSLRLQEEVESLRTELQRAHSERKILEDAHSREKDELRKRVADLEQENALLKDE
                     KEQLNNQILCQSKDEFAQNSVKENLLMKKELEEERSRYQNLVKEYSQLEQRYDNLRDE
                     MTIIKQTPGHRRNPSNQSSLESDSNYPSISTSEIGDTEDALQQVEEIGLEKAAMDMTV
                     FLKLQKRVRELEQERKKLQVQLEKREQQDSKKVQAEPPQTDIDLDPNADLAYNSLKRQ
                     ELESENKKLKNDLNELRKAVADQATQNNSSHGSPDSYSLLLNQLKLAHEELEVRKEEV
                     LILRTQIVSADQRRLAGRNAEPNINARSSWPNSEKHVDQEDAIEAYHGVCQTNSKTED
                     WGYLNEDGELGLAYQGLKQVARLLEAQLQAQSLEHEEEVEHLKAQLEALKEEMDKQQQ
                     TFCQTLLLSPEAQVEFGVQQEISRLTNENLDLKELVEKLEKNERKLKKQLKIYMKKAQ
                     DLEAAQALAQSERKRHELNRQVTVQRKEKDFQGMLEYHKEDEALLIRNLVTDLKPQML
                     SGTVPCLPAYILYMCIRHADYTNDDLKVHSLLTSTINGIKKVLKKHNDDFEMTSFWLS
                     NTCRLLHCLKQYSGDEGFMTQNTAKQNEHCLKNFDLTEYRQVLSDLSIQIYQQLIKIA
                     EGVLQPMIVSAMLENESIQGLSGVKPTGYRKRSSSMADGDNSYCLEAIIRQMNAFHTV
                     MCDQGLDPEIILQVFKQLFYMINAVTLNNLLLRKDVCSWSTGMQLRYNISQLEEWLRG
                     RNLHQSGAVQTMEPLIQAAQLLQLKKKTQEDAEAICSLCTSLSTQQIVKILNLYTPLN
                     EFEERVTVAFIRTIQAQLQERNDPQQLLLDAKHMFPVLFPFNPSSLTMDSIHIPACLN
                     LEFLNEV"
BASE COUNT         2756 a         2132 c         2130 g         2292 t
ORIGIN      
        1 gaaactccag gccagcccgg gaacatggcg ccaggcgggc cagccgcgga ctgagagccg
       61 cggggcagcc aggagccggg gcccgagccc cgcccggccc gggccatgtc ggtgggcgag
      121 ctctacagcc agtgcacaag ggtctggatc cctgaccctg atgaggtatg gcgctcagct
      181 gagttaacca aggactacaa agaaggagac aagagcctac agctcagact ggaggatgaa
      241 acgattctgg aatacccaat tgatgtacaa cgcaaccagc tgcccttctt acggaatcca
      301 gatatcttgg tgggagaaaa tgacctgact gcccttagct atcttcatga gcctgcagtt
      361 ttgcataatt tgaaggtccg tttcctggag tccaaccata tctacactta ctgtggtatc
      421 gtacttgttg ccattaatcc ttatgaacag ttgccaatct atggacaaga tgtcatctat
      481 gcctacagtg gccaaaacat gggagacatg gacccccaca tctttgctgt ggcagaagaa
      541 gcctacaagc agatggccag agatgagaag aatcagtcca tcatagtcag tggggagtct
      601 ggagccggga agacggtatc agccaagtat gccatgcgct atttcgccac cgttggtggc
      661 tcggccagtg aaaccaacat cgaagagaag gtgctggcat ccagtcccat catggaggcc
      721 attggaaatg ccaagaccac ccgcaatgac aacagcagcc gttttggcaa gtacatccag
      781 attggctttg acaaaaggta ccacatcatc ggggccaaca tgaggactta cctcttggag
      841 aagtccagag tggtcttcca ggcagatgat gagaggaatt accacatctt ttaccagctc
      901 tgtgctgctg ccggtcttcc agaatttaaa gagcttgcac taacaagtgc agaggacttt
      961 ttctatacat cacagggagg agacacttcc atcgagggtg tggacgatgc tgaggacttt
     1021 gagaagactc gacaagcctt cacactcctc ggagtgaaag agtcccatca gatgagcatt
     1081 tttaagataa ttgcttctat cttgcacctt ggaagtgtgg cgattcaggc tgagcgtgat
     1141 ggtgattcct gtagtatatc accccaggat gtatacctaa gcaacttctg ccgactgcta
     1201 ggggtggagc acagtcagat ggagcactgg ctgtgtcatc gcaagctggt caccacctcg
     1261 gagacctacg tcaagaccat gtccctgcag caggtgatca atgcgcgcaa cgccctggcg
     1321 aagcacatct atgcccagtt gttcggctgg attgtggagc acatcaacaa ggccctgcac
     1381 acctccctca agcagcactc cttcatcggg gtcctggaca tctatgggtt tgagacattt
     1441 gaggtaaaca gctttgagca gttctgtatc aactatgcaa atgaaaagct ccagcagcag
     1501 ttcaactcgc atgttttcaa actggagcaa gaagaataca tgaaggaaca gatcccttgg
     1561 accctgattg atttttatga taaccaacct tgtatcgacc tcattgaagc caagctgggt
     1621 atcttggacc tgttggatga agaatgtaag gtccccaaag gaactgacca gaactgggct
     1681 cagaagctct atgaccggca ctccagcagc cagcacttcc agaagccccg catgtccaac
     1741 acggccttca tcatcgtcca ctttgcagac aaggtggagt acctctctga tggttttctg
     1801 gagaaaaaca gagacacggt gtatgaagag cagatcaata tcctgaaggc cagcaagttc
     1861 ccactagtgg ctgacttgtt tcatgatgac aaggaccctg ttcctgccac cacccctggg
     1921 aaggggtcat cttcgaagat cagcgtccgt tctgccagac cccccatgaa agtctccaac
     1981 aaggagcaca agaaaaccgt tggccaccag ttccgtacct ccctgcatct gctcatggag
     2041 accctgaatg ccacgacacc tcactatgtc cgctgcatca agcccaacga tgagaagctc
     2101 ccctttcact ttgacccaaa gagagcagtg cagcaactca gagcctgcgg ggtgttggag
     2161 acgattcgaa tcagtgcagc tggctaccca tccaggtggg cctaccatga ctttttcaac
     2221 cggtatcggg tgctggtcaa gaagagagag ctcgccaaca cagacaaaaa ggccatctgc
     2281 aggtctgtcc tggagaacct catcaaggac cccgacaagt tccagtttgg ccgcaccaag
     2341 atcttctttc gagcaggcca ggtggcctac ctggagaagc tgcgggctga caagttccgg
     2401 acagccacca tcatgatcca gaaaactgtc cggggatggc tgcagaaggt gaaatatcac
     2461 aggctgaagg gggctacctt aaccctgcag aggtactgcc ggggacacct ggcccgcagg
     2521 ctggctgagc acctgcggag gatcagagcg gctgtggtgc tccagaaaca ttaccgcatg
     2581 cagagggccc gccaggccta ccagagggtc cgcagagctg ccgttgttat ccaggccttc
     2641 acccgggcca tgtttgtgcg gagaacctac cgccaggtcc tcatggagca caaggccacc
     2701 accatccaga agcacgtgcg gggctggatg gcacgcaggc acttccagcg gctgcgggat
     2761 gcagccattg tcatccagtg tgccttccgg atgctcaagg ccaggcggga gctgaaggcc
     2821 ctcaggattg aggcccgctc agcagagcat ctgaaacgtc tcaacgtggg catggagaac
     2881 aaggtggtcc agctgcagcg gaagatcgat gagcagaaca aagagttcaa gacactttca
     2941 gagcagttgt ccgtgaccac ctcaacatac accatggagg tagagcggct gaagaaggag
     3001 ctggtgcact accagcagag cccaggtgag gacaccagcc tcaggctgca ggaggaggtg
     3061 gagagcctgc gcacagagct gcagagggcc cactcggagc gcaagatctt ggaggacgcc
     3121 cacagcaggg agaaagatga gctgaggaag cgagttgcag acctggagca agaaaatgct
     3181 ctcttgaaag atgagaaaga acagctcaac aaccaaatcc tgtgccagtc taaagatgaa
     3241 tttgcccaga actctgtgaa ggaaaatctc ctcatgaaga aagaactgga ggaggagcga
     3301 tcccggtacc agaaccttgt gaaggaatat tcacagttgg agcagagata cgacaacctt
     3361 cgggatgaaa tgaccatcat aaagcaaact ccaggtcata ggcggaaccc atcaaaccaa
     3421 agtagcttag aatctgactc caattacccc tccatctcca catctgagat cggagacact
     3481 gaggatgccc tccagcaggt ggaggaaatt ggcctggaga aggcagccat ggacatgacg
     3541 gtcttcctga agctgcagaa gagagtacgg gagctggagc aggagaggaa aaagctgcaa
     3601 gtgcagctgg agaagagaga acagcaggac agcaagaaag tccaggcgga accaccacag
     3661 actgacatag atttggaccc gaatgcagat ctggcctata atagtctgaa gaggcaagag
     3721 ctggagtcag agaacaaaaa gctgaagaat gacctgaatg agctgaggaa agccgtggcc
     3781 gaccaagcca cgcagaataa ctccagccac ggctccccag atagctacag cctcctgctg
     3841 aaccagctca agctggccca cgaggagctc gaggtgcgca aggaggaggt gctcatcctc
     3901 aggacccaga tcgtgagcgc cgaccagcgg cgactcgccg gcaggaacgc ggagccgaac
     3961 attaatgcca gatcaagttg gcctaacagt gaaaagcatg ttgaccagga ggatgccatt
     4021 gaggcctatc acggggtctg ccagacaaac agcaagactg aggattgggg atatttaaat
     4081 gaagatggag aactcggctt ggcctaccaa ggcctaaagc aagttgccag gctgctggag
     4141 gctcagctgc aggcccagag cctggagcat gaggaggagg tggagcatct caaggctcag
     4201 ctcgaggccc tgaaggagga gatggacaaa cagcagcaga ccttctgcca gacgctactg
     4261 ctctccccag aggcccaggt ggaattcggc gttcagcagg aaatatcccg gctgaccaac
     4321 gagaatctgg accttaaaga actggtagaa aagctggaaa agaatgagag gaagctcaaa
     4381 aagcaactga agatttacat gaagaaagcc caggacctag aagctgccca ggcattggcc
     4441 cagagtgaga ggaagcgcca tgagctcaac aggcaggtca cggtccagcg gaaagagaag
     4501 gatttccagg gcatgctgga gtaccacaaa gaggacgagg ccctcctcat ccggaacctg
     4561 gtgacagact tgaagcccca gatgctgtcg ggcacagtgc cctgtctccc cgcctacatc
     4621 ctctacatgt gcatccggca cgcggactac accaacgacg atctcaaggt gcactccctg
     4681 ctgacctcca ccatcaacgg cattaagaaa gtcctgaaaa agcacaatga tgactttgag
     4741 atgacgtcat tctggttatc caacacctgc cgccttcttc actgtctgaa gcagtacagc
     4801 ggggatgagg gcttcatgac tcagaacact gcaaagcaga atgaacactg tcttaagaat
     4861 tttgacctca ccgaataccg tcaggtgctg agtgaccttt ccattcagat ctaccagcag
     4921 ctcattaaaa ttgccgaggg cgtgttacag ccgatgatag tttctgccat gttggaaaat
     4981 gagagcattc agggtctatc tggtgtgaag cccaccggct accggaagcg ctcctccagc
     5041 atggcagatg gggataactc atactgcctg gaagctatca tccgccagat gaatgccttt
     5101 catacagtca tgtgtgacca gggcttggac cctgagatca tcctgcaggt attcaaacag
     5161 ctcttctaca tgatcaacgc agtgactctt aacaacctgc tcttgcggaa ggacgtctgc
     5221 tcttggagca caggcatgca actcaggtac aatataagtc agcttgagga gtggcttcgg
     5281 ggaagaaacc ttcaccagag tggagcagtt cagaccatgg aacctctgat ccaagcagcc
     5341 cagctcctgc aattaaagaa gaaaacccag gaggacgcag aggctatctg ctccctgtgt
     5401 acctccctca gcacccagca gattgtcaaa attttaaacc tttatactcc cctgaatgaa
     5461 tttgaagaac gggtaacagt ggcctttata cgaacaatcc aggcacaact acaagagcgg
     5521 aatgaccctc agcaactgct attagatgcc aagcacatgt ttcctgtttt gtttccattt
     5581 aatccatctt ctctaaccat ggactcaatc cacatcccag cgtgtctcaa tctggaattc
     5641 ctcaatgaag tctgaagatg catgtttcca gcattagttt gattcccaat gtgagcaaga
     5701 aggaagtata tacagtaaag taaattcaag gatctgttaa atctggtaaa agtagatcaa
     5761 atcagagatt gacagcctgt ggagggtgct gaactataca gaattagaca caactatgtc
     5821 attatttttt gtacctactg ctcagaataa aaacacttga aatatggaag attttaagtt
     5881 tgatttcagt ccaacacata tacataattt atagacacca agcagtcccc atagacatat
     5941 aaaaggtgtc aattctataa aacgaagctg cctagttttg atctttgcat agaactagag
     6001 aatgtccaaa ttaaaatacc aaatatatat aagtcacata aattgccttc aaagggcttt
     6061 aacaaataat ggtactaata accatgataa tggcatatac tgacatttcc caaagtttgc
     6121 aaaccatagg tgtggttgag tttgtggtga gatgttttaa gaacaaaaat atggggatga
     6181 gacttctgag aaatattccc aaaatatttt ttaatggctg attatacaca gacagtggtg
     6241 taactgacct ccagaccaga cattttgagt actggtttct gaagcaaaat tagaagtgcc
     6301 agtcctcagt gtgctcaaac gcttttgtgt tatcttgatt taatggaaga gattattaaa
     6361 atgctgctat cccaaactcc aagtgagaaa gatggaaaaa tattttgttt ctgatgctag
     6421 tccatacact ttccaagtcc cacaaaactt tcacaaaaat gtatataagc taaatattag
     6481 aaacggataa caaacttgtt ttatttatag atgtaaaaac caaacaagtc aatatgaaag
     6541 cttttaatct cttaatacca ttaagcttcc agtaagagca tcacataatg ctctactgtt
     6601 ccagaaacca aatagtaaat caaactaaag ttcgcacatc agatcatctg aaaaaccttc
     6661 aaaaataatc agttcaggga tattatacaa aagtttgggt tttttttttt taagagaata
     6721 aaatggctta ggtcaacttt cccttttcag gttattttca acgtttttca aatttagcac
     6781 acaaaaaatt gtaaatatct ctcccacaaa ataaggattt taaaaaagta attcagtaat
     6841 ataacaggct tagatgtttg ctgctcttag aatttttttt aacttgtttt tggtttcttc
     6901 aaaagcaagc attcaattgg aaacccatat tctttccaca ctttttttta ctgtcttttc
     6961 tgtatttctt gatagcagta tgctgttccc ataagaaaaa aatggtattt gcaaatcatg
     7021 gaagaacagc ctctgtatta cattgagaaa ataagattta tccatgaatt ggaagtagaa
     7081 cagcctgcct tcaccctctt ttactcaacc acccaactta aaaggctctt ggaaacacag
     7141 cacactccac gctaccttct gcactgtgcc cttagagcac agcttcctca gttgttctct
     7201 gcatctcctg gggcttaggc cagtcttagc ctgggttaag gctgctgaca ttgtgttcca
     7261 atcagttgtc atgggcatta tcccctctac atccacatta aacatgccgg cttctcttgg
     7321 gcatcggcag agctgtgcct ttttctttca gttacagtta cataatcact gacgtccatg
     7381 acacttaccc atggatccat gtgctgactt catttagaag gccaatctaa aacaactggg
     7441 tttgtggcta cctctttaaa gttgtttgtg aaggataatt tgttttttaa tgcactttag
     7501 tttgaaagtg agtctcttat gtaaggacca tccttaaaag accaaaaatg ccttgttaga
     7561 gtgttaagga gttttcacat gcagtggttc cacaaacaca gtggcttact atccttatac
     7621 actgtcttat accatcattc tctccatctc tcttggtcac tactctctgc tgtcactggt
     7681 taatcactag gtgccaagag cttactgaat aaaagcttgg caattagaat aaatggggag
     7741 ggaaggacct tatgaatagt ccatttagcc taagaaatgg cagatttagt tcttctcttc
     7801 caaaagataa aggtatatcc tggaattgta cttaaaactt acagatgact aacaaatata
     7861 tactttatat gtagttaata tttagatctg tcttatttaa tacttggagg ctagaagaag
     7921 catctttagg ggaactatat aatcttttgt tagcattttc tctgcatttt aaaaaatcat
     7981 ttcaattcaa acatttatca gtgtcatgaa atcagtaatg actctttaac aattcaggtt
     8041 tgaactctgc attagatgtc tctttaattt tttaatattt aaaatttagt tgacattttt
     8101 ttcaccaggt gcctttagcg gttactaaga taactgacat cagttgtttc tctgaaataa
     8161 gtgttgctgt gggaataatt ttaatgttca aggtgatatc atgggggagt tttgtctttt
     8221 aaaacattag aagcatttta aatattaaga atcaaatatt tatagatcaa aacttgtgtt
     8281 ttaagtatta tacgggacct gtttacttat agtaaatgtg aatgtacaca tgagttgttg
     8341 ctgaagctga caagcatatt acatacatgc attttccctg tgccctcata gttgcagtta
     8401 gagttccagt acctgtaggc tcacctggga ggcagattag acccaaaggt agatgttttt
     8461 cccctttcca tgaagcatgt cagtgggagt tgcttccttt gatttcccta gtactaaatt
     8521 ttaaggcttt tgtaaaaaca aaacaaaact aggagcttgg aacagttaaa aatcaacact
     8581 gctaccatca attcatcaaa tatttactta gagctttcat acattaagat tccagtaacc
     8641 aataaattag aattcatttc ttctgcataa agtaaatttt catacacttg acctactaag
     8701 acagcaaggg tgtcctaaat tgaggcattt gtataatgcc tgcataacta aatggtcact
     8761 aaaatgggac agcatggggc aagaccttgt agttcttcac agaatatttg tggtcagttt
     8821 ctccaattaa tttgctgcat gagccaaata accataattc actttttata cccactggtg
     8881 ccataattag agaattagag ggtgtagaca gaggttaatg ccaatgagaa acacaggaca
     8941 gggttttttt tattataaag gtcattagat acaaaagatt gtttttcaaa aaatttctaa
     9001 ttctaacaaa ggggatcaat cagaaatgaa actaagctac tttctaaagt gacactgtat
     9061 cagaataatc cagatttgaa tataacattt tgccaccaac tgacatttag atgaaggact
     9121 gcctctctga aagagttcag atcatattca ggggtgaatc caacaccatg gaagaaagac
     9181 tactgatgaa aatattttcc cactttgcac aaatctgtaa actacacctt tgtttataga
     9241 aaaatgcttg taatagtcac tgtaatattt agctgtggat aaaaatttgt ggaaataaat
     9301 acttttgaat
//