LOCUS       AB262552                2531 bp    DNA     linear   PLN 15-AUG-2009
DEFINITION  Ligusticum sinense chloroplast trnK, matK genes for tRNA-Lysine,
            maturase, partial and complete cds.
ACCESSION   AB262552
VERSION     AB262552.1
KEYWORDS    .
SOURCE      chloroplast Ligusticum sinense
  ORGANISM  Ligusticum sinense
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; campanulids; Apiales; Apiaceae; Apioideae;
            Acronema clade; Ligusticum.
REFERENCE   1  (bases 1 to 2531)
  AUTHORS   Zhu,S., Fushimi,H. and Komatsu,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-JUN-2006) to the DDBJ/EMBL/GenBank databases.
            Contact:Katsuko Komatsu
            Institute of Natural Medicine, University of Toyama, Division of
            Pharmacognosy, Department of Medicinal Resources; Sugitani 2630,
            Toyama, Toyama 930-0194, Japan
REFERENCE   2
  AUTHORS   Zhu,S., Fushimi,H., Han,G., Tsuchida,T., Uno,T., Takano,A. and
            Komatsu,K.
  TITLE     Molecular Identification of "Chuanxiong" by Nucleotide Sequence and
            Multiplex Single Base Extension Analysis on Chloroplast trnK Gene
  JOURNAL   Biol. Pharm. Bull. 30, 527-531 (2007)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..2531
                     /cultivar="Chuanxiong"
                     /db_xref="taxon:49555"
                     /mol_type="genomic DNA"
                     /note="synonym: Ligusticum chuanxiong"
                     /organelle="plastid:chloroplast"
                     /organism="Ligusticum sinense"
                     /PCR_primers="fwd_name: trnK3914F, fwd_seq:
                     TGGGTTGCTAACTCAATGG, rev_name: trnK2R, rev_seq:
                     AACTAGTCGGATGGAGTAG"
     tRNA            <1..19
                     /gene="trnK"
                     /note="5' exon of transfer RNA for Lysine"
                     /product="tRNA-Lysine"
     intron          20..>2531
                     /gene="trnK"
                     /note="intron of trnK gene"
     CDS             757..2274
                     /codon_start=1
                     /gene="matK"
                     /note="It is an open reading frame (ORF) located within
                     the intron of the transfer RNA gene for Lysine (trnK)"
                     /product="maturase"
                     /protein_id="BAF50736.1"
                     /transl_table=11
                     /translation="MEEFQRYLKLNISQQHYFLYPLIFQEYIYALAHDHGLNRNRSVL
                     LENAGYNKFSLLIVKRAIERMYQYEQNHLILFANDFTQNTFFGRNKNFNFQMISEGFA
                     VIVEIPFYLRLLFSIERKGIVKSHNLRSIHSIFPFLEDKFSHLIYVLEILIPYPVHLE
                     ILVQTLRYWVKDASSLHLLRFFLHEYRIWNTPNKASSCFSKRNQRFFFVLYNSHLCEY
                     ESIFVFLRNKSSHLCSTSSGTLLERIFFYGKLEHLGLVEAFAKAFQDSLWLFKDPLMH
                     YISYQGKSILASKGTPLLMKKWTYFFVNLWKCHFYLWSQPGRICINQLYNHSLALLGY
                     LSSARLNPSMVRSQMLENAFIIDNPINKFDTLVPIVPLIGSLAKARFCNVLGHPISKA
                     VWTDLSDSDIVVRFGRICRNISHYYSGSSQKKSLYRIKYILRLSCARTLARKHKSTVR
                     AFFKRSGSGLLEEFFTAEEQVLYLTFPRASSTSQRLYRRRIWYLDIICINDLASY"
BASE COUNT          798 a          402 c          461 g          870 t
ORIGIN      
        1 tagagtacac ggcttttaag tgcggctagg atcttttaca catttggatg aagcgaggga
       61 ttcgtccata ccatcggtaa agtttggaag accacgactg atcctgaaag ggaatgaatg
      121 gaaaaaatag catgtcggat caacgaagag ttctgagaat atttcattct ttccgaatcg
      181 gtacaaaccg ttgtgttctt ttttgaaacg gaacaaaatg aattcaattt caagttgggt
      241 cggatgaata aatggatata gagccctaat ggcttcaatt tatttattta ttgatatgat
      301 tattgattat agggaaaaag caacgagctt ctgttcttaa tttgaacgat tacccgatct
      361 aattagacgt taaaaatgta ttagtgcctg atacgggaag ggattatccc atgaacgaat
      421 tctttatatt ttaatgaatc ctaactattg acattttcca ttatggaata gaaatgtgtg
      481 tgtagaagaa acagtatatt gataaaaaaa ttccaaaatc aaaagagcga ttaggttgaa
      541 aaaataaagg atttctaagt cttttgttat cctataacga acataaactt attcgtttaa
      601 atggaaaaga gaggatagat aatccgttga taagtttacc tgtatccccg aggtatctat
      661 tcgtttatta ctcgaatacc tcgttttgac tgtatcgcac tatgtttcat tgataacccc
      721 caaaatcctc tacccttagt tcaactagaa tttcaaatgg aggaattcca aagatattta
      781 aagctaaata tatctcaaca acactacttc ttatatccac ttatctttca ggagtatatt
      841 tatgcacttg cgcatgatca tggtttaaat agaaatagat ccgttttgtt ggaaaatgca
      901 ggttataata agttcagctt actaattgtg aaacgtgcaa ttgagcgaat gtatcagtat
      961 gaacagaatc atttgattct ttttgctaat gattttaccc aaaatacctt ttttgggcgc
     1021 aacaagaatt ttaattttca aatgatatca gaaggatttg cagtcattgt agaaattccg
     1081 ttttatctcc gattattatt ttcgatagaa aggaaaggaa tagttaaatc tcataattta
     1141 cgatcaattc attcaatatt ccctttttta gaggacaaat tttcacattt aatttatgtg
     1201 ttagagatac taatacccta cccagtccat ctggaaatat tggttcaaac tcttcgctac
     1261 tgggtaaaag acgcttcttc tttacattta ttaagattct ttctccacga gtatcgtatt
     1321 tggaatactc caaataaagc cagttcttgt ttttcaaaaa gaaatcaaag gtttttcttc
     1381 gtcctatata attctcatct atgtgaatac gaatccatct tcgtctttct tcgtaacaaa
     1441 tcttctcatt tatgctcaac gtcttctgga acccttcttg aacgaatctt tttctatgga
     1501 aaactagaac atcttggact tgtagaagct tttgctaagg cctttcagga cagtctatgg
     1561 ttgtttaagg accctttgat gcattatatt agttatcaag gaaaatcaat tctcgcttca
     1621 aaagggacgc cccttttgat gaaaaaatgg acatattttt ttgtcaattt atggaaatgt
     1681 catttttacc tatggtctca gccgggacgg atctgtataa accaattata taatcattcc
     1741 ctagctcttc tgggctatct atcaagtgcg cgactaaacc cttcaatggt acgcagtcaa
     1801 atgctagaaa atgcatttat aattgataat cctattaata agttcgatac tcttgttcca
     1861 attgttcctc taattggatc attggctaag gcgagatttt gtaacgtatt ggggcaccct
     1921 attagtaagg cggtttggac tgatttatca gattctgata ttgttgtccg atttgggcgt
     1981 atctgcagaa atatttctca ttattatagt ggatcctcac aaaaaaagag tttgtatcga
     2041 ataaagtata tacttcgact gtcttgtgct agaactttgg ctcgtaaaca taaaagtact
     2101 gtacgtgctt tttttaaaag atcgggctcg gggttattgg aagaattctt tacggcggaa
     2161 gagcaagtcc tttatttgac ctttccaaga gcttcttcca cttcgcagag gttatataga
     2221 aggcgtattt ggtatttgga tattatttgt atcaatgatt tggccagtta ttaattgaat
     2281 gattcgttag gaaatcatgt aaattgtcac taaaaatgta ggtaatgaag ataaaaaatg
     2341 aagataacaa tttttttttc tgaaatgttg atgtaggatg tagtaagggt taaatcaacc
     2401 gagtattcaa cttttttaaa gttctaagta agaaaccggg ttttaaatgt atacataggg
     2461 aaagccgtgt gcaatgaaaa atgcaagcac ggtttgggga ggggtgttta cctatttaac
     2521 aggtaaatta t
//