LOCUS       AB237163              119746 bp    DNA     linear   BCT 14-AUG-2019
DEFINITION  Pseudomonas syringae pv. actinidiae argK-tox gene cluster,
            complete cds.
ACCESSION   AB237163
VERSION     AB237163.1
KEYWORDS    .
SOURCE      Pseudomonas syringae pv. actinidiae
  ORGANISM  Pseudomonas syringae pv. actinidiae
            Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
            Pseudomonadaceae; Pseudomonas; Pseudomonas syringae.
REFERENCE   1  (bases 1 to 119746)
  AUTHORS   Genka,H. and Sawada,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-OCT-2005) to the DDBJ/EMBL/GenBank databases.
            Contact:Hiroyuki Sawada
            National Institute of Agrobiological Sciences, Division of Genome
            and Biodiversity Research; 2-1-2 Kannondai, Tsukuba, Ibaraki
            305-8602, Japan
REFERENCE   2
  AUTHORS   Genka,H., Baba,T., Tsuda,M., Kanaya,S., Mori,H., Yoshida,T.,
            Noguchi,M.T., Tsuchiya,K. and Sawada,H.
  TITLE     Comparative Analysis of argK-tox Clusters and Their Flanking
            Regions in Phaseolotoxin-Producing Pseudomonas syringae Pathovars
  JOURNAL   J. Mol. Evol. 63, 401-414 (2006)
REFERENCE   3
  AUTHORS   Sawada,H., Takeuchi,T. and Matsuda,I.
  TITLE     Comparative analysis of Pseudomonassyringae pv. actinidiae and pv.
            phaseolicola based on phaseolotoxin-resistant ornithine
            carbamoyltransferase gene (argK) and 16S-23S rRNA intergenic
            spacer sequence.
  JOURNAL   Appl. Environ. Microbiol. 63, 282-288 (1997)
REFERENCE   4
  AUTHORS   Sawada,H., Suzuki,F., Matsuda,I. and Saitou,N.
  TITLE     Phylogenetic analysis of Pseudomonas syringae pathovars suggests
            the horizontal gene transfer of argK and the evolutionary
            stability of hrp gene cluster.
  JOURNAL   J. Mol. Evol. 49, 627-644 (1999)
REFERENCE   5
  AUTHORS   Sawada,H., Kanaya,S., Tsuda,M., Suzuki,F., Azegami,K. and Saitou,N.
  TITLE     A phylogenomic study of the OCTase genes in Pseudomonas syringae
            pathovars: The horizontal transfer of the argK-tox cluster and the
            evolutionary history of OCTase genes on their genomes.
  JOURNAL   J. Mol. Evol. 54, 437-457 (2002)
REFERENCE   6
  AUTHORS   Sawada,H. and Fujikawa,T.
  TITLE     Genetic diversity of Pseudomonas syringae pv. actinidiae, pathogen
            of kiwifruit bacterial canker
  JOURNAL   Plant Pathol. 68, 1235-1248 (2019)
  REMARK    DOI:10.1111/ppa.13040
COMMENT     
FEATURES             Location/Qualifiers
     source          1..119746
                     /db_xref="taxon:103796"
                     /mol_type="genomic DNA"
                     /note="argK-tox gene cluster"
                     /note="pathotype strain"
                     /note="pathovar: actinidiae"
                     /organism="Pseudomonas syringae pv. actinidiae"
                     /strain="KW-11"
     CDS             complement(1..1305)
                     /codon_start=1
                     /gene="ACT001"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4531 encoded by GenBank Accession Number AE016853"
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="BAF32764.1"
                     /transl_table=11
                     /translation="MFHLFRPRRDRKALHQLIASLNGSGEPVVRGCAEENTVLECWRS
                     LSSQRHLNEQRIAELEQELETARHLLGEASASATAYETRFDLVNRASSEGLWDMEVVA
                     GDPVNPNNRFWWSQQLRSLLGFNDERDFPNVLASWADRLHPQDKQATLDAFAKHLNDR
                     SGNTPYRVKNRLAMKNGTYRWFYAQGETLRDARGTPLRVAGSLRDIHDELERDLEHDV
                     IITRFELAREMLSDGLWDMEVIAGDPVNARNPFWWSPQFRRLLGFETVEEFPDVLDSW
                     ASRLHPEDKERSLTAFGTHLNDRSGKTPFDIEYRLKMKTGEYRWFRARGQTRRTPEGT
                     PLRVVGALVDVHLKHEQDALRETEAHHQKNLEENIAQLTQIVGTIQSIASQTNLLALN
                     AAIEAARAGEAGRGFAVVADEVRKLATRTTEATEQAASMMSR"
     CDS             complement(1542..2720)
                     /codon_start=1
                     /gene="ACT002"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4533 encoded by GenBank Accession Number AE016853"
                     /product="sodium-proton antiporter"
                     /protein_id="BAF32765.1"
                     /transl_table=11
                     /translation="MHNPTPRTESPNALAFIKRFFAAEAAGGLILMAAALAALIVANS
                     PLADSYFVALHTVLAGMSVEHWINDGLMAIFFMLVGLEIKREMLAGQLASWSQRALPG
                     FAALGGMVVPALIYVAFNWGQPDTLGGWAIPAATDIAFALGVLSLLGKRVPLSLKIFL
                     SALAILDDLGAVLIIALFYTSGLSIPMLLAALGSIAVLVALNRLGVKKLLPYLVVGAL
                     LWFFMLQSGIHATLAGVALALCIPLGKPDEEASSPLLHLEEKLHPWVAFAVVPIFGFA
                     NAGVSLSGITVDKLVDPVPLGVALGLLIGKQVGIFALAALAIRAGLARLPDGSNWGQL
                     YGVAALCGIGFTMSLFIGALAFPGAPALVDEVKVGVLIGSVLSALLGVVVLRRFGARG
                     "
     CDS             complement(2879..4393)
                     /codon_start=1
                     /gene="ACT003"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4534 encoded by GenBank Accession Number AE016853"
                     /product="peptide-binding protein"
                     /protein_id="BAF32766.1"
                     /transl_table=11
                     /translation="MKARPMKMLTVAMLAACSLAAGVAEAAGVLTIGRREDGTTFDPI
                     KSAQNIDNWVFSNVYDVLIRVDDKGTKLLPGLAESWSISPDGLTYTLKMREAKFSDGS
                     ELTASDAVFSLLRIRDDKGSLWSDSYKIIDKVVAADPHTLVITLKNPSASFLSQLALP
                     NVSILSEKAMKTLGEEAYAEKPVSSGAFTVKEWRRGDRVILAKNPNFWEAPNVSLDGV
                     EWISVPDDNTRVLMVQKGELDAAILVPFSRIENLKKNPDLVVHLDPSTREDHLLINHE
                     HGALAKPEVRQALDMAIDKKSLIDAATFGQGTVANSYIPKGALYHYADNLQRPYDPVK
                     AKKMLADAGASDLKLNYVVNAGNEVDEQISVMLQQQLAKVGVTTTLQKVDPSQSWQML
                     IDGDYDISVMYWTNDILDPDQKTTFVLGHDTNNNYMTHYKNEKVKELVAAARVEMDPK
                     KREQMYIDLQKMAKADVNWIDLYYSPYISVSRKNIEHFGQNPLGRFTLEETVKK"
     CDS             complement(4443..5423)
                     /codon_start=1
                     /gene="ACT004"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4535 encoded by GenBank Accession Number AE016853"
                     /product="ATP-binding protein of peptide ABC transporter"
                     /protein_id="BAF32767.1"
                     /transl_table=11
                     /translation="MSGPSLLNVNDLVVRFPAPGSGFMGLNKRWVHAVNGVSLSISAG
                     ETLGLVGESGSGKSTLGRAILRLNDITSGQIVFDDVDVAQGSGINLQRLRSETAMVFQ
                     DPSSSLNPRMTVGATLAEVLKVQRKVAASDIPARVIELLDMVGLRAEFAERKPGALSG
                     GQCQRVGIARALAIEPRLIIADECVAALDVSIQGQIINLLLELRERMNLAILFIAHDL
                     AIVRRLCDRVAVMHLGKIVEEGPVEAVFLRPRHPYTAALIQAIPEIDPDCPLPSEPLQ
                     GEPPSPLNLPDGCAFHPRCRFARPTCSSVAPPTRYAGEQRYDCVLDTPVF"
     CDS             complement(5420..6439)
                     /codon_start=1
                     /gene="ACT005"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4536 encoded by GenBank Accession Number AE016853"
                     /product="ATP-binding protein of peptide ABC transporter"
                     /protein_id="BAF32768.1"
                     /transl_table=11
                     /translation="MSTPVLKVSEMSVVASNVAKHRGREVTLVDRLSFDLHQGEILGL
                     VGESGSGKTMACRALMQLMPSPDLQVRGGSVLLNDVDLLKLDAAGMRAMRGRRIGMIF
                     QNPSSHLDPLMRIGEQIAEGFRLHQGSSKREARAQAIDLLRQVGIPDPVSRVDNFPHE
                     FSGGMRQRAMIAVALGCGPQVLIADEPTTALDVTVQAQILRLLLDLRDRHGLSLIMIT
                     HDLGVVAQTCDSIAVMYAGRLCEHGSKRDVLARARHPYTHGLIECQPASSAGSGLLRT
                     IPGQPPLLDALPSGCRFHARCGHAGQGCAETLPLMRPMGVAHAAACHYPLAVSQPSVV
                     EGIPS"
     CDS             complement(6436..7299)
                     /codon_start=1
                     /gene="ACT006"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4537 encoded by GenBank Accession Number AE016853"
                     /product="permease of Peptide ABC transporter"
                     /protein_id="BAF32769.1"
                     /transl_table=11
                     /translation="MSVAQAHLRPQWRSRLRLRLRNGRLAMLMGGALLGLWLLLALFA
                     PWLAPYDPIYQNTELRLLAPHLAHPFGTDNFGRDILSRVIWAARVDLQICVIGVIFPF
                     MIGTFVGALSGYIGGRFDNLCMRLIDIVLAFPFLVLMLAIIAILGPGLSSFYIAMALV
                     GWVSYARLIRSQILVLKESDFALAAKSLGFGHLRILFRHLLPNAMFGSIVFSMSDAVL
                     VLLSGASVSYLGLGVQPPLAEWGTMVAEGQAFLTSAWWICTFPGLAIVTLAMGFSLLA
                     DGAAETLGERR"
     CDS             complement(7296..8243)
                     /codon_start=1
                     /gene="ACT007"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4538 encoded by GenBank Accession Number AE016853"
                     /product="permease of Peptide ABC transporter"
                     /protein_id="BAF32770.1"
                     /transl_table=11
                     /translation="MNLGRYRFILQRPLQLLPVLFGISLVTFILVRSIPGDPARILLG
                     ARSTPDALANIRAQYGLDQPMWTQYLYFMKNLFQGDMGKSLLYKIDVLKLIGTRLEPT
                     LFLVIGSVLLALLIAVPLATVAARNKGSWGDNLIRVFTTTGLGMPAFWLGIMLILLFS
                     VRLDWFPVSGYGSDWLDKLHHMVLPCLTIALALSAVLVRNLRASMLMELQADHVTAAR
                     ARGVSEGALFRRHVLPNSLVPSINLLAVNIGWLISGTVVIESLFAIPGIGQLLVRGIF
                     SRDYMVVQGVAMVLACATVIVNFLADVATVAIDPRVSIK"
     CDS             8582..9346
                     /codon_start=1
                     /gene="ACT008"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4539 encoded by GenBank Accession Number AE016853"
                     /product="transcriptional regulator of LuxR family"
                     /protein_id="BAF32771.1"
                     /transl_table=11
                     /translation="MHIRLSDFNSRLQSASTLDQQMDCALLLASDLGFDAVIYDYSPV
                     PVSHDGALITPSLLSLRNTPADWHALWCSQGYYQIDPVQHLAVARVSPFVWSYQPRAE
                     TVLQTFITDMHKPVVRYLHDSHMTCGVTVPIHMPKGGFATLTGLCSDSSDVALEDARQ
                     SLAEFGLLAHAFQEVAYPLFDQKMRSCNAIKLTRRERECLSWSAEGLTAREIADQLNR
                     SVATITLHLNSAMQKLGAKNRVQAVVRAVHYRLLDH"
     CDS             9441..10382
                     /codon_start=1
                     /gene="ACT009"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4540 encoded by GenBank Accession Number AE016853"
                     /product="proline iminopeptidase"
                     /protein_id="BAF32772.1"
                     /transl_table=11
                     /translation="MADMTIKEGLAPFGDYQTWYRITGDLRGGGTPLVILHGGPGCTH
                     DYVDSFKDIANTGRAVIHYDQLGNGKSTHLPHMGSEFWTVDLFLRELDSLLKYLEIAD
                     NYALLGQSWGGMLASEHAVLQPTGLKALIIANSPADMHTWVSEANRLREELPDDVQAT
                     LLKHEEAGTLTDPEYLTASRVFYDRHVCRITPWPVEVERTFHQIDEDPTVYRAMNGPT
                     EFHVIGTMKDWSIVDRLPKINVPTLVISGFYDEATPLVVKPYVDNIPDVRESVFQESS
                     HMPHVEERMACMGCVAGFLDKVATSGKALPDVKARFG"
     CDS             10640..12265
                     /codon_start=1
                     /gene="ACT010"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4541 encoded by GenBank Accession Number AE016853"
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="BAF32773.1"
                     /transl_table=11
                     /translation="MNLRSLNISRRASLCFGIITVLLIGLGGFSYVQIDHLRTAEQNI
                     EENSLPSIQVVDDIQIALLHARLESIRMLASTDPAVHIIAEAKAREAIEALRSSSEFY
                     RKNLISGASDLAQFEDANSKMGAYIDGVKQIIAMDSSDHEKAVSFANAEQVQRATAYQ
                     EKLTTLRKQNAEEAVSSGNDATAVYNHSVNVLLTVVIAASLLTVVLAIALTRSIVDPI
                     SVSLKLAEDIAAGDLTRQLSVVGSDEASRLMNALNTMSGNLRSTIHEISGASAQLSTA
                     AVEMTSITESADRTLQQQNSEIEQAATAVNEMSAAVEEVARNATSTSEAARQSSLSAD
                     LGNQRVAETLAAMQKLTGLVEGSSGQVTALAGQAQDISKVLSVIRGIAEQTNLLALNA
                     AIEAARAGEQGRGFAVVADEVRALAHRTQTSTQEIEQMISAIQAGSSATVESMQKSTL
                     EVHSTRKTAEGAGESLRQITDSVLEINNRNLQIATASEQQAHVARDVDRSLISIRDLA
                     VQSSEGTRQTLVASNELSQLAVNLNDLVLRFKT"
     CDS             12510..13010
                     /codon_start=1
                     /gene="ACT011"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4542 encoded by GenBank Accession Number AE016853"
                     /product="GAF domain protein"
                     /protein_id="BAF32774.1"
                     /transl_table=11
                     /translation="MNNNLTSAELAVISEIEATSSLLRLVTRLTGLRFAAIAKVTESS
                     WTACAVYDEIQFGLEAGHQLKLETTLCNELRQHRQPIVINELATDPVYAEHPIPKLYG
                     FQSYFSLPIIFPNGDFFGTLCGLDQLPKQLDDADTLDTLKVFCTLIASTLYAHYQLQE
                     MQELTV"
     CDS             13374..15197
                     /codon_start=1
                     /gene="ACT012"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4543 encoded by GenBank Accession Number AE016853"
                     /product="GAF domain/GGDEF domain/EAL domain protein"
                     /protein_id="BAF32775.1"
                     /transl_table=11
                     /translation="MNASAPIPLNETQRLLRIRELCVLEDTSDEVFDEIVAMTADFFQ
                     TPIALVSIVDEHRQWFRARVGLSARETPRNVSFCAYTILSDTLFEIPDATLDERFMNN
                     SLVTGHPDIRYYAGAPLITDDGLALGSLCVIDTKPREPMSEHQTQMLKRFASLVMKRI
                     VSLRLSCFIDQPTGLFNRSRLQEDIHEALASSVDYQLVVMDMITSAFLNDIVKALGYS
                     FSQDLVTAIKERMESLLPQTCPLYKVGPTRFGFLLAGDRPPEHLFRTILEDFETPVEC
                     HGIPVQMQVGLGVVTLNRDPNEEQDWMRMVISAADDARDRDLGWAMYEPHFDAAQQRA
                     FKLLSSLTSAVHSHDQLRLVYQPRIDLETGLCTSVEALLRWNHPTLGPIGPAEFVPLA
                     EKTALMRPLSLWVLTSAIEQAARWQQQGFHFRIAINVTPEDLTGPAFTDRMVRLLGQH
                     KIDPTRFELEFTEGALMHNPAEVRHQLERMRQMGMDVAIDDFGTGYSNWNYLRQLPAT
                     TVKLDQSLIRNLASDKTDQRLVKALIGLAKKLGYCVVAEGIETDEIRRLVKQWGCDEG
                     QGYLIAKPMEADAVLGWLGPDRRLQSVTEAAEAAVIRDKRL"
     CDS             15274..16074
                     /codon_start=1
                     /gene="ACT013"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4544 encoded by GenBank Accession Number AE016853"
                     /product="membrane protein"
                     /protein_id="BAF32776.1"
                     /transl_table=11
                     /translation="MTGLVMEAGGLGFVVAGLVVGFIVGMTGVGGGSLMTPILLWFGI
                     NPATAVGTDLLYAAITKSGGVLVHRKNDNIDWKVTGLLTLGSVPAVLLTLWFLSTLHT
                     APDALNAIIKQALGYVLLLTALAVLFKKKLLAFAHGRGDGQSFFSGTSLTVLTVITGL
                     ILGTMVALTSIGAGALGTVALFILYPLLPTRRLVGTEIAHAVPLTLVAGLGHASMGNM
                     NWELLGWLLMGSLPGIYLGSHMAGRVSDDLLRPFLAIMLGMIGFKLAF"
     CDS             16299..16499
                     /codon_start=1
                     /gene="ACT014"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4545 encoded by GenBank Accession Number AE016853"
                     /product="conserved hypothetical protein"
                     /protein_id="BAF32777.1"
                     /transl_table=11
                     /translation="MLIRIEEGVYGADWVVKLDDYPVKCRSWQEAREFADRMKSRIDA
                     PHSLPHLARRAAPEHSASAMAR"
     CDS             complement(16745..16939)
                     /codon_start=1
                     /gene="ACT015"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Streptococcus pneumoniae TIGR4 SP0547
                     encoded by GeneBank Accession Number AE007365"
                     /product="conserved domain protein"
                     /protein_id="BAF32778.1"
                     /transl_table=11
                     /translation="MSIITKWMLQAIALFMLGWMATVTASWSNNVSSGTGNDRLAELS
                     AGVLSSPAVTVATSRNLQSE"
     CDS             complement(17128..17367)
                     /codon_start=1
                     /gene="ACT016"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4546 encoded by GenBank Accession Number AE016853"
                     /product="conserved hypothetical protein"
                     /protein_id="BAF32779.1"
                     /transl_table=11
                     /translation="MGWISENHLWWFALLTALVVLSDIWAVMRIRKSKTESSNKLMWI
                     IVIVAVPVLGVLALVVAGPRHVDTPAKPEQQSTKY"
     CDS             complement(17601..19154)
                     /codon_start=1
                     /gene="ACT017"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="almost identical to Pseudomonas syringae pv.
                     tomato DC3000 PSPTO4547 encoded by GenBank Accession
                     Number AE016853"
                     /product="D-galactarate dehydratase"
                     /protein_id="BAF32780.1"
                     /transl_table=11
                     /translation="MNLIQHADSPRYIRLHPLDNVVVVVNDQGVPAGTEFDNGLVTVD
                     NVPQSHKVSTVDLAVGEAIIRYGHTIGYALQPIPRGSWVREDQLRMPSAPALDSLPMS
                     DAVPEKQAPLEGYTFEGYRNADGTVGTRNILGITTTVQCVTGVLDHAVKRIRDELLPK
                     YPNVDDVVALTHSYGCGVAITATDAYIPIRTVRNLARNPNLGGEALVIGLGCEKLQAG
                     QVMHEDDSSVDLSEPWLYRLQDSSHGFNEMIEQIMELAETRLKKLDMRRRETVPASEL
                     ILGMQCGGSDAFSGITANPALGYASDLLLRAGATVMFSEVTEVRDAIYLLTSRAQDQD
                     VAQALVREMDWYDRYLAKGEADRSANTTPGNKKGGLSNIVEKSLGSIVKSGSSAINGV
                     LGPGERVNSKGLIFCATPASDFVCGTLQLAAGMNLHVFTTGRGTPYGLAMAPVVKVST
                     RTELAQRWPDLIDIDAGRIATGRASIEDLGWELFHFYLDVASGKKKTWTEHYRLHNDI
                     TLFNPAPIT"
     CDS             complement(19165..20550)
                     /codon_start=1
                     /gene="ACT018"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4548 encoded by GenBank Accession Number AE016853"
                     /product="MFS transporter of phthalate permease family"
                     /protein_id="BAF32781.1"
                     /transl_table=11
                     /translation="MQKSKPTHVRYLILLMLFLVTTINYADRATIAIAGSSIQKDLGI
                     TAVTLGYIFSAFGWAYVAGQIPGGWLLDRFGSKKVYAMSIFTWSLFTLLQGYVGEFGI
                     STAIVPLFMLRFLVGLAEAPSFPGNARIVAAWFPTAERGTASAIFNSAQYFATVLFAP
                     LMGWIVYTYGWKHVFVVMGAVGIVFSMIWMKVIYGPRNHPMINEAEFEHISSNGALVD
                     LDQDKGKGKEKAASSGPKWDYIRQLLTNRMMLGIYLSQYCINGITYFFLTWFPVYLVQ
                     ERGMTILKAGIIASLPAICGFIGGVLGGIISDYLLRKGHSLTFARKAPIIGGLLLSTS
                     IVTCNYVDVEWVVVGFMALAFFGKGVGALGWAVMSDVSPKQIAGLSGGLFNTFGNVAS
                     ITTPIVIGYIISSTGSFKWALVFVGANALLAVISYIFIVGEIKRVELKEPPAKGPLLN
                     DSVSDLSEAKS"
     CDS             complement(20716..21627)
                     /codon_start=1
                     /gene="ACT019"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4549 encoded by GenBank Accession Number AE016853"
                     /product="dihydrodipicolinate synthetase"
                     /protein_id="BAF32782.1"
                     /transl_table=11
                     /translation="MNPQELKSILSSGLLSFPVTDFNAQGDFHRAGYIKRLEWLAPYG
                     ASALFAAGGTGEFFSLAASEYSEIIKTAVDTCATSVPILAGVGGATRQAIEYAQEAER
                     LGAKGLLLLPHYLTEASQDGVAAHVEAVCKSVKIGVVVYNRNVCRLTPTLLEQLAERC
                     PNLIGYKDGLGDIELMVSIRRRLGDRFSYLGGLPTAEVYAAAYKALGVPVYSSAVFNF
                     VPKLAMDFYHAIARDDHEAVGKYIDDFFLPYLEIRNRKAGYAVSIVKAGAKIAGYDAG
                     PVRAPLTDLTPDECDMLAALMDKQGKQ"
     CDS             complement(21912..22661)
                     /codon_start=1
                     /gene="ACT020"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4550 encoded by GenBank Accession Number AE016853"
                     /product="transcriptional regulator of GntR family"
                     /protein_id="BAF32783.1"
                     /transl_table=11
                     /translation="MENQSAPPRARRKHRSLAQELVTELSERIRSGQLKRGDKLPTES
                     AIMEEQGVSRTVVREAISRLQASGLVETRHGIGTFVLDTPSPSGFRIDPATIVTLRDV
                     LAILELRISLEVESAGLAAQRRSDEQLAAMRAALDALNESAAHATDAVASDFQFHLQI
                     ALSTGNRYFTDIMTHLGTSIIPRTRLNSARLAHDDQQHYMDRLSREHEEIFEAIARQD
                     SDAARAAMRLHLTNSRERLRHAHEEAESQRA"
     CDS             complement(22759..24492)
                     /codon_start=1
                     /gene="ACT022"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4551 encoded by GenBank Accession Number AE016853"
                     /product="ATP-binding protein of ABC transporter"
                     /protein_id="BAF32784.1"
                     /transl_table=11
                     /translation="MNRNAEYSAVNDTVKGAFFPRVWKLITPYWRSEEKTVAWLLLVS
                     VIALTLFSVQVSVLFNSWYRDFYNALQNKDLAAFTHLILYFSGIAAIAILAAVYRLYL
                     TQLLTIRWRRWLTEQHFTRWLEHKNYYHLEQGGYTDNPDQRLSEDLNEFTTSTLSLGL
                     GLMSSVVSLVSFSVILWGVSGSIELFGVTIPGYMFWAAMLYAIVGSLLTHWIGKRLIP
                     LNNQQERYEADLRFALVRVRENAESIALSEGERNENQRLSGRFSMIWNNFRASMKVQK
                     RLTFFTSGYSQIALIFPFIVAAPRYFAGKIELGDLMQINSAFGNVQENFSWFISAYST
                     LASWRATCDRLLSFRQALTDHEAQQPAIERVHADDALDLRNLGLSIAGGRQLLSEADL
                     HIAAGERVMLSGRSGSGKSSLLRALGGLWPHGSGQIRLPAEPVLFLPQRPYLPIGTLR
                     EAMSYPQSADHYSPERFADALKKCRLEHLIPRLDESNHWQRFLSPGEQQRMAFARALL
                     VAPRWLYMDEATSAMDEEDEAAMHRAIIDGLPGLTLLSIGHRSSLKRFHNRHVRVEDG
                     KLIEQAASGAV"
     CDS             24482..24592
                     /codon_start=1
                     /gene="ACT021"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="almost identical to Pseudomonas syringae pv.
                     tomato DC3000 PSPTO4552 encoded by GenBank Accession
                     Number AE016853"
                     /product="conserved hypothetical protein"
                     /protein_id="BAF32785.1"
                     /transl_table=11
                     /translation="MRFMWVRLALFERTMPEHNEAKKRLHEHYEKTFINA"
     CDS             complement(24582..25145)
                     /codon_start=1
                     /gene="ACT023"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4553 encoded by GenBank Accession Number AE016853"
                     /product="DNA-binding response regulator"
                     /protein_id="BAF32786.1"
                     /transl_table=11
                     /translation="MSDDDIQVEGEELPHLLLVDDDATFTRVMARAMSRRGFRVSTAG
                     SAEEGLALAQQDIPEYAALDLKMDGDSGLVLLPKLLEMDPDMRVVILTGYSSIATAVE
                     AIKRGACNYLCKPADADDVLAALLSEHANLDTLVPENPMSVDRLQWEHIQRVLAEHEG
                     NISATARALGMHRRTLQRKLQKRPVRR"
     CDS             complement(25142..26401)
                     /codon_start=1
                     /gene="ACT024"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4554 encoded by GenBank Accession Number AE016853"
                     /product="sensor histidine kinase"
                     /protein_id="BAF32787.1"
                     /transl_table=11
                     /translation="MLAPVQMLSATRQNLWRLTFIRILVLAAQAGSVGIAWLFDLLPL
                     PWLQLSITLGCSLVLCGLTVIRLRTSLPLTELEYALQLALDLLIHSALLYYSGGSANP
                     FVSYYLVPLTIAAATLPWRYSLILSGFALTMYTLLMVRSYPLETDSIARENMQVYGMW
                     LSFALAASVITFFAAKMAEELRRQEQLRAERREEGLRDQQLLAVATQAAGAAHELGTP
                     LATMSVLLKEMRQDHNDPALQEDLSVLQEQVKQCKQTLQQLVRAAEANRRMAVEQQPA
                     TRWLDESLNRWHLMRPEVSYRFYQLGKGDVPMLAPPPDLTQALLNLLNNAADACPDGL
                     EVNLNWDSAEVCISIRDHGAGVPLAIAEQIGKPFFTTKGKGFGLGLFLSKASVTRAGG
                     SVKLYSHEEGGTLTELRLPRETRGEEA"
     CDS             26595..27308
                     /codon_start=1
                     /gene="ACT025"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4555 encoded by GenBank Accession Number AE016853"
                     /product="conserved hypothetical protein"
                     /protein_id="BAF32788.1"
                     /transl_table=11
                     /translation="MFNLRPAATLVALAAALSSLPALAEEARYNQISLRAEVNQEVQR
                     DLMLVTLYTEAQDSDPAKLAAQITETLNKALGQARQVKNVKIRQGSRNSYPVYDDKGQ
                     KITGWRERAELRLESADFAVLSKLTGELLTDLKMGGMDFSISPSTRKTSEDALLKDAV
                     TAFKARAQLVTEALGGAGYKLVNLNLNTSGYPQPYLRAPVMMMAKSSRDESAPTPDVE
                     AGTSQVSVAADGVIEVAIP"
     CDS             27413..29083
                     /codon_start=1
                     /gene="ACT026"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4556 encoded by GenBank Accession Number AE016853"
                     /product="conserved domain protein"
                     /protein_id="BAF32789.1"
                     /transl_table=11
                     /translation="MSSDWRQPPSPRNYPLTSLTTALTERYGQRAFTHKESRMNPSDS
                     TSERFAADTDQAMKTNAETLPSPLRFEAGKGDEHTHTHGAIEAVLESAGFRHEEIRAI
                     YFGNWLRDYSQLLDPKIVRATTMPKSFPDLLSRHALTRIVDVLAVKEFTDLMQIDRSR
                     FVVTPERLGVYRPGEHIDNPKAINPKPASPKERDADFDDWVLPDDPALQVDHETSMKR
                     YIQRSVDIMVAGLESAVNAGPQSTDGLRDMGAALHILEDFFAHSNFVELSLIKLGHNS
                     VLPWTSKADCKHKLPLVTGTFGGSDIIASLAAPLGNILFSPDDKPFEAFKAGERYERD
                     QILLIILGEHPDQSLLAGYEAFLEARDQWASLPFSEQVEKFYAFIGTPGRLLGNAFGI
                     AMQSLAVWLGNSVDDLQTLLDEDPNTSGSTDPSHSQLAKDHAQHPLHVLAATLARKAV
                     LQVGQAVLGQWHGKEGAEHPARVAARFFTHPMDCDWQDAIIGEWAEANPAQIERAALK
                     SELDRYQSDLQSNAKQDLQRFSQDSSNFLNVFFESTSLADLWARVTGK"
     CDS             29180..30781
                     /codon_start=1
                     /gene="ACT027"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4557 encoded by GenBank Accession Number AE016853"
                     /product="periplasmic peptide-binding protein of peptide
                     ABC transporter"
                     /protein_id="BAF32790.1"
                     /transl_table=11
                     /translation="MGHTLFKPLLLTTALLACAPLAQAASTLVYCSEASPAGFDPSQY
                     TSGTDFDASAETVFNRLTQFKRGGTEVEPGLATRWDVSPDGLTYTFHLRDGVKFHTTD
                     YFTPTRTFNADDVLFTFNRLLDANHPFRKAYPSESPYFTDMGLNTTIKSVDKVDAQTV
                     RFTLNNTDAAFVQNLAMSFASIQSAEYADKLLKEGKADELNQKPIGTGPFVFKRYQKD
                     SQIRYTGNTEYWKPEDVKIDNLIFSISSDAAVRMQKLKAGECQVSGYPRPQDIEEMKK
                     DPKLKVLSQAGFNLGFLAYNVTHAPLDQLKVRQALDMAIDKPAIIKAVYQSAGQLAEN
                     ALPPGQWSYDPTIKDAPYDPTKAKQLLKEAGVAPGTKIDLWAMTVQRASNPNARMSAQ
                     MIQSDWDKIGIKANIVSYEWGEYIKRAKAGEHDAMIYGWTGDNGDPDNWLGVLYSCAA
                     VKGSNYAKWCDPAYDKLVQQAKLTTSRDERIKLYQQAQHILKQQVPITPIANSKVFQP
                     MRQEVQDFKISPFGLTPFYGVSLSK"
     CDS             31054..32676
                     /codon_start=1
                     /gene="ACT028"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4558 encoded by GenBank Accession Number AE016853"
                     /product="periplasmic dipeptide-binding protein of
                     dipeptide ABC transporter"
                     /protein_id="BAF32791.1"
                     /transl_table=11
                     /translation="MLKHAVIPFLVGASLLASAPFAHAASNLVFCSEGSPAGFDPGQY
                     TTGTDFDASAETIFNRLSQFERGGTAVVPGLATKWDISEDGLTYTFHLREGVKFHTTS
                     YFKPTREFNADDVLFTFNRMIDKDMPYRKAYPTEFPYFTDMAMDTNITKIEKVDDHTV
                     KFVLGKVDAAFIQNMAMSFASVQSAEYAAQLLKEGKPELINQQPIGTGPFVFKSYQKD
                     SNIRYTGNKDYWKPEDVKVDNLIFAITTDASVRIQKLKKNECQITAYPRPADLEPLKA
                     DKNLKMPDQAGFNLGYIAYNVMDKIKGDDRPNPLAQLKVRQALDMAVNKQQIIDSVYQ
                     GAGQLAVNAMPPTQWSYDTTIKDAKYDPEKARQLLKEAGIKEGTEITLWAMPVQRPYN
                     PNAKLMAEMLQADWKKIGISAKIVSYEWGEYIKRAKNGENGAMLIGWSGDNGDPDNWL
                     GTLFGCDALNGNNFAKWCDKPFDTLIHQAKQTPDQAKRTELYKQAQHLLKDAVPMTPI
                     AHSTVYQPMRTSVQDFKISPFGLNSFYGVSVK"
     CDS             33006..34598
                     /codon_start=1
                     /gene="ACT029"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4559 encoded by GenBank Accession Number AE016853"
                     /product="periplasmic dipeptide-binding protein of
                     dipeptide ABC transporter"
                     /protein_id="BAF32792.1"
                     /transl_table=11
                     /translation="MRKTLAMTSCLGLLALAPFAQAASNLVFCSEASPAGFDGAQYTS
                     STDNDASEPIYNRLTEFKQGDTSVVPALATSWDVSEDGLTYTFHLREGVKFHSNKNFT
                     PSRDFNADDVVFTFNRMLKPDHPFRIAYPTEFPYFTSMGLNKKIKSVEKTGPLTVVFT
                     LNTVDAAFIQNIAMNFAGILSAEYAEQLMAKGDVRDINQQPIGTGPFVFQRYQKDSQI
                     RYKGNKEFWDPSRVKIDQLIFAIVTDASARMQKLKANECQVSVNPRPADLAKLKEDKS
                     LQIIEKPGFNLGYISYNVRHEPLGKLEVRQALDMAVNKKAIINAVYQGAGQLAVNAMP
                     PTQWSYDDSIKDAPYDPEKAKALLRAAGIKEGTELTLWAMPVQRPYNPNAKLMAEMLQ
                     ADWAKVGIKVKIVSYEWGEYLKRTKNGEHDISLIGWTGDNGDPDNWLGTLYSCAAIGG
                     NNYSMWCDEKYDQLVKAAVATTDREKRTDLYKQAQRYLKEQVPITPVAHSTVNQPLRA
                     EVRDFHVSPFGRNNFSGVSIAD"
     CDS             34750..36129
                     /codon_start=1
                     /gene="ACT030"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4560 encoded by GenBank Accession Number AE016853"
                     /product="Outer membrane porin of OprD family"
                     /protein_id="BAF32793.1"
                     /transl_table=11
                     /translation="MKKTSTALLALSLSSFGALVQAEPASQTFIPTGLSTKNAQAEAN
                     GFFEDQHLTGTTRNWYANELKRRDEVFRYNDNGIPEQTSRRINWQQGTIVNYSSGFTQ
                     GVVGFSTELALYNAIALDRDTDDFAGNSNRTLAHSDGDAVGQWSKMGLGNVKARVSNT
                     VLTMGRQSVNTPVIAFIGNRALPSSFQGFAVQSDELNNLSLQGGSFDRVSPRMEQSLD
                     KFRSEYGDRSKPADRLDMFGGDYKPTDSLTASFYASNLEDFWHQYYFAFTHELGDSKV
                     FALSTNLNYYKTKDAGQSKLGAIDNDTYSLSFTGTHNAHSVSLAYQEVNGNEYFDYAH
                     DTNAIFLANSLLSDFNGPNEKSLQIAYVLNMAEYGVPGLKFNIYQARGWDIDGTHYKG
                     TGYTDVLAMDGETHYEYGIGSSYSVQSGPLKATAVRATYTTHRASENQADGNINEFRL
                     VTTIPFNIL"
     CDS             36212..37807
                     /codon_start=1
                     /gene="ACT031"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4561 encoded by GenBank Accession Number AE016853"
                     /product="periplasmic dipeptide-binding protein of
                     dipeptide ABC transporter"
                     /protein_id="BAF32794.1"
                     /transl_table=11
                     /translation="MKMLSLRNSIALALLSVAVSVSAKPLVVCTEASPEGFDMVQYTT
                     AVTADAVAETVFNRLADFKPGTTEVIPALADSWEISEDGLTYTFHLRKGVKFHTTDYF
                     KPTRDMNADDVLWSFQRQLDPKHPWHDKSSVGFPYFESMGFKELLKSVEKTDDYTVKF
                     TLTRREAPFLADVAMAFASIYPAEYADQLLKANKTNDLNSKPIGTGPFIFQRYAKDAQ
                     VRFKANPEYFRGTPPSEALILAIATDNNVRLQKLKANECQIALYPKPDDVPSIKKDPN
                     LKIDEMEAMTTGYIAINTTHKYLSDVRVRKAIDMTFDKNAYVNAVFGKGNALVAVNPY
                     PPTLLGYNNSLKNPPVDLDKARALLKEAGVPEGTTFTLFTRNGGGPTNPNPMLGAQMM
                     QSDLAKIGIKIDIRVMEWGEMLKRAKNGEHDMVSAGWAGDNGDPDNFLTPMLSCEAAK
                     NGENYARWCNADFQTLIDKARETVNPQDRAALYEQAQAIFNKDQPWISMAHTRMFTAM
                     RNNVEGYQISPLTINNFATTRVK"
     CDS             37882..38892
                     /codon_start=1
                     /gene="ACT032"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4562 encoded by GenBank Accession Number AE016853"
                     /product="permease of dipeptide ABC transporter"
                     /protein_id="BAF32795.1"
                     /transl_table=11
                     /translation="MFSFIARRVGLLIPTFFGITLLTFALIRLIPGDPVEVMMGERRV
                     DPEMHAQAMERLGLNKPLYAQYIDYIGKLAQGDLGESLRTRTSVWSEFTSLFPATLEL
                     SLAALIFACILGLLAGVIAALKRGSLFDHGVMGISLAGYSMPIFWWGLILIMFFSVSL
                     GWTPVSGRIDLLYDIPPVTGFMLIDTLLSDEQGAFLDALHHLILPAIVLGTIPLAVIA
                     RMTRSSMLEVLREDYVRTARAKGLSPARVVFVHGLRNALIPVLTVFGLQIGTLLAGAV
                     LTETIFSWPGIGKWLIEAIGARDYPVVQNGILLIACLVILVNFVVDILYGFANPRIRH
                     QR"
     CDS             38903..39814
                     /codon_start=1
                     /gene="ACT033"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4563 encoded by GenBank Accession Number AE016853"
                     /product="permease of dipeptide ABC transporter"
                     /protein_id="BAF32796.1"
                     /transl_table=11
                     /translation="MSTPTPAVAVDQSLLYPSPYKEFWQAFSKNKGAVAGLLFMILIV
                     FCALFAPWVAPHDPSEQYRDFLLTPPVWLEGGQWQFILGTDELGRDLLSRLIQGSRLS
                     LLIGLASVVMSLIPGIFLGLLAGFFPRILGPSVMRLMDIMLALPSLLLAVAIVAILGP
                     GLINTVIAIAIVSLPSYVRLTRAAVMGELNRDYVTAARLAGATLPRLMFITVLPNCMA
                     PLIVQATLSFSSAILDAAALGFLGLGVQPPTPEWGTMLASARDYIERAWWVVSLPGLT
                     ILLSVLAINLMGDGLRDALDPKLKNTA"
     CDS             39825..40793
                     /codon_start=1
                     /gene="ACT034"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4563 encoded by GenBank Accession Number AE016853"
                     /product="ATP-binding protein of dipeptide ABC
                     transporter"
                     /protein_id="BAF32797.1"
                     /transl_table=11
                     /translation="MSLLEIKNLNVRFGDAKAVPVVDGLSLSVDRGEVLAIVGESGSG
                     KSVTMMALMGLIDSPGIITADALNFDGNDLLKLNSRQRRRIIGKDLAMVFQDPMTALN
                     PSYTVGFQIEEVLRQHLNMSGKAARQRALELLEKVEIPGAAARLNAYPHQLSGGMSQR
                     VAIAMAIAGEPKLLIADEPTTALDVTIQAQIMDLLLSLQKEQDMALVLITHDLAVVAE
                     TAQRVCVMYAGQAVEVGQVPGLFEVPAHPYSEALLAAIPEHSMGAERLATLPGMVPGR
                     YDRPQGCLLSPRCPYVRDNCRTERPGLDPKAHSLARCFYPLNQEVA"
     CDS             40793..41767
                     /codon_start=1
                     /gene="ACT035"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. syringae B728a
                     Psyr4242 encoded by GenBank Accession Number CP000075"
                     /product="ATPase component of ABC-type oligopeptide
                     transport system"
                     /protein_id="BAF32798.1"
                     /transl_table=11
                     /translation="MSVVLTARDLTRHYEVSRGLFKGTALVRALNGVSFELEAGKTLA
                     VVGESGCGKSTLARALTLIEEPSSGSLKIAGQEVTGASKSERKQLRKDVQMVFQSPYA
                     SLNPRQKVGDQLGEPLLINTKLSAAERREKVQAMMAQVGLRPEHYQRYPHMFSGGQRQ
                     RIALARAMMLQPKVLVADEPTSALDVSIQAQVLNLFMDLQQEFNTAYVFISHNLSVVR
                     HVADTVLVMYLGRPAEMGPKEEIYNRPLHPYTQALLSATPTIHPDPLKPKIKIVGELP
                     NPLNPPSGCAFHKRCPYATERCATDVPELRLVDNRQVACHYAEQFVAA"
     CDS             complement(41848..44316)
                     /codon_start=1
                     /gene="ACT036"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4569 encoded by GenBank Accession Number AE016853"
                     /product="iron-uptake factor"
                     /protein_id="BAF32799.1"
                     /transl_table=11
                     /translation="MLALMGITGALYSFEDEILDVLNPDTLLVEERAAALPPLELVHK
                     LEAATGLTVAILRVETLGNRAAQVYFTPEPGERRGPKRNFDPYTGELKGDAVGEGFFD
                     FVLQLHRYLAAGEVGKQVTAACTLILLFFCLSGLYLRWPRNALNWRVWLTLDWAKKGR
                     SFNWDLHSVFGTWCLLFYLLFAITGLNWSYDWVSNGLNTLMGDAPSVQRKAPVVTANK
                     TAPLVVDYAAVWDSIQKTAGPELRAYNLRLPASGGQPATVFYLLKNSPHPRALNSITL
                     DPANGQVSAVLRYAERGLGAQLLASNYALHVGSYFGLVGRIIMTGASLMMPLFFITGW
                     LLYLDRRRKKRDVRSARGEVQDDACADASSWLIGFASQSGFAEQLAWQTAAQLQASGL
                     PVRVKRLGELTEEDFSQSRKALFVVSTFGEGEAPDSARGFERKLLGRRLAVEHLDYAV
                     LALGDRQYLHFCGFAHRLHDWLAEQGARTLFAPVEVDSADPAALQHWQQQLGQLTGSL
                     PLAHWQAPVFENWTLARREHLNPGSSGSKVFRLELTAPGLMSWQAGDLVEVMPRNAAQ
                     VIEQCLHGLGVDPLSTVSVEGLQETLAQALATRQLPHNRAHLVGLHAQALIDALVPIS
                     AREYSIASVPEEECLQLIVRQEVHADGSLGLGSGWLTEHAVLDSTVSLRVRRNSSFHL
                     PAEPVPLILLGNGTGLAGLRSLLKARIAQGQTRNWLLFGERNRAHDFHCGTELEGWLE
                     SGGLTRLDLAFSRDQAEKIYVQDRLREAAAELRVWLDDGAAIYICGSLLGMAAGVDQV
                     LHEVLGAQRVNELIEQGRYRRDVY"
     CDS             complement(44520..45533)
                     /codon_start=1
                     /gene="ACT037"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4570 encoded by GenBank Accession Number AE016853"
                     /product="conserved hypothetical protein"
                     /protein_id="BAF32800.1"
                     /transl_table=11
                     /translation="MNVYVLDTPVQLPKPNMEIVIGSREKLKHQADALGDIYLPVMKE
                     TLRSLVNEVGNVDKEALDALTLVPHFFNGDEMLPFVDAIAKLRGEPEEAKSGAAIAEF
                     SQEISILLDTRIASLARQAKVLDKALINLNAVQVNAVDHLTPALDQEISTLQARLAIE
                     KTRLEEMLTKEKVVNALITDLESLSFFDKLKPLIASLETLADIDPKNPLIGSIKAGIA
                     GVSNILDLLDAAVDYDHLITLRDTLQAQSLELQDAVGEARTALDVEVSKRDQISGLAS
                     VQVYKNDYVREIGKLHTALTQVLANCRLPASEGLEERVEHFSRQANALNTYLVDLRGS
                     WRS"
     CDS             complement(45569..46768)
                     /codon_start=1
                     /gene="ACT038"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4571 encoded by GenBank Accession Number AE016853"
                     /product="conserved hypothetical protein"
                     /protein_id="BAF32801.1"
                     /transl_table=11
                     /translation="MVTSVEPQFTDGEAHTVEDVGRVGKDLMNVLSGKGEGVARAPGL
                     LITNEDVRRIRRYVNTGLSLPTKLEEVSQLVGGSDNGIAGLAPDAMAELYVGIQTHAR
                     SWSAIETNMQKVGSDLYVFSGNLITIATNVVDFIKGLQSYQTLQVGDLTPAQIDQMPP
                     VALMDQDSKKIPGLLALVDDLKVYIKDHSASTTRTRVGVTDFKRCLKDEIAPGVALKI
                     RLARSGNAGDEIARLTADVDQLNNCINQKLAEYEEYSEYKWIGFWWGVIGGVVSYSIY
                     GPKATAALSEKDHLIKEKRLVELTLKKQNRLLGDLLAFETSLQDLKTRIDGAASGVSN
                     IESLWVLLEELVESSHDRIKNTNNALYLVSFVSRFQTLLANWKEIKVQSFDLLTAFNN
                     ALEEPAV"
     CDS             complement(47046..48125)
                     /codon_start=1
                     /gene="ACT039"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4572 encoded by GenBank Accession Number AE016853"
                     /product="pyridoxal-dependent decarboxylase of pyridoxal
                     binding domain"
                     /protein_id="BAF32802.1"
                     /transl_table=11
                     /translation="MVIDTAIISKAYDDLRAGFEFAKVYYAVKANPAVEVINLLKDKG
                     SSFDIASIYELDKVMSCGVGPERMSYGNTIKKSKDIRYFYEKGVRLFATDSEADLRNI
                     AKAAPGSKVYVRILTEGSTTADWPLSRKFGCQTDMAMDLLILARDLGLVPYGISFHVG
                     SQQRDISVWDAAIAKVKVIFERLKEEDGIVLKLINMGGGFPANYITRTNSLETYAEEI
                     IRFLKEDFGDDLPEIILEPGRSLISNAGILVSEVVLVARKSRTAVERWVYTDVGKFSG
                     LIETMDEAIKFPIWTEKKGEMEEVVIAGPTCDSADIMYENYKYGLPLNLAIGDRMYWL
                     STGAYTTSYSAVEFNGFPPLKSFYL"
     CDS             complement(48145..48255)
                     /codon_start=1
                     /gene="ACT040"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4573 encoded by GenBank Accession Number AE016853"
                     /product="conserved hypothetical protein"
                     /protein_id="BAF32803.1"
                     /transl_table=11
                     /translation="MHPFTNTACHQEFQQHVDQCRRLLFSRHLQENEGVR"
     CDS             48885..50132
                     /codon_start=1
                     /gene="ACT041"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas aeruginosa PAO1 PA1914
                     encoded by GenBank Accession Number  NC_002516"
                     /product="conserved hypothetical protein"
                     /protein_id="BAF32804.1"
                     /transl_table=11
                     /translation="MDRLKTILIALSLPALLAASSVHAGEGTDVAWLMSYYYNRTPTD
                     CGAGRPLDQCSGLRLRGTDSGQAFEPWDPSPNSVKSGGVSMSFLRKDVKYKDLGLKKT
                     NGFVLKPNDFISQNEKKISTLCFFPLDAWTDYRTNAGCSENSNTTNYVEKICQDAGVK
                     TAEQWLADYRRVNNDHQKQCGFEIKDRADDAESFWQGVRARQMVQNDRDAMETQSEIR
                     VPPWGAEEDAQLPVLAFIYTPNPGLPSGLEKARGDQKRYFQKTGKWVPVIRADLPTAN
                     NVDARFTYNEGDQHRDAPTPKVDNECKSYIASATWLQRDDPFIKGQPWSLQVTPTECG
                     RNMTKQQQAAAYAELFSKYGKDKQWNPDNGSMNQQLVCHLEWSGDDNGKKVYTRDKRF
                     WNLEPVRPAVSWDDVFKQGCNPY"
     CDS             complement(50289..51458)
                     /codon_start=1
                     /gene="ACT042"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4575 encoded by GenBank Accession Number AE016853"
                     /product="ATP-binding protein of glycine
                     betaine/carnitine/choline ABC transporter"
                     /protein_id="BAF32805.1"
                     /transl_table=11
                     /translation="MIELQNLSKTFQSNGKEVKAVDSVSLTVNEGEICVFLGSSGCGK
                     STTLKMINRLIMPTSGKVLINGEDTTDLDEVTLRRNIGYVIQQIGLFPNMTIEENIVV
                     VPKLLGWDKQRCHDRARELMSMIKLEPKQYLHRYPRELSGGQQQRIGVIRALAADAPL
                     LLMDEPFGAVDPINREMIQNEFFEMQRALNKTVIMVSHDIDEAIKLGDKIAIFHGGKL
                     LQIDHPDTLLAHPADDFVSSFVGQDSTLKRLLLVKAEDAADNAPSVSPETPVADALEV
                     MDENDRRYIVVTDGENKAMGYVRRRDLHRQQGTCAQFLREFNATAAYDEHLRILLSRM
                     YEFNRAWLPVLDAENVFLGEVTQESIAAYLSSGRSRGMKTSIVSPAETAAAEATS"
     CDS             complement(51455..52108)
                     /codon_start=1
                     /gene="ACT043"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4576 encoded by GenBank Accession Number AE016853"
                     /product="Permease of glycine betaine/carnitine/choline
                     ABC transporter"
                     /protein_id="BAF32806.1"
                     /transl_table=11
                     /translation="MSFFNVFSQIDWAQVLHLTTQHITLVGIAVTLAIVVGVPLGVLM
                     TRFPALAGPLQASATVLLTVPSIALFGLLLPFYSKFGQGLGPMPAITAVFLYSLLPIM
                     RNTYLALTGVEPGIREAAKGIGMTFGQRLRMVELPIAVPVILAGVRTAVVMNIGVMTI
                     AATIGAGGLGVLILASISRSDMSMLIVGAVLVSILAIIADLLLQWLQRTLTPKGLLK"
     CDS             complement(52122..53015)
                     /codon_start=1
                     /gene="ACT044"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4577 encoded by GenBank Accession Number AE016853"
                     /product="Periplasmic substrate-binding protein of
                     glycine betaine/carnitine/choline ABC transporter"
                     /protein_id="BAF32807.1"
                     /transl_table=11
                     /translation="MKRICLFLGFALLFPAFAQAAEKPLLRVGARVFTEQTILSELTA
                     QYLRTKGYDVQVTGGLGSSLARSAQESAQLDLIWEYTGVSLVNYNHVDEKLDSEQTYA
                     RVKELDAKKGLVWLSPSKFSNTYALALPQKIADKYPQVNTMTDLTKVLKDEAKEGHLV
                     ALDTEFANRSDGLLGMVKHYDMNLGRENTRQMDAGLVYTALRNGQVFAGLVYTTDGRL
                     NAFKLKVLEDDKRYFPDYTAAPVIRQDYLDKHPDIAPLLKPLADLLDTQTMIDLNARI
                     DVGHESPSKVAADFLRQHPLN"
     CDS             complement(53030..53743)
                     /codon_start=1
                     /gene="ACT045"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4578 encoded by GenBank Accession Number AE016853"
                     /product="Permease of glycine betaine/carnitine/choline
                     ABC transporter"
                     /protein_id="BAF32808.1"
                     /transl_table=11
                     /translation="MANRYGKGLLGGAVVIALLALLIHWIGISTIKQYQDDLLFYLQA
                     HLILVLVSMLAALVVGIPAGIALSRPSMVGRAERFMQIFNIGNTVPPLAVLAIALGIL
                     GIGSGPAIFALFLASLLPIVRNTYEGLKNVQGSLKEAAVGIGMTPRQVLWRVELPNAV
                     PIIIGGVRVALAINVGTAPLAFLIGANSLGSLIFPGIALNNQPQLVLGAACTALLALL
                     LDGLVTLASRLWLERGLAR"
     CDS             54089..55672
                     /codon_start=1
                     /gene="ACT046"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4579 encoded by GenBank Accession Number AE016853"
                     /product="peptide chain release factor"
                     /protein_id="BAF32809.1"
                     /transl_table=11
                     /translation="MTQQAAEVAKRRTFAIISHPDAGKTTITEKLLLMGKAISVAGTV
                     KSRKSDRHATSDWMEMEKQRGISITTSVMQFPYRDHMINLLDTPGHEDFSEDTYRTLT
                     AVDSALMVLDGGKGVEPRTIALMDVCRLRDTPIVSFINKLDRDIRDPIELLDEIEAVL
                     KIKAAPITWPIGCYRDFKGVYHLADDYIIVYTAGHGHERTDTKIIQNLDSDEARAHLG
                     DEYDRFVEQLELVQGACHEFNQQEFIDGQLTPVFFGTALGNFGVDHVLDAVVNWAPMP
                     LARVANERTVEPEEEKFAGFVFKIQANMDPKHRDRIAFMRICSGRYEKGMKMRHVRLG
                     KDVRIGDALTFFSSEREQLEEAYAGDIIGLHNHGTIQIGDTFTEGEALGFTGIPHFAP
                     ELFRRVRLKDPLKSKQLRQGLQQLAEEGATQVFFPQRSNDIILGAVGVLQFDVVASRL
                     KEEYKVECAYEPITVWSARWIECADKKKLEEFENKAVENLAVDGGGHLTYLAPTRVNL
                     ALMEERWPDVKFRATREHH"
     CDS             56022..56264
                     /codon_start=1
                     /gene="ACT047"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4580 encoded by GenBank Accession Number AE016853"
                     /product="conserved hypothetical protein"
                     /protein_id="BAF32810.1"
                     /transl_table=11
                     /translation="MTYLIDAWLDRPHPYLRILHRETGEVCAVLEEEALEELRDQGDL
                     DVCSLSSSEPLVLKELVRNLFLFCYARALRPMGELH"
     CDS             complement(56344..57018)
                     /codon_start=1
                     /gene="ACT048"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4581 encoded by GenBank Accession Number AE016853"
                     /product="Peptidyl-prolyl cis-trans isomerase of
                     FKPB-type"
                     /protein_id="BAF32811.1"
                     /transl_table=11
                     /translation="MTVQVLRNYRLRAPLRSSVMSEVNLSTDETRVSYGIGRQLGDQL
                     RDNPPPGVNLEAIVAGLRDAFGGQPSRVGQEEMSASFKVIREIMQAEAAAKAEQAAGA
                     GKAYLAENAKREGVTTLASGLQFEALTSGDGAKPTREDQVRVHYHGTLIDGTVFDSSY
                     DRGEPAEFPVSGVIAGWTEALQLMNAGSKWRLHVPSELAYGAQGVGSIAPHSVLVFDV
                     ELLDVL"
     CDS             complement(57115..57423)
                     /codon_start=1
                     /gene="ACT049"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4582 encoded by GenBank Accession Number AE016853"
                     /product="conserved hypothetical protein"
                     /protein_id="BAF32812.1"
                     /transl_table=11
                     /translation="MNYQEFTDHAQAGRVEELNLISIEGGIYLLDVRMNGTSVMLKDA
                     AGKTLHLRSVEHARELLKNVPVVPFYLVHCVVHDELCGMPVNDRSEMRMPISFHSSWS
                     "
     CDS             complement(57531..58019)
                     /codon_start=1
                     /gene="ACT050"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4583 encoded by GenBank Accession Number AE016853"
                     /product="conserved hypothetical protein"
                     /protein_id="BAF32813.1"
                     /transl_table=11
                     /translation="MERFFENAMYASRWLLAPIYFGLSLGLLALCLKFFQEIFHVIPN
                     IFSLAEADLILVLLSLIDMALVGGLLVMVMISGYENFVSQLDIDEDKEKLNWLGTMDS
                     SSLKMKVAASIVAISSIHLLRVFMDATNIKPEYLMWYVIIHMTFVISAFAMGYLDKLT
                     KH"
     CDS             complement(58146..58475)
                     /codon_start=1
                     /gene="ACT051"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4584 encoded by GenBank Accession Number AE016853"
                     /product="conserved hypothetical protein"
                     /protein_id="BAF32814.1"
                     /transl_table=11
                     /translation="MQRSLCLTRECMGLMTRIECVIRPLPHDNGQWVVLFAAGMAEEQ
                     PSAIKSQGPFNGMPEAQSVLSSILENLSLHGYRCLDDVPIWSLHLQAELRRIGSDGAV
                     CQRSSLF"
     CDS             complement(58650..61085)
                     /codon_start=1
                     /gene="ACT052"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4585 encoded by GenBank Accession Number AE016853"
                     /product="ATP-dependent protease"
                     /protein_id="BAF32815.1"
                     /transl_table=11
                     /translation="MPDSVAANLRLAPHALTRPFSAEQFSFATTHELEPFRGVLGQER
                     AVEALQFGVAMPRPGYNVFVMGEPGTGRFSFVKRYLKAEGKRMQAPSDWVYVNNFDEP
                     REPKALELPPGTAHEFMADIGGLIDNLLVTFPAVFEHPSYQQKKSSIDRAFNQRYDRA
                     LDVIERLSLEKDIALYRDNSNIAFTPMADGKALDEAEFSQLPEADRDRFHEDISSLEE
                     RLNEELASLPQWKRESNNQLRQLNEETITLTLQPLLAPLSEKYAENAAVCAYLQAMQV
                     YLLKTLVEQLVDDAKTDAQARKLLEEQYSPSLVVGNTRDGGAPVVFEQHPTYDNLFGR
                     IEYSTDQGALYTTYRQLRPGALHRANGGFLILEAEKMLSEPFVWDALKRTLQSRKLKM
                     ESPLGELGRVATVTLTPQVIPWNVKIIIIGSRSLYYTLQDLDPDFQEMFRVLVDFDEE
                     IPMVDETLEQFAQLLKTRTSEEGMAPLTADAVARLATYSARLAEHQGRLSARIGDLFQ
                     LVSEADFIRQLANDDKTDAGHIERALKAKATRTGRVSARILDDMMAGVILIDTDGAAV
                     GKCNGLTVLEVGDSAFGVPARISATVYPGGSGIVDIEREVNLGQPIHSKGVMILTGYL
                     GSRYAQEFPLAISASIALEQSYGYVDGDSASLGEACTLISALSRTPLKQCFAITGSIN
                     QFGEVQAVGGVNEKIEGFFRLCEARGLTGEQGAIIPHANVTTLMLDERVVQAVRDGQF
                     HIYAVRQADEALSLLVGEPAGAPDENGEFPEGSVNARVVERLRDIAEMLSDEDLKEEL
                     EKEPAQLQPELKI"
     CDS             61293..61850
                     /codon_start=1
                     /gene="ACT053"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4586 encoded by GenBank Accession Number AE016853"
                     /product="conserved hypothetical protein"
                     /protein_id="BAF32816.1"
                     /transl_table=11
                     /translation="MAACLDVITQETRPLAELKREKAMKRILLGTLFAAVSINAMAQA
                     PGGPDCGWGNMLFEGQRGTPAHFLASTTNGTSGNATFGMTSGTNGCSTNSALTYGGKS
                     WLAMNGMMDELSKDMAMGQGEALTTYAVVLGVAPEDREHFAAVTHEHFSQIFSKADAT
                     AEDVHTNTVNVLKNDPTLAKYATQA"
     CDS             61913..63766
                     /codon_start=1
                     /gene="ACT054"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4587 encoded by GenBank Accession Number AE016853"
                     /product="conserved hypothetical protein"
                     /protein_id="BAF32817.1"
                     /transl_table=11
                     /translation="MLKRLVTLALFVCAPLSAAPHATADRLQQMANEPFWISLGHYEA
                     GKLGGWRSYVTDPKFFLAADGAHDPKAELSATLEAIYAPVTNEQTHAQCVYPARTRWL
                     RDQLHLTDLPTPDCKEFKAWYKDVAPDSTVLIFPAAYLNSPSSMFGHTLLRIDPASAK
                     TNNTTLLSYAINFGAYIEGMDNSILYAWKGLAGGYPGLFALVPYQEKLSEYRSLENRD
                     LWEYRLNLTAEETGRMVEHVWELKQIRFSYFFFDENCSYRLLELLQVARPGLHLTEQF
                     GLTAIPTDTVKAIKAAGLVEKIDYRPSRERELLSRAAPLDADEQQWVLNVSADQKQLQ
                     DSQYLAQPKERRALIQDAAYRLERYRANGLERDTQRSQRSFELLQAINQNPPPQLDIP
                     RPGLPEEGHESRTWQLGAGTRGDKAFAEYGLRMAYHDLNDNAYGFPLGAQIEILQLKV
                     RQYEGNDWQVQQLDLATIRSLTPRTELLKPWSWQVTGGLERVLGKHGDENLVSHVNGG
                     GGGTWQLGDEVLGFALGTVRVEHNNDFAEFISPAAGFNTGVLWRNPLGNLSLEAKGDY
                     FTNGEVRRSVSLNQQWELSRNLGLRLSAQREFSQMSSPQNEVMLEVKWYHY"
     CDS             complement(63705..64238)
                     /codon_start=1
                     /gene="ACT055"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4588 encoded by GenBank Accession Number AE016853"
                     /product="Type III effector Hop protein"
                     /protein_id="BAF32818.1"
                     /transl_table=11
                     /translation="MKKSGAGTQAYALFASATGSSSKGVLSALARHLTGCFAPNKAAL
                     YAATAVGYETSPGSYSVAASVHALSVDHRQPALTRLNNVLFNQALALDLERFDEVVPA
                     EEMFRPSLKRKGAHPRLVDSLDGEHLTVQTMEKGLKRLAEDPAQSFARCHCVFYPISS
                     DTTSPQASLRSVASSSG"
     CDS             complement(64253..64726)
                     /codon_start=1
                     /gene="ACT056"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4589 encoded by GenBank Accession Number AE016853"
                     /product="conserved hypothetical protein"
                     /protein_id="BAF32819.1"
                     /transl_table=11
                     /translation="MIAFATGLLEHSLKRLGYDAADLHSLRDEGYLLWHGKNGHTSLL
                     VPAAGGDALFVISTLSYIDPEQDGRLLALALHLNLSPAHTLGASIALDIEQNTLCLRY
                     THDLTGHGTDSLSRALESTQALAEQIKQVIETFRSEFGRPPMRAHTARRPDAVAL"
     CDS             64896..65249
                     /codon_start=1
                     /gene="ACT057"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4660 encoded by GenBank Accession Number AE016853"
                     /product="lipoprotein"
                     /protein_id="BAF32820.1"
                     /transl_table=11
                     /translation="MKQYWLLLSLAIVLAGCQSTRDQMLAEGYPPGFAEGYQDGCGSG
                     RDAAGASTGQFKKNVPRYLKDKLYAEGWTDGFRQCQASQDNRDRLDPGQVFNDRDRAW
                     EREKTRSAAKAYRPN"
     CDS             65325..65822
                     /codon_start=1
                     /gene="ACT058"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4601 encoded by GenBank Accession Number AE016853"
                     /product="transcription elongation factor"
                     /protein_id="BAF32821.1"
                     /transl_table=11
                     /translation="MSRAFVNEDNAAADAEQPVERLVSAQTNYVTAYGLTLLKEHVGS
                     LQAQHSAQNALGEATDKQRLADLERDLRYFTQRLQSAQVVAPALSTEKVQIGSWITFT
                     DEEDNHQRVQLVGEDQADATRGLINWGSPLGSALLGAQKGDEVMWKRPAGDQTIEVLL
                     IEPDH"
     CDS             complement(65875..67566)
                     /codon_start=1
                     /gene="ACT059"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4602 encoded by GenBank Accession Number AE016853"
                     /product="ATP-binding protein ABC transporter"
                     /protein_id="BAF32822.1"
                     /transl_table=11
                     /translation="MSKTDKAGKTGSYVYTMHRLSKVVPPKREILKNISLSFFPGAKI
                     GVLGLNGSGKSTLLKIMAGVDTEFDGEARPMPELNVGYLPQEPQLDPNKTVREVVEEA
                     VSVIKDAQARLDQVYAEYAEPDADFDKLAAEQAKLESILQASDGHNLERQLEVAADAL
                     RLPAWDAKVSVLSGGEKRRVALCRLLLSAPDMLLLDEPTNHLDADSVAWLEHFLHDFP
                     GTVVAITHDRYFLDNVAGWILELDRGAGIPYEGNYSGWLEAKSDRLAQESKQQTAHEK
                     AMKDELEWVRKGAKARQSKSKARLQRFEEMQSQEFQKRSETNEIYIPAGPRLGDKVIE
                     FKNVTKGYGDRVLIDNLSFSMPKGAIVGVIGGNGAGKSTLFRMLMGKEQPDSGSIEVG
                     ETVQLACVDQSRDDLDGSKSVFQAVSDGSDVIRIGNYEIPSRTYVGRFNFKGGDQQKF
                     VKDLSGGERGRLHLALTLKEGGNVLLLDEPSNDLDVETLRSLEEALLDFPGAAIVISH
                     DRWFLDRVATHILAYEDDSQAIFFEGNYTEYEADRRKRLGEAAAQPHRVRHKKLA"
     CDS             67714..68976
                     /codon_start=1
                     /gene="txi1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="identical to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4294 encoded by GenBank Accession Number 
                     CP000058"
                     /product="tyrosine recombinase"
                     /protein_id="BAF32823.1"
                     /transl_table=11
                     /translation="MGFQVIEQVVNAARRKLLVQDYIPVYYPNLYITMEHSGRALETT
                     KKYLEHLVVLEEFLAFSSIDLISHLEQRPHSEYLTDSELSRFVSDAGFSKQTLDMKYA
                     GMRLHPTAYKSVGKVHAQQRIEAARDYLAFLYDKLGDHSTRYEAVDDLKKRINRKIKA
                     ARPAWRKTRTEEMKGLTSQERTRLLEIMHPDTAENPFSDEAIRLRNYIILLLGLDMGL
                     RRSEMLLIKTSDIHWHSRQLAVVNLEDEGLDPRTMAPQFKTNERMLVMTDDLYDAITE
                     YESKYRNRKPRSGASLARRHPFLLVAHKRNEGGPLTIKAVDGVLSRVREIAPELAHVH
                     PHLLRHDAVYTMLESMREELAVLTPEDRTVQVQKTLTWMFGWSPDSNMPGHYGAKFWK
                     EEADKAIQKRAKRFTASRQKADTTRGGS"
     CDS             68976..70574
                     /codon_start=1
                     /gene="txi2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="identical to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4295 encoded by GenBank Accession Number 
                     CP000058"
                     /product="tyrosine recombinase"
                     /protein_id="BAF32824.1"
                     /transl_table=11
                     /translation="MNIPVEALQAPKESTLDAWLNTPRLAKCGEVFTPADPMWKPDKS
                     ASDSVNWKAAIACVSPDWRPWLHAALVYRMVNVAARTVANTASVLSRAAQAGLDPLNE
                     GQLIALRERFSDKEFSVMASFIAFWHDCESLEQRPSQSLIDAYKGLPRKKNSSNDVIL
                     SLDPEEGPLTQVEQDALHQWIHEQFCHGQLDFEQYIYLRMLMIYGQRGYQVRMMVFGD
                     FTKSEVKFHWAKQKGDEAGWRKKSETFRLDEDLYNTVQAYKAMILAQLWQTYPSGVDW
                     NVAIQNVPLFRKKLDHDAAEAWKRRWNPPVLLDSPLQKALEDAPQPLFHVGSGTVKQW
                     LHHIERMESFPISPRTHQPLKVAGHRFRHTLGTDLSNAGLSEFAIARALMHSDTRTVR
                     KYRAVSTELLALIDAKMNDHMALIVNAFTGIIVTDLTSAINGDRADRLIEDVAVCGAT
                     TACLLDAPYTCYACGKFQPLLHANHREVLERLERRREQTIATDKTTGVLWDRAILACR
                     KVILDCEAMHRSSDSRAQKNDRSV"
     CDS             70558..72792
                     /codon_start=1
                     /gene="txi3"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="identical to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4296 encoded by GenBank Accession Number 
                     CP000058"
                     /product="tyrosine recombinase"
                     /protein_id="BAF32825.1"
                     /transl_table=11
                     /translation="MTEAFDSEPPNNIVDFKPKSQLDPEAHLVAFIEWAKNTLPKGIP
                     NRVNASIRWEDGSWHSHGLLGCSFTALGSTFSARKTMQAPFTEFTKAILVYRRVYLQK
                     KGMSDWMNALRGLEVALFELTGTLDVTRVSAAVCNNACEHMKRHWTKGNTAYLYSKSL
                     EAIIALMLAKKLLKSDFRWTSPLKQSQRGTLKQQREDREKKLPNPEAIRALGEVFTNE
                     LTSRLDIVVTSACALLLSAPSRVGELADIPLDFLLFKEDAQGNRRMFLRWYAEKMNQV
                     TAKPVVIPEMEPVVERVITLLKPITDEARAYAAWLEDHPDEFPPHAGVPLKGADEPLT
                     YGEACAALKLAVNKGYARSVFNINLLKSLEKQKALSPAARALLTEIRDGWDSSRGKRI
                     HVKGKIGVQGWEFDDRCVITLRKLNMLLREKYLPKDFPYTTPYTEGKARLKYRDALFT
                     MRTGVLAGDSGTSGAQLGFGVEIAANTGRMNAQLGGTNNPAVKSLFERYGYPGVKVNT
                     HAFRHELNTQMRKAGLSQLLIDAFSGRSSMGSVYNHETVEERTQGVAAYHPKTKLGTA
                     ALRLDKVKTNQPLSLADVRELREGEQDRIIHQTHLGVCVHNFASEPCPKMGACLDCGR
                     LGCVKGDDVKLGNLKEERDDLKRRLDKALDAQSRDVFGASEWAKKLGEKLFKCEELIQ
                     TLENPGLEKGAIVWNADNGWTLTKNAVAMSGLIAVKVIEEHPAQEALSSLDDVLALLN
                     EIEG"
     CDS             72795..73193
                     /codon_start=1
                     /gene="txi4"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="identical to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4297 encoded by GenBank Accession Number
                     CP000058"
                     /product="conserved hypothetical protein"
                     /protein_id="BAF32826.1"
                     /transl_table=11
                     /translation="MGHLTPKDEKRIIKLIEEWSEPKLTWPLLVEACKEKLGISRARQ
                     SLMNLPAVDLAMKNCKAALKAQKLKPGWISDIQAANEHIEKLTANNQKLLAAVRDMHS
                     RFLIWQANADMHGLTQSMLERPVSQLQKRS"
     CDS             complement(73611..74417)
                     /codon_start=1
                     /gene="txi5"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="identical to ISPsy5 truncated transposase encoded
                     by GenBank Accession Number CP000058"
                     /product="ISPsy5-like transposase"
                     /protein_id="BAF32827.1"
                     /transl_table=11
                     /translation="MRPDAKVEKVYLYPKPVDFRKSIDGLSALVELDIKVAVFDPVLF
                     VFLPTRLLEGYRGYLMTDDYAGYNALGAQAGVERLGCWAHARRKFVEARKVQPKGKTG
                     RADIALNLINKLYGVERDLNDACDDDRKTGRHDRSLPVLAQLKNWMEKTQPQVTSQNA
                     LGRALGYLASNWKKLERYVEEGYLPIDNNAAERAIRPFVIGRKNWLFSDTPKGASASA
                     QLYSLVETAKANGQEPYAWLRHALERLPLATSVEDYEALLPWSCAPRLHS"
     CDS             74419..74865
                     /codon_start=1
                     /gene="txi6"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. phaseolicola
                     NPS3121 encoded by GenBank Accession Number DQ141263"
                     /product="transcriptional regulator of Sir2 family"
                     /protein_id="BAF32828.1"
                     /transl_table=11
                     /translation="MASWLLRESGAQHPGSVKRFECGVYGAVTFDQQFVSDGLSVEPP
                     RCPRCNGKLRPGVVWFGEDLPIAVWKRAVGAAQGCDVLLSIGTSGVVFPAAEIPRIAL
                     KSGARVVHINTTETPLESPLEMSLIGRAAVCVPAIVSQIAAPGKVV"
     CDS             complement(75442..76035)
                     /codon_start=1
                     /gene="txi7"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="dentical to Pseudomonas syringae pv. phaseolicola
                     NPS3121 Ptx22 encoded by GenBank Accession Number
                     DQ141263"
                     /product="uncharacterized conserved protein"
                     /protein_id="BAF32829.1"
                     /transl_table=11
                     /translation="MSGIAIGIVLTLSLTASRGGRAQSIVDLLYVGGRSHLTLLLSYL
                     AFDLINSLVALVISEFYSYLVPFMLDWLKVLVCVFFTCFAAVNLYKVFAGAAVSPEFG
                     EAHGFRYILASSLKNYGLWFDALFPIPLLIVFFARAGFQSWQILAGMMLGYVGWYTLL
                     VGVTANKLAYQNLMWFAATCIMVLIDCVLIGMLLFYK"
     CDS             complement(76092..77351)
                     /codon_start=1
                     /gene="txi8"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4299 encoded by GenBank Accession Number
                     CP000058"
                     /product="hypothetical protein"
                     /protein_id="BAF32830.1"
                     /transl_table=11
                     /translation="MGVVPMKKIILIETSDVATRYSALAVLKLGFEPLFIIGSARYYQ
                     GDTFTQLMEFPYLECGDTTNVDAVLKLIGALPKDSIEAILSLVETRIPIAVELASTLG
                     VKGLDCALARLGGKEYVSSLIPEYSPISMEVGEFSNFSMLVRGPFAHCKKVIVKPVRG
                     SGAAGYAEFSLSDSEFNEKILAHIQSCALSLGAHEFIMQEYVDGELISLEGYAVAGQC
                     HFLGVSLRRKIANTESVNYFPASKYFTEEVIQRAKLAVEAIVLRSGLQQGYFHSEFKI
                     GPKTAVLIDANFGRVAGAAISEQIALSYQCDPVYFFKHVIEVGCLQSEATLNVSSPID
                     TISIFYGLPVQARINDIKFSLDWSLNHTRVLDIFTSVDPMGRDDWGWIALVSGRAQDV
                     RRQIDGLLIVTDKGTYTPFYIDSSEPL"
     CDS             complement(77471..78688)
                     /codon_start=1
                     /gene="txi9"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="identical to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4300 encoded by GenBank Accession Number
                     CP000058"
                     /product="membrane protein, putative"
                     /protein_id="BAF32831.1"
                     /transl_table=11
                     /translation="MISYLKNPAVSARVILIFIDRVVEKSIVAMMTIVISLQFGVERA
                     TYALITAALLTVVGSIAIDALARKVDKWAIVLVSEVVRGAILLIFAVVISYCPKTYIV
                     YLLFLVSVSVLGGISATLSESLLIEMTKNIDRAVLYSLIYWVRNLALILGPLIVMLVY
                     PSGFIGYIGFVGLVSVVLTGILFFWCKVPVTLNVETSNAGSLFGSLSVASKDRSFIIF
                     LLASTIMSTIALMPSHYIAVRLAVDFSSIPMTIFFREFSLSGVDLSNLMRSANSLFVL
                     VLTLPVYYLKPKLSEMQLLVAGMLLFGLGFTIASMSSGIFVLLVAVFLYSLGATLFVP
                     IHFSIFARLCNDEHRNIYVAVSEQDIRVAALLSALSLVLVNSVNSSWVALLVAFLSGL
                     TLWLYQRVLRDVQ"
     CDS             complement(78848..79495)
                     /codon_start=1
                     /gene="txi10"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. phaseolicola
                     NPS3121 Ptx19 encoded by GenBank Accession Number
                     DQ141263"
                     /product="adenylylsulfate kinase"
                     /protein_id="BAF32832.1"
                     /transl_table=11
                     /translation="MATNTPVRYQERIRMSKNDNVVWQLGTVSPVERHRNLNQAPMTL
                     WFTGLSGSGKSTLAFNLERLLMRRGIFCAVLDGDNIRHGLCKDLGFDAESRAENIRRV
                     SEVARLMNDAGLTVLAAFISPHSSDRALAKEIIGDDRFSEVYVSSPLHICESRDPKGL
                     YKKARQGELANFTGIDAPYEPPPYPSVCLDTSSLSIEACLEILLSEVERNRGSSK"
     CDS             complement(79576..80841)
                     /codon_start=1
                     /gene="txi11"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="identical to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4302 encoded by GenBank Accession Number
                     CP00005"
                     /product="conserved hypothetical protein"
                     /protein_id="BAF32833.1"
                     /transl_table=11
                     /translation="MTNILMVDCTDVSSRAIITARQIGYNLIFLRTEMTRLFSSLSEE
                     FLIENTYKLYSIDSCLDLVAFEEKVREINEAHPLSVMFTPLEDIVESVSTIAANLGIR
                     ATSIEGVKNAKNKPRARALLHRNGLSNCTYKKCASLDALHEVVAKIGIPCIIKPAKGF
                     AKFLTAHIKNQQDVDKFIADYNDARGKLDDIALSQVSLDFVIEQYIDGKMYSVEVAKN
                     EQGFFPLMLTERHRSEHNDILEIGSIMAPAGFFPREQEIFDYCEKVLACLSLDVGVFH
                     IEIIVSDKGIDIIEVNPRLMGGALGTLYNKSTSLSIYEIVFNAYIGSQVKCRPASALF
                     ATARRIAPIASGTAQKNIGKLFIEEHCPWVLEHSINIVEGQAVLPMIDNDTSLGYLHV
                     VGVTYQDSVQKAKTATQLIQRALGVSLSY"
     CDS             complement(80901..81998)
                     /codon_start=1
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /gene="txi12"
                     /note="identical to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4303 encoded by GenBank Accession Number
                     CP000058"
                     /product="L-arginine: lysine amidinotransferase"
                     /protein_id="BAF32834.1"
                     /transl_table=11
                     /translation="MQLNEKDSNVIQTSPVCSYTEWDLLEEIIVGVVDGACIPPWHAA
                     MEPCLPTQQHQFFRDNAGKPFPQERIDLARKELDEFARILECEGVKVRRPEPKNQSLV
                     YGAPGWSSTGMYAAMPRDVLLVVGTDIIECPLAWRSRYFETAAYKKLLKEYFHGGAKW
                     SSGPKPELSDEQYVDGWVEDEAATSANLVITEFEPTFDAADFTRLGKDIIAQKSNVTN
                     EFGINWLQRHLGDDYKIHVLEFNDMHPMHIDATLVPLAPGKLLINPERVQKMPEIFRG
                     WDAIHAPKPIMPDSHPLYMTSKWINMNILMLDERRVVVERQDEPMIKAMKGAGFEPIL
                     CDFRNFNSFGGSFHCATVDIRRRGKLESYLV"
     CDS             complement(82102..82884)
                     /codon_start=1
                     /gene="txi13"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="identical to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4304 encoded by GenBank Accession Number
                     CP000058"
                     /product="HAD-superfamily hydrolase of subfamily IIA"
                     /protein_id="BAF32835.1"
                     /transl_table=11
                     /translation="MKIKALLLDIDGTMVFKGHAIPGAAEAIEAARMAGLQLRFLTNI
                     TGQLPSTIAEDLQRHGINVRAEEIHTASTSCARYLKSLGDVSCFFLMPESVNSMFEGI
                     ARDHVSPDVVVIGDIGESFDYACLNQAFGYLHKGARLVVPHKNLFWFDPRGVRLDCGA
                     FILGLEAASGKQALVTGKPSPVFFTSVMDSLGVKPSQTMIIGDDLLTDIAAAQHLEVA
                     HALVLTGKGASYTESDVPRPERLWPSIAELSRFLAQSGHNTD"
     CDS             complement(82881..84494)
                     /codon_start=1
                     /gene="txi14"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="identical to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4305 encoded by GenBank Accession Number
                     CP000058"
                     /product="hypothetical protein"
                     /protein_id="BAF32836.1"
                     /transl_table=11
                     /translation="MSRQSLLWLLVDGLSRDLYQRLRNRMGIQANHAATLEPLFPNCQ
                     TPPSLFSIWSAEPVARHGLTGYEIPEAVAGNPAHWRDAFQVWPRESLMAWDYFAQAGR
                     AIRTCGVPFVQPERLGAQLLSHTEVYLNPVLPLSIVRAGECLRCEALGLSFRVHADEV
                     AMVLVDEQGKQARIALDETRHLPLSPAIPVGAGGESHRAFAVRAVIIDQQLCLCVLGF
                     QPIRVHGSLAGERRRQLMDRAYVAGNPGKLYAAGELGGRLNEGGSGAAELLLLDLLDS
                     VHQSFVADVVLALEAGDSDLTVAYYPVIDLVCHQLLRYLEDASTPQLLFEAIEQRLAR
                     WLDELFAACQTASGKETRFIAHSDHGMQPIWWDIRPNRLFLELGWLALDAQGNLDAQR
                     SNVFFHPAENGLLVLRLEPAGIGMLGAPQVLDALQTAFAELGEGGFTLLQGAAATLGS
                     GWRSDLYLQPPPGVRVRADHTGALIESSRKGGDHSVWSDAASLKGVLLELGAAPSRPW
                     PQPLCLEQLLPRLLNDLFISNPLTAPGIS"
     CDS             complement(84491..85093)
                     /codon_start=1
                     /gene="txi15"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="identical to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4306 encoded by GenBank Accession Number
                     CP000058"
                     /product="hypothetical protein"
                     /protein_id="BAF32837.1"
                     /transl_table=11
                     /translation="MSFSQSTRGGAIRLSIVAPSGSGKSTAANYLYEYFTHLGLKVQV
                     LKLAAPLYRLQARFYSEACTALSPGAQDQKLLEQVAGQLRFINPFALVKAFAQELEKT
                     EADVVINDDLRDDQTDWPYLRENGFKVIKIVTDPLSRQRRLESRKDISVIHNSALDFQ
                     IERIHADFTLANDSTPDAFRHQIQELANHLMSSLPAGLQA"
     CDS             complement(85106..86170)
                     /codon_start=1
                     /gene="txi16"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. phaseolicola
                     NPS3121 Ptx14 encoded by GenBank Accession Number
                     DQ141263"
                     /product="hypothetical protein"
                     /protein_id="BAF32838.1"
                     /transl_table=11
                     /translation="MGYLLSNGVFRLSLQVEADPAGLVPRLMAFFTPYLMVDNSDAPA
                     DLTVCLHAPQAFETPWKTRCQIPHLIRETYAVGFTLKVWRGDLPNGESLAWDPEKQVG
                     YRYRMSTRKVDFYGAEDAFIHLIELVRYYGLLVESAKGSAVLHSSAVVSRSHKAVTAF
                     AGVKGAGKTTTMLEYVLAGEHDYYSGDKLLLDVQDGRVRARGWPDYPHIGLGSLRQHP
                     CLIEEFPELAGLINDPACADRHKVLIAPERFAQVFGRAPTGSSWLDEVVLPEVMQSAE
                     RSRQSLSTVEILALIDGDSVFEWPAQFTTSTWHGIPPARTDIPCALSDALREALSRVR
                     WTYSPGRSSTSTHDNQATTA"
     CDS             complement(86239..88170)
                     /codon_start=1
                     /gene="txi17"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="identical to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4307 encoded by GenBank Accession Number
                     CP000058"
                     /product="phosphoenolpyruvate synthase"
                     /protein_id="BAF32839.1"
                     /transl_table=11
                     /translation="MSGKYLTLKTLAQRTSVPTLVGLQESDFKRLWHNYEELQKQLRD
                     VLQVIQLTAGAFLDKHLEQLQLLAPVQWRPDARDYLESRLTEADINIHQPLAVRSSCA
                     IEDGASHSFAGIFDSWLDVSGWDALFDAIEGVWRSGFSHRAIVERLRCELLDASVGMT
                     VIVQHMVAARWAGVAFSHDPLDGSAVPLIEAVAGAGDALVSGASQALSVRLLANGDFT
                     GAPQLLAEPAMLSSIAELLSLARQHLHAPADIEWAWDGQQVWLLQARVIASLRNLESS
                     APLCHWVDLYTAADPELEPFRPWPDFAQYFRSKRRPLALLALDHGVEAGSALLIAANA
                     GGMTQAHSDALLAQLHSDQVVLDFSAGIRQQILPRAQLPARLRELLGAQTQVFVVRDF
                     IRGDAGLITQSLGSTSYAGQVLCEYSPDGLLAINRGSASTSTWRIDADGLAPGHGLST
                     GTLDLPLNPHQRRQLVIVTEAAIAGLGEVQLEWVVDRGQLSLVDFSPLKSQFLVDDRA
                     GERTISPGFARGLSLVVDECAQIEEISIAATVSINNLPSPETLGPAIMRLMQRIEQAK
                     APIVMVSPRPYAALAALIPYVSGFIFESSSLLCHLAILLRESGVPALASPALYRAALS
                     TPGNVLVQANQRPLETIPG"
     CDS             complement(88251..88811)
                     /codon_start=1
                     /gene="txi18"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="identical to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4308 encoded by GenBank Accession Number
                     CP000058"
                     /product="deoxycytidine deaminase"
                     /protein_id="BAF32840.1"
                     /transl_table=11
                     /translation="MILTGNEITNRVIAGDIVISPFSKNSINPNSYNFRLHNHMKVYE
                     DGIIDVKSEQPTRDIYIGSEGFVLEPMRLYLASSIETMGSTRFVPTYAARSSIARLGM
                     FINLSAPLGDIGFIGRWTIQLLAVNRIRVYPGMDIGQMMFWHVQGEIELYNGKYQGAK
                     EAKASRLFMDYATTLKESSVLESQEI"
     CDS             complement(88808..89326)
                     /codon_start=1
                     /gene="txi19"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="identical to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4309 encoded by GenBank Accession Number
                     CP000058"
                     /product="deoxycytidine deaminase"
                     /protein_id="BAF32841.1"
                     /transl_table=11
                     /translation="MMLTGSEIQRMRELKRIVIEPFDPRLIEQNSYACHLGSEIIEYD
                     AEQIDPHEGLGTIQHTIPEEGLVLQPRRFYLGSTVECIGGLDFASELYANLSTALCGM
                     FIQTSAPLGHTGATICWTLEIVVTQPLRIYAGTKIAKVCFWKNFGAVRAYEGRYAGSQ
                     SVVPSRIIMDQP"
     CDS             complement(89374..90357)
                     /codon_start=1
                     /gene="txi20"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="identical to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4310 encoded by GenBank Accession Number
                     CP000058"
                     /product="fatty acid desaturase"
                     /protein_id="BAF32842.1"
                     /transl_table=11
                     /translation="MSLATAVVCERKERCRHEKLRVDPHVVHDLMKLRPGKCFIQIGM
                     QWLLIVFAVFFAKWASSWLAYSISIVWIATRQHALLVLMHDASHYLISRRRWLNDTVG
                     NLFLAFPLSVCVSRYRRHHLLHHRHLNTELDPDIKDSQLPKTRIRFYGLLLRDALGVS
                     TLMTLRSVNNFGLLGLFARGSHASRLDRRLAMAFIIAVGGGITWVGGGWDVLWLWVVP
                     AFTILPLILRVRSIAEHGGRLDHPNASNARSIDVGIIERFLWAPCHINRHWEHHLCPA
                     VPTYNLSLLTARLASFFPQSSAAQRTQGYFFSARSLVSELYPNTTPPWLAD"
     CDS             complement(90363..91499)
                     /codon_start=1
                     /gene="txi21"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="identical to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4311 encoded by GenBank Accession Number
                     CP000058"
                     /product="fatty acid desaturase"
                     /protein_id="BAF32843.1"
                     /transl_table=11
                     /translation="MSAQTPLQLILTGANGTLGIPLVRSLLQQSLQLQLLCLLRTQTS
                     CDELAATLSAVERARVEFLVVDICDAGAMAAAADSRPKLECALGIHLAADVSWDKSCE
                     DMTALNVGGSENFCRFLLRQADRPALIYVSTAYTQVEDWEYRNGYEESKAMAERSLRA
                     NFGERISISTFSCSLVVGDSKTGAISRFNGLYPLIRFMAGFSPPFLVGNKTGLLDIVP
                     LDWVVGELRAMIIRFAASGVAEQVVASAGDKRIGYEHLVRLVENQLGEARETAGLGAQ
                     DPVPILKSRQWDFLKRSLSAWSPEGISKNEFRYFERLLQVYGVYASSDRVRAPLNVSR
                     PSPDPVEFLPQVIKFWLQQHPRAFRSRSLTSSEVQGAATGLVEE"
     CDS             complement(91503..91967)
                     /codon_start=1
                     /gene="txi22"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="identical to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4312 encoded by GenBank Accession Number
                     CP000058"
                     /product="conserved hypothetical protein"
                     /protein_id="BAF32844.1"
                     /transl_table=11
                     /translation="MPAVNTSLNLGSLELERVWSTLCEFQRYPEFMKDVLDVTIEQRT
                     GNEIISTWRVLLNGSELTWTERDLLLPDHRIVFQQIDGDLEVWSGEWSIQQAGDDLSV
                     QLDVLFDLGIPSLADVLHPIGERAIRANSRQMLEGIRDRILLSQLSTVAVEA"
     CDS             complement(91955..93139)
                     /codon_start=1
                     /gene="txi23"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4313 encoded by GenBank Accession Number
                     CP000058"
                     /product="ornithine aminotransferase"
                     /protein_id="BAF32845.1"
                     /transl_table=11
                     /translation="MLKMSGLSASEARGDGAWVEDTQGGRWLDFGSFGVHLLGHSHSG
                     VVSALVEQIQRFGLSTKILSNEPIVLAAERLLVMAGPEKDKVIFGNTGSEVVEAALKL
                     ARIVTGRRRVIAFEQAYHGRTAAALSVSHGYMRHAGLLTEGDVVFCPIDDLDAVANAL
                     EAGDIAAIIIEPIQGEGGIRPVENEFLRGLGDLAQAFDCRLIFDEIQTGLGRIGSLRV
                     DVPCDILLLGKVLGGGVFPISAALFTSKRFDAAARDPVVHASSFAGSALAGAVVNAVL
                     DVVSAPDFTLRVQRLGDRVLSYLRQRLADNPLITDIRGQGLMIGVEFKRLDHVGEMII
                     EAAKRHLLLAFCLTDPKVLRLYPPAVISDADLETGLEHFCQSVEAITRTEFDKEIPLC
                     QQ"
     CDS             complement(93244..93789)
                     /codon_start=1
                     /gene="txi24"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4314 encoded by GenBank Accession Number
                     CP000058"
                     /product="conserved hypothetical protein"
                     /protein_id="BAF32846.1"
                     /transl_table=11
                     /translation="MFEARQDSTLRWFPRLTGGVGVEGNSMARAIVSAAWLVMSELYA
                     YLEDLEGAMDAPDASVLIKVKIAELLVQIDCTLGRTAVLDEEHRLPWLLEYGLCEVIN
                     LPGADMARLLGLFAANDATEIRRVSQLIRDLIAAFPGELVDSLQAHNQGRVLRFLRSS
                     DKACTALGCDASFLVPLMKSL"
     CDS             complement(93800..94690)
                     /codon_start=1
                     /gene="txi25"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4315 encoded by GenBank Accession Number
                     CP000058"
                     /product="hypothetical protein"
                     /protein_id="BAF32847.1"
                     /transl_table=11
                     /translation="MLCVVDEPVSTEQMATQIHQEGLHLELLLFNAADVHLALGELTS
                     LAQSPALICLQNYSRWDKRNKVPRKYVERLVYGVTNDLTTPYLSALGDLCVVVSRKDL
                     DVFRVNVACSRLAQRSDEPFAAIGYLMNALTAAMNSLLSMSGWVLSNKKWTLRRWNKS
                     RDLVFLDLCPTTWTEVSALWADLAKGPAVLDEALSRIETLLQQMTGRLAPELLRDEPF
                     TGLQGNVARYPLHGQAALVCAGNGYVRLAENVPAGVTLAQCFADLCQLPPLSALEHLQ
                     AIRAGTWSPSLQRQSGASAS"
     CDS             complement(95072..96118)
                     /codon_start=1
                     /gene="txi26"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="identical to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4316 encoded by GenBank Accession Number
                     CP000058"
                     /product="hypothetical protein"
                     /protein_id="BAF32848.1"
                     /transl_table=11
                     /translation="MQRVVITGSWRLRVGEPEVGVELNVCPVDAPIDFDRPMTLVDLR
                     PYGLNNLAHRDVPLALAYFDGDTLYLKALLMRQEMHVCHFYSPMTLPSCNKDRVSDVL
                     AEAFQKWHLTLNNFECCFFEAPPGMAFACHFEIDLPASHAADMVIEHLDTLQWPQFYL
                     HLGSELSSIRSRKAVYRCPSSSEWLTVERGCRRKKSINSTGLRIEVFSHAGNGWVRSD
                     VIESLNDDVDKELLQFRGDSDPDKLFKHSHDLYVSGSRVGVESAISGGIYELDFCFFQ
                     SAGAQQSNSREECTARSVVIRYVGGRKPFDMDCVQSDMSALSSCLVNTLDLDSSTREL
                     SELPSWTWNHFDIA"
     CDS             complement(96124..97344)
                     /codon_start=1
                     /gene="txi27"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="identical to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4317 encoded by GenBank Accession Number
                     CP000058"
                     /product="hypothetical protein"
                     /protein_id="BAF32849.1"
                     /transl_table=11
                     /translation="MFDHEYATENFDRLWVLYFDEETLSEEESFLYPPLVLTGRVSQS
                     KHGVNSLLVEANSVWVDQVLTGQCTHTFSEHLDFEPQRLTSAQRKVNDRVNLELDRVV
                     PGIARSGLKPVIYCVEAGDEVRCYMAVEATARHLLALRFCTVAYPPGEHDYQAVQAIV
                     ARSRASLIERLPLLNSRFGYFQWRPEMEFERKFTFQDLPDTWNLVTDLYARLYGGALP
                     GFFPECHKGFQVFDYENHIFDIVGEPEELGYISFIPQVNSNVTVKRKWFQENAELRRE
                     SLWWDQNIGVSDLAAEARSRVNADILPLPVFRRKRFDVNFESLKTGHVYGVYFDICRT
                     VDSPAEHSFGQVEVEYCRSRTAFLLDDIFEEFNFLAKYVERLLSEKKVAYKEDLFSKL
                     DFSRQSRSKNNIPE"
     CDS             complement(97413..98765)
                     /codon_start=1
                     /gene="txi28"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="identical to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4318 encoded by GenBank Accession Number
                     CP000058"
                     /product="hypothetical protein"
                     /protein_id="BAF32850.1"
                     /transl_table=11
                     /translation="MTGRLLVRKNENTRLLLLKANEKKLRATILSLFPEEAVAIAGWT
                     ANRLPVGWVLSGPRCGTSAFKAALAKHPECLALAGEHRMFFTLNELNYPHTKANRESS
                     LSTLDRKSKDDIKQMMLLLASCGDALVEPDSREVLRYAWEWAYRLPLQWTTTDFDPAV
                     VVSAVQQATDIYLEGGTRDLSVLDGLVLDKLTTVYPTIDCAYYDLPGKSSASASHWST
                     YKEKNNGPIIEISPYVIPRPRQLKTASVNVKSLLLKASSDPFRISAMRSLFAEHEVRV
                     VRLSRNPLSSINGLMDGWLHHCFWQHDLSTELGEDHPLSGWCFDLFEDWKQTAGSMSL
                     VEVCSAQWLEPNKLIAQAVRSKAANEEWRDFKFEDFVRSENSQIDMLKNAAEFLFGTG
                     DYFIVEQFVAPSVNVTEPHKPSRWQKRSEVLMPLLQSTQIIDLARAQGYEVEKLSDWI
                     "
     CDS             99222..100205
                     /codon_start=1
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /gene="argK"
                     /product="OTCase"
                     /protein_id="BAF32851.1"
                     /transl_table=11
                     /translation="MKITSLKNRNLLTMNEFNQSELSHLIDRAIECKRLKKDRIFNLG
                     LNHLNICGIFLKPSGRTSTSFVVASYDEGAHFQFFPADNIRFGHKESIKDFARVVGRL
                     FDGIAFRGFEHEVAEELAKHSGIPVWNALTDTHHPTQVLADVMTVKEEFGRIEGVTIA
                     YVGDGRNNMVTSLAIGALKFGYNLRIIAPNALHPTDAVLAGIYEQTPERNGSIEIFTE
                     VAAGVHQADVIYTDVWISMGESVSVEERIALLKPYKVTEKMMALTGKADTIFMHCLPA
                     FHDLDTEVARETPDLVEVEDSVFEGPQSRVFDQGENRMHTIKALMLETVVP"
     CDS             100440..101513
                     /codon_start=1
                     /gene="txi30"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4320 encoded by GenBank Accession Number
                     CP000058"
                     /product="ISPsy25 transposase"
                     /protein_id="BAF32852.1"
                     /transl_table=11
                     /translation="MSALDITLSHEETIELKRRVRSATIPQREGRRARIILLAAEGET
                     RDNIARLTGFSCPTITLWCQRFRARRLDGLVDQPGRGRKSSLPEETVRRVLEQVTRPR
                     IGEPRWSCRSMARAAGTSSTTVHKLWAANDLKPHLTRTFKLSNDPQFDEKFWDVIGLY
                     LAPPDKALVLCCDEKSQVQALERTQPGLPLGIGHIQTKSHDYTRHGTVTLFAALDYLQ
                     GKLISSIERQHRHQEWLAFLKKINKETPKHLQLHLIVDNYATHKHAAVKAWLAKHPRF
                     HIHFTPTSSSWMNMVERFFRDITVYLRDGSFASVRELESSITTFMALRNARPTRCVWN
                     AKGEEILNKIQRAREALETAQEN"
     CDS             complement(102466..103122)
                     /codon_start=1
                     /gene="txi31"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4321 encoded by GenBank Accession Number
                     CP000058"
                     /product="hypothetical protein"
                     /protein_id="BAF32853.1"
                     /transl_table=11
                     /translation="MRPPAEWRASSMTTAYERTRSVIETGGFLARISRDKTLPDRVRE
                     QARQLLRHYPTAEAVRLAGRCEAIRQVEVSKLSGIPKAMHPALATWPLLDPFFCDTAI
                     HHAPQASAPSAMLGSTALQSNPRPEGGIVAASFQILGLAAPAGMGCWSIEHRSFKSAR
                     TLVLSRATVVLGSPTSARNWFESRIRSLDRQQPCTFMSNLHEFTLVMDTLFRLEHGVF
                     "
     CDS             complement(103086..103856)
                     /codon_start=1
                     /gene="txi32"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="identical to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4322 encoded by GenBank Accession Number
                     CP000058"
                     /product="Sir2 family transcriptional regulator"
                     /protein_id="BAF32854.1"
                     /transl_table=11
                     /translation="MPEFRNAAKALLDAPEIVVFTGAGISAESGISTYGDPLTGIWAS
                     YDPRNMETAKAFRGNPPLVWGWYLWRRQQVSKAAPNAAHLAVSRLAKSGYSVSVITQN
                     IDDLHERAGSVDVLHLHGSLSTPKCFACHRPAEIPPSQVTSHIGGEVEPPRCVRCNGK
                     LRPGLVWYGEDLPSDVWKSAIALVKSCDVLISVGTSGIVTPAADIPRIALSYGATVIH
                     VNTEDVSTGAQNELMLIGKATEVFKKLCALLPSGEQAL"
     CDS             complement(103907..104407)
                     /codon_start=1
                     /gene="txi33"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="identical to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4323 encoded by GenBank Accession Number
                     CP000058"
                     /product="conserved hypothetical protein"
                     /protein_id="BAF32855.1"
                     /transl_table=11
                     /translation="MIYVLDPAERTVFTRTHCELDGMVFLLTITSTQTGMCDRAAMVS
                     CAYELQHYMTAASNVEISHVQMLCPPAISRSGKWSLEDLDRITCFQGVVTEESAVVYR
                     TSQGVYKMGDLDLRKKKTSRVWFSKKRLENHQPRMSEPAHKSKSHQMYAPLYLKPAPA
                     LRANSQ"
     CDS             104723..104953
                     /codon_start=1
                     /gene="txi34"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="identical to Pseudomonas syringae pv. phaseolicola
                     1448A PSPPH_4324 encoded by GenBank Accession Number
                     CP000058"
                     /product="RtrR protein"
                     /protein_id="BAF32856.1"
                     /transl_table=11
                     /translation="MDKLAKALGRRIRTQRKACQISQDALALACNIDRSYMGRIERGE
                     VNITVEKLYRIAGVLACDPSGLLPQVSELQPA"
     CDS             105902..109738
                     /codon_start=1
                     /gene="ACT094"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4631 encoded by GenBank Accession Number AE016853"
                     /product="sensory box/GGDEF domain/EAL domain protein"
                     /protein_id="BAF32857.1"
                     /transl_table=11
                     /translation="MPTSTPLPSPHVAADSATRPLRGSVKGVLAALVLVMLAMLLWQL
                     IEQFHQTLERQRQRSLEYSIQLSDRMSLNMALKAQIAMNLLDEAQSSGERLEQPVMLA
                     SLRTALPALRSVARLNPAGDIVSDSAEVPRDGDFLRRAMRQALGRPYFYTSTNDGNQL
                     YVLIRQGGGITGDYWALRMAPDALKDLASQPAQDFQHLWRLEQRKTQRVILREPLPSN
                     DADSGLSETILLQPLSNSDWQLRGLFDTYKARSELLTPLIGKCVIGLLLSILPLIALI
                     SLRRRQRQMLQSRRRYRDIFEGAGVAICVMDMSGLQEQLDALQINNGEEFDRLLKSQP
                     ASLKRLLQQLRINELNEVALGLLEIECNEQAWQQLIEGESRTRPGIGIQVIHAVLARQ
                     TRLELEICLTRARGQDQHLWLVMRLPEARSDFDAVILSIGDITSRKQTELSLLDRESF
                     WSDVIRTVPDHLYVQDVLSQRMIYSNHHFGHTLGYNKFELHAMGEFFWEILLHPEDAK
                     SYQDMRLRQRHHGHNELLQCVLRFRDHENNWRCFDVREQALAWDTEHLVTRIIGIAKD
                     ITEQVASSQSLRDSEQRYRMLAESISDVIFSTDTHLTVNYVSPSVERALGYSADWITR
                     NGWSAAIANPQQLTGFDALISRISKVLNKPQELARLRDEVTTRMFLFDCLRADGRKIP
                     VELRVVLVWDEHGNFEGIFGVGRDISQQRRAEKDLRMAATVFEHSTSAILITDPAGYI
                     VQANEAFTRVSGYEVAQVLDQLPGMLTVESEQEAHLRYILRQLNGQGTWEGEIRLKRR
                     NGEHYPAWVGITAVVDDEGDLASYVCFFSDISERKASEDRIHRLAYYDALTHLPNRTL
                     FQDRLHSALQQAERQQAWVVLMFLDLDRFKPINDSLGHAAGDRMLQEMATRLLACVSA
                     DDTVARMGGDEFTLLLQPDITREAALTRAIHVAERILTSLVTPFVLEGREFFVTASIG
                     IALSPQDGSELSKLMKNADTAMYHAKECGKNNFQFYQTDMNATALERLELESDLRHAL
                     EQQEFTLYYQPQFSGDGKRLTGAGALLRWRHPRRGLVPPNDFIPVLEELGLVVEVGDW
                     VLTEACRQLKHWHQAKVRVPKVSVNISARQFSDGQLGKRIAHILEQTGLSPACLELEL
                     TESILMREVNEAMQILDGLKNLGLSIAVDDFGTGYSSLNYLKQFPIDVLKIDRTFVDG
                     LPSGEQDAQIARAIIAMAHSLNLSVIAEGVETHEQLEFLREHGCDEVQGFLFGRPMPP
                     SQFEAQFSNDALFMLD"
     CDS             110246..111499
                     /codon_start=1
                     /gene="ACT095"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4632 encoded by GenBank Accession Number AE016853"
                     /product="Serine hydroxymethyltransferase"
                     /protein_id="BAF32858.1"
                     /transl_table=11
                     /translation="MFSRDLTIAKYDADLFAAMEQEALRQEEHIELIASENYTSPAVM
                     EAQGSVLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRAKELFGADYANVQPHAGSQAN
                     SAVYLALLQGGDTILGMSLAHGGHLTHGASVSSSGKLYNAVQYGIDGNGMIDYDEVER
                     LAVEHKPKMIVAGFSAYSQILDFPRFRAIADKVGAYLFVDMAHVAGLVAAGVYPNPVP
                     FADVVTTTTHKTLRGPRGGLILARANADIEKKLNSAVFPGSQGGPLEHVIAAKAICFK
                     EALQPEFKTYQQQVVKNAKAMAGVFIERGFDVVSGGTENHLFLLSLIKQDISGKDADA
                     ALGRAFITVNKNSVPNDPRSPFVTSGLRFGTPAVTTRGFKEAECKELAGWICDILADL
                     NNEAVIDAVREKVKAICAKLPVYGA"
     CDS             complement(111607..112584)
                     /codon_start=1
                     /gene="ACT096"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. syringae B728a
                     Psyr_4271 encoded by GenBank Accession Number NC_007005"
                     /product="cobalamin synthesis protein"
                     /protein_id="BAF32859.1"
                     /transl_table=11
                     /translation="MTELQPIPVTVLTGFLGAGKTTLLRHLLKAEHGLKIAVIENEFS
                     DAGIDSQLLGTDPVQIMTLSNGCVCCTIHTDLTKALYLLLERLDSGEIAFDRLVIECT
                     GLADPAPVAQTFFIDEELRERYILDGIITLVDAAHADTHLAQTIAQAQIGFADRLLVS
                     KRDLVDDAAFDALSARLTRINRRAPIRIVEHGKIDLAELLDVRGFNLNADLGGGMTLR
                     PLAPAGKSSDRITSLVLRSDKPLNLDRLSEFMNELLEDHGKQLLRYKGVLNIEDEPRK
                     MVFQGVLKLYGFDWDTEWAEGEPRESVIVFIADELPEEKIRAGFEKVCA"
     CDS             complement(112680..112877)
                     /codon_start=1
                     /gene="ACT097"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4637 encoded by GenBank Accession Number AE016853"
                     /product="conserved hypothetical protein"
                     /protein_id="BAF32860.1"
                     /transl_table=11
                     /translation="MFNDLSRLGKYLGQAARLMVGMPDYDTYVEHMQNTHPDKPMMTY
                     EQFFRERQEARYGGKGGPKCC"
     CDS             complement(112905..114980)
                     /codon_start=1
                     /gene="ACT098"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4638 encoded by GenBank Accession Number AE016853"
                     /product="carbon starvation protein"
                     /protein_id="BAF32861.1"
                     /transl_table=11
                     /translation="MKNNNSLMRHVPWLIVAIVGACALGVVALRRGEAINALWIVVAA
                     VAIYLVAYRYYSLFIATHVMQLDPLRATPAVVNNDGLDYVPTNKHILFGHHFAAIAGA
                     GPLVGPVLAAQMGYLPGTLWLIAGVVLAGAVQDFMILFLSTRRDGRSLGDMVREEMGR
                     IPGTIALFGCFLIMIIILAVLALIVVKALAESPWGMFTVMATIPIAMFMGIYMRYIRP
                     GRIGEISLVGVLLLLGSIWVGGMVAADPTWGPMFTFTGIQITWMLVGYGFVAAMLPVW
                     LLLAPRDYLSTFLKIGTILALAIGILILAPELKMPALTQFTNGTGPVWKGALFPFLFI
                     TIACGAVSGFHALISSGTTPKLLDNEKNARYIGYGGMLMESFVAIMAMVAASVIEPGV
                     YFAMNSPAAVVGSDVVTVAQTVSSWGFAITPEQLTAVAKDIGENTILARAGGAPTLAV
                     GIAQILHQVLPGENTMAFWYHFAILFEALFILTAVDAGTRAGRFMLQDLLGSFVPALK
                     RTESWTANAIGTGGCVALWGYLLYQGVIDPLGGINTLWPLFGISNQMLAGIALMLASV
                     VLIKMKRQRYVWVTMLPAVWLLICTVTAGLIKLFDANPAVGFLALAKKYSAAADAGQI
                     LAPAKTMDQMQHVIFNAYTNSGLTILFLFVVFSILFYAIKVGRAAWTTKARTDKEAPY
                     QAMPPASQV"
     CDS             115267..115635
                     /codon_start=1
                     /gene="ACT099"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4639 encoded by GenBank Accession Number AE016853"
                     /product="conserved hypothetical protein"
                     /protein_id="BAF32862.1"
                     /transl_table=11
                     /translation="MTDSHAERRRFKRIAFDAKTDVKQGDNSWKVQLVDLSLKGLLIE
                     KPERWSADPAQPFEVDIRLSSDVHVKMDVEMTHDHNQQLGFVCRHIGLESISHLRRLI
                     ELNLGDPAELDRELAALIEL"
     CDS             complement(115656..117023)
                     /codon_start=1
                     /gene="ACT100"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4640 encoded by GenBank Accession Number AE016853"
                     /product="DNA repair protein"
                     /protein_id="BAF32863.1"
                     /transl_table=11
                     /translation="MAKAKRLYGCTECGATFPKWAGQCADCGAWNTLVETMIESGAAA
                     PPSGRTGWTGSQAQIRTLAEVSVEEIPRFSTNSAELDRVLGGGLVDGSVVLIGGDPGI
                     GKSTILLQTLCNIAQRMPALYVTGEESQQQVAMRARRLGLPQDKLRVMTETCIETIIA
                     TAKVEKPKVMVIDSIQTIFTEQLQSAPGGVSQVRESAALLVRYAKQSGTAIFLVGHVT
                     KEGALAGPRVLEHMVDTVLYFEGESDGRLRLLRAVKNRFGAVNELGVFGMTDKGLKEV
                     SNPSAIFLTRAQEEVPGSVVMATWEGTRPMLVEVQALVDDSHMSNPRRVTLGLDQNRL
                     AMLLAVLHRHGGIPTHDQDVFLNVVGGVKVLETASDLALMAAVMSSLRNRPLPHDLLV
                     FGEVGLSGEVRPVPSGQERLKEAAKHGFKRAIVPKGNAPKEAPPGLQIIAVTRLEQAL
                     DALFE"
     CDS             117218..117664
                     /codon_start=1
                     /gene="ACT101"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4641 encoded by GenBank Accession Number AE016853"
                     /product="large conductance mechanosensitive channel
                     protein"
                     /protein_id="BAF32864.1"
                     /transl_table=11
                     /translation="MSVLTEFKAFAVKGNVVDMAVGIIIGAAFGKIVSSFVGDVIMPP
                     LGLLIGGVDFSDLAVTLRPAQGTAPAVLLAYGKFIQTVIDFIIVAFAIFMGVKAINRL
                     KREEAKAPTLPPTPSKQEVLLSEIRDLLKEQNQPAAPVTVDPARPL"
     CDS             complement(117849..118625)
                     /codon_start=1
                     /gene="ACT102"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4642 encoded by GenBank Accession Number AE016853"
                     /product="ferreodoxin NADP reductase"
                     /protein_id="BAF32865.1"
                     /transl_table=11
                     /translation="MTVSEDKFTRQTLQRVTPLTTNLFTLRTTRDPGFRFRAGQFARL
                     GVTKTDGTTVWRAYSMVSSPHDEFLEFFSIVVPDGEFTSELSRLREGDSLMVEKQAFG
                     YLTLDRFVDGRDLWLLSTGTGVAPFLSILQDFEVWEKFERVILVYSVRESSELAYQPL
                     ISELMQRDYLAEYAHKFMFLPTVTREQHPGALSGRITQLIENGALERATGIDLTPEHS
                     RVMLCGNPQMIDDTRALLKQRDMRLSLSRKPGQVAVETYW"
     CDS             118963..119196
                     /codon_start=1
                     /gene="ACT103"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Pseudomonas syringae pv. tomato DC3000
                     PSPTO4644 encoded by GenBank Accession Number AE016853"
                     /product="transcriptional regulator of LuxR family"
                     /protein_id="BAF32866.1"
                     /transl_table=11
                     /translation="MSTMDINFIQPSPTKNLTQREIEVLKWSAEGKTAGDIAMILCLK
                     ERTIHFHIASAIQKMGVCNKTAAAVQAALSGMF"
BASE COUNT        27458 a        35041 c        32780 g        24467 t
ORIGIN      
        1 tcagcggctc atcatgctgg ctgcctgctc cgtggcttcg gtggttctgg tggccagctt
       61 gcgcacctca tcggccacca ccgcaaagcc ccgccctgcc tcaccggcac gcgcagcttc
      121 aatggccgca ttgagcgcca gcaggttagt ctggctggcg atgctctgga tggtgcccac
      181 aatctgggta agctgggcga tgttctcttc caggtttttc tgatgatgcg cttcggtttc
      241 ccggagggca tcttgctcat gcttcaaatg cacatccacc aacgcaccca ccaccctcag
      301 cggcgtacct tccggggttc gacgggtctg accgcgtgcg cgaaaccagc ggtactcgcc
      361 ggttttcatc ttcaaacggt attcgatatc gaacggcgtc ttgcccgagc gatcgttcaa
      421 atgagtaccg aaggccgtca ggcttcgttc cttgtcttcc gggtgcagcc gtgatgccca
      481 actgtccagc acgtcaggaa actcttcgac tgtttcaaaa cccagtagac gtctgaactg
      541 cggcgaccac cagaaagggt ttctggcatt gaccgggtca cccgcaatca cctccatgtc
      601 ccacagaccg tcggagagca tttcgcgggc gagttcaaag cgggtaatga tcacgtcatg
      661 ctcgaggtca cgctcaagct catcgtgaat atcacgaagg gagccggcga cacgcaaggg
      721 cgtgccacgg gcgtctcgca atgtttcacc ctgggcgtag aaccagcgat acgtgccgtt
      781 cttcatggcc agacgattct tgacccggta cggcgtgtta cccgagcgat cgttgaggtg
      841 cttggcaaat gcgtcaagcg tggcctgttt gtcctgtgga tgaagccggt ctgcccaact
      901 ggccagcacg ttgggaaagt ctcgctcgtc attgaagccc agaagcgaac gcagttgctg
      961 ggaccaccag aatcgattgt tcgggttgac cggatcaccc gcaaccacct ccatgtccca
     1021 gaggccttca ctggaagcgc ggttgaccag atcaaaccgc gtttcgtaag cagtcgccga
     1081 cgcagaagcc tcgccgagaa gatggcgggc ggtttcaagc tcttgctcaa gctcggcaat
     1141 ccgctgttcg ttcagatggc gctggctgct tagcgaacgc cagcattcaa gtacggtgtt
     1201 ttcttctgcg cagcctctta caaccggctc gccagaaccg ttgagcgacg caataagttg
     1261 gtgaagggct tttctgtcgc gacgcgggcg gaataaatgg aacatgcagt ggactctcaa
     1321 aataagtcag atttgccgag tccctggcat gtcacttctt tatcgacatg ccgtgcagtt
     1381 tctgtaagtc agattgcgat caggtaatgg ctcccacgtg gagcgtctta cgatagttgg
     1441 gattatcgcc acgccgcctg ctcagtatcg gacgcagagc gtccagaccg gcatgccgac
     1501 gcggagcgtc gcacgatagt tgagattacc gttccctacg ctcacccccg cgctccaaac
     1561 ctgcgcaaca ccaccacccc caacaacgcc gacaacaccg acccgatcag cacgcctacc
     1621 ttgacctcgt ccaccagtgc cggtgcgccc gggaaggcca gtgcgccgat gaacaggctc
     1681 atggtgaaac caatcccgca cagtgccgcg acaccgtaaa gctgacccca attactgccg
     1741 tcaggcaagc gagcgagacc ggcgcggatg gccagagccg caagggcgaa gatgccgacc
     1801 tgtttgccga tcagcaaccc cagcgcgacg cccagtggca cagggtctac cagtttgtcg
     1861 acggtgatgc cggacaatga cacgcccgca ttggcgaacc cgaagatcgg taccacggca
     1921 aaagcgaccc acgggtgcag tttctcttcc agatgcagca gcggcgagct ggcttcttca
     1981 tcaggtttgc cgagcgggat gcacagcgcc agtgccacac ctgcaagggt ggcgtggatg
     2041 ccggactgga gcatgaaaaa ccacagcagc gcgccgacga ccaggtacgg caacagcttt
     2101 ttaacgccca gacggttcag cgccacgagt acggcgatgg agcccagcgc cgccagcagc
     2161 atggggatgg acagaccgct ggtgtagaac agcgcgatga tcaataccgc gccaaggtca
     2221 tcgagaatcg ccaaagccga caggaagatt ttcagggaca gcggtacgcg tttgccgagc
     2281 agagacagca cgcccaaggc aaaggcgatg tcggtcgcag ccgggatggc ccaaccgccg
     2341 agggtgtctg gctggcccca gttgaatgcc acgtagatca acgccggcac caccatgccg
     2401 cccagcgccg caaagcccgg caaggcgcgc tggctccatg acgcaagctg gcctgccagc
     2461 atttcgcgtt tgatctcaag gcccaccagc atgaagaaga ttgccatcag gccgtcgttg
     2521 atccagtgct ctaccgacat gccggcgagc acggtatgca gcgctacaaa atagctgtca
     2581 gccaacggcg aattggcgac gatcagggca gccagcgcag ccgccatcaa aatcagaccg
     2641 ccagcggctt cggcggcgaa aaagcgcttg atgaacgcca gcgcgttcgg ggattcggta
     2701 cggggggtgg ggttgtgcat gaagggctcc gcgggggtac agcgcaaaaa ggccgcaacc
     2761 ttaccactcg cagagcctgt cgaagcgcag gtaaacttga ggatacaaat taacgcgcac
     2821 gccagttatc gctcgtagaa tcagggctct ggccaatcag cagagagccc tgcccacctc
     2881 acttcttgac ggtttcttca agggtgaatc ggcccagcgg gttctggccg aaatgctcga
     2941 tgttcttgcg tgaaacgctg atgtagggac tgtagtacag gtcgatccag ttgacgtcgg
     3001 ctttggccat tttctgcagg tcgatgtaca tctgctcacg ctttttgggg tccatttcaa
     3061 cccgcgcagc agcgaccagt tccttgacct tctcgttctt gtaatgggtc atgtagttgt
     3121 tgttggtgtc atgaccgagc acgaacgtgg ttttctggtc cgggtcgaga atgtcgttgg
     3181 tccagtacat cacggaaata tcgtaatcac cgtcgatcag catctgccag ctctggctcg
     3241 ggtcgacctt ctgcagcgtg gtggtcacgc cgaccttggc cagttgctgc tgaagcatga
     3301 ccgagatctg ctcatcgact tcgttgcccg cattgaccac atagttgagt ttcaggtccg
     3361 aggcaccggc gtcagccagc atttttttgg ctttgaccgg gtcgtacggg cgttgcaggt
     3421 tgtcggcata gtgatacagc gcgcctttgg ggatgtagga attggccacc gtgccctgtc
     3481 cgaacgtggc ggcatcaatc agcgatttct tgtcgatggc catgtccagt gcctggcgta
     3541 cttcaggctt ggccagcgcg ccgtgttcgt ggttgatcaa cagatgatct tcgcgggtag
     3601 acgggtccag atgcaccacc agatcagggt tcttcttcag gttttcgatc cttgaaaagg
     3661 gcaccagaat cgcggcgtcc agctcgccct tctggaccat cagtacgcgg gtattgtcat
     3721 ccggtacgga gatccactcg acgccatcca ggctgacgtt cggcgcctcc cagaagttgg
     3781 ggttcttggc cagaatcacc cggtcaccgc gccgccactc tttcaccgtg aaggcgccgg
     3841 agctgacagg cttttcggcg taagcctctt cgcccagagt tttcatggcc ttctcggaga
     3901 gaatcgaaac gttgggcaag gccagttgcg agaggaacga ggctgaagga tttttcagcg
     3961 tgatgaccag ggtatgcgga tcggccgcga cgactttgtc gatgatcttg taggaatcgc
     4021 tccacagcga gcctttgtca tcgcgaatac gcagcaggct gaacactgcg tcactggcgg
     4081 tcagctcaga accatcggag aactttgcct cacgcatctt gagcgtatag gtcaggccat
     4141 caggcgagat cgaccagctt tccgccagcc ccggcagcag tttggtgcct ttgtcgtcca
     4201 cccggatgag cacgtcgtag acgttggaaa atacccagtt gtcgatgttc tgcgcgcttt
     4261 tgatcgggtc gaaggtggtg ccgtcctcac gacggccgat ggtcagcacg cccgcagctt
     4321 ccgccacacc cgctgccagg gaacaggccg ccaacatggc gacggtcagc attttcattg
     4381 gtcgagcttt catacacatg aactccttgc cggtgtcggg acagatgttg ttgtagttcg
     4441 gatcaaaaaa cgggcgtatc gagtacgcag tcatagcgct gctcgccggc atagcgggtc
     4501 ggcggcgcaa cgcttgagca ggtgggcctg gcaaaacggc agcgcggatg aaacgcgcag
     4561 ccatcaggca aattcagggg gcttggcggc tcgccctgca acggttcgct gggtaatggg
     4621 caatccggat caatctccgg gatcgcctgg atcagcgcag cggtgtaggg atggcgcggc
     4681 ctgagaaaga ccgcttcgac cgggccttct tcaacgatct tgcccagatg catcaccgcc
     4741 acccggtcgc acagccgccg cacaatggcc aggtcgtgag cgataaacag aatcgccagg
     4801 ttcatgcgtt cacgcagttc cagcagcagg ttgatgatct gcccctgaat cgacacatcc
     4861 agcgctgcca cgcattcgtc ggcaatgatc agccgcggct cgatggcaag tgcgcgggca
     4921 atgccgacac gctgacactg cccgccgctc agggcaccgg gcttgcgctc ggcaaactcg
     4981 gcgcgcaggc cgaccatgtc cagcagctcg atgacccgcg ccggaatgtc ggatgccgcg
     5041 accttgcgct gcactttaag cacctcggcc agcgtggcac cgacggtcat gcgcgggttg
     5101 agcgaggaag acgggtcctg aaagaccatc gccgtttcac tgcgcagacg ctgcagattg
     5161 atgccgctgc cctgggccac gtcaacatcg tcgaagacga tctgccctga ggtgatgtcg
     5221 ttcaggcgca gaatggcacg gcccaaggtg ctcttgccgc tgcccgactc gccgaccagg
     5281 cccaacgttt cacccgctga aatgctcagt gacaccccgt tgacggcatg gacccagcgc
     5341 ttgttcaggc ccatgaagcc tgacccgggg gccgggaagc gcaccaccag atcgttgacg
     5401 ttcaacagac tggggccgct catgacggta ttccttcgac gactgacggt tggctaacgg
     5461 ccagcggata gtgacacgcc gcagcgtgcg caacgcccat cgggcgcatc agcggcagcg
     5521 tttcggcgca gccttggcct gcatggccac agcgcgcatg aaagcggcag ccgctgggca
     5581 gcgcgtcgag caacggcggc tggccgggaa tggtacgcaa caggccactg cccgcgctgc
     5641 tggcgggctg gcactcgatt aggccgtggg tgtacgggtg tctggcgcgg gccagcacat
     5701 cgcgcttgct gccgtgctcg cacaggcgac cggcgtacat caccgcgatg gagtcgcagg
     5761 tttgcgccac cacgccaagg tcgtgggtaa tcatgatcaa cgacagcccg tggcgatcgc
     5821 gcaggtccag cagcagacgc agaatctgcg cctgcacggt cacgtccagc gcagtggtcg
     5881 gttcgtcggc gatcaatacc tgcgggccgc agcccagggc cacggcaatc atcgcccgct
     5941 ggcgcatgcc gccggaaaac tcatggggaa agttatccac acgcgaaacc ggatcaggaa
     6001 tgccgacctg acgcagcagg tcaatcgcct gcgcccgcgc ttcacgtttc gatgagcctt
     6061 gatgcagccg aaaaccttcg gcgatctgct cgccgatgcg catcaacggg tccagatggc
     6121 tgctggggtt ctgaaaaatc atgccgatcc ggcgtccgcg catggcgcgc atcccggcgg
     6181 catcgagctt gagcaggtca acgtcattta acagcaccga gccgccgcgc acctgcaggt
     6241 ccggcgacgg catcaattgc atcagtgccc ggcaggccat ggtcttgccg gaaccgcttt
     6301 cgccgaccag cccgagaatc tcgccctgat gcaggtcgaa cgacaagcga tcgaccagcg
     6361 tcacctcacg gccacgatgc ttggccacat tgctggcgac cacactcatc tcgctgactt
     6421 tcagcaccgg cgtactcatc gacgctctcc cagtgtttcg gcagcgccat cggccagcag
     6481 gctgaaaccc atggccagtg tcacgatggc gaggcccgga aaggtgcaga tccaccaggc
     6541 cgaggtcaga aacgcctgcc cctcggcaac catcgtgccc cactcggcca acggcggttg
     6601 cacgcccagg cccaggtagc tgaccgacgc gccactgagc aacaccagca ccgcatcgga
     6661 catggaaaac acaatcgagc cgaacatcgc gttgggcagc agatggcgaa acagaatacg
     6721 caggtgacca aagcccaggc tcttggccgc cagggcgaaa tcgctttcct tgaggaccag
     6781 aatctgtgaa cggatcagcc gcgcataaga cacccagccc accagcgcca tggcgatata
     6841 aaagctgctc aggcccggcc cgagaatcgc gatgatcgcc agcatcaaca ccagaaacgg
     6901 gaacgccaga acgatgtcga tgaggcgcat gcacaggttg tcaaaccggc caccgatata
     6961 gcccgataat gcccccacaa aggtgccgat catgaacgga aagatcaccc cgatcacgca
     7021 gatctgcagg tcgacgcgcg ccgcccagat cactctggac agaatatcgc ggccaaaatt
     7081 gtcggtgccg aacgggtgcg cgaggtgtgg cgcaagcagg cgcagctcgg tgttctgata
     7141 aatcggatcg tacggtgcca gccagggcgc gaagagtgcc agcagcagcc acaggccaag
     7201 cagagcgccg cccatcagca tcgccagccg gccattgcgc aagcgcagac gcagtcgcga
     7261 acgccactgc ggacgaagat gagcctgggc gacgctcatt tgatgctcac ccgcgggtct
     7321 atcgcgaccg tggccacatc ggcgaggaag ttgacgatca ccgtggcaca ggccagcacc
     7381 atcgccacac cctgcaccac catgtaatcg cgactgaaaa tgccgcgcac caacaactgg
     7441 ccaatgccgg ggatggcaaa caggctttcg ataaccacag tgccgctgat caaccagccg
     7501 atattgactg ccagcaggtt gatcgagggc accagcgagt taggcagcac gtgccggcga
     7561 aacagcgcgc cttcactgac cccgcgtgcc cgtgccgccg tgacgtgatc ggcttgcagc
     7621 tccatgagca tgctggcgcg caggttgcga accagcacgg cagacagcgc aagggcgatg
     7681 gtcaggcacg gcagcaccat gtgatgcagc ttgtccagcc agtcgctgcc gtagcccgac
     7741 accggaaacc agtcaagccg cacactgaac agcaggatca gcatgatgcc cagccagaac
     7801 gccggcatgc ccagccctgt ggtggtgaaa acgcgtatca ggttatcgcc ccaactgcct
     7861 ttgttgcgcg cagcgaccgt cgccaggggc acagcaatga gcaaggccag cagaacgctg
     7921 ccgatcacca gaaacaaggt cggctccagg cgtgtaccga tcagcttgag tacgtcgatc
     7981 ttgtacagca gcgacttgcc catatcaccc tgaaacaggt ttttcatgaa gtacaggtac
     8041 tgcgtccaca tcggctgatc caggccgtac tgggcgcgga tattggccag tgcgtccggt
     8101 gtggaacggg cacccagcag aatacgcgcc ggatcaccgg ggatcgaacg caccagaatg
     8161 aaggtcacca ggctgatgcc gaacagcacg ggcagcagtt gcagcggacg ctggaggatg
     8221 aagcgataac gacccaggtt catcagacgc cccgatgctg tgacagaagt ttcagcagaa
     8281 ccggaaagta cgccgccgcc ctttccacgc aaaagggcaa ggcgaagttg tagtcgaaca
     8341 ttcgccattc gtcgactttg atcgtttttt gctcacctgg cccactctca tccctcatca
     8401 cactgcacct ttgcggacat ggctcatggc atcaacccta tcgtgcagcg cgacggcaga
     8461 catctagcaa ttcttatagg ttttacagga ctgacagccg attggacgca agcgtggcac
     8521 tgtccttgct aattgctata ttaagacccc agattggttc aatgacaaag gaggtcatgc
     8581 catgcatatc aggttgtcgg atttcaattc gcgtctgcaa tcggcatcta cgctggatca
     8641 gcaaatggat tgcgccctgc tgctggcatc ggatctggga ttcgatgctg tgatttacga
     8701 ctacagcccg gtgcccgtgt cccatgatgg agcactgatc accccgtcgt tgctgtcatt
     8761 gcgcaacacg cccgccgact ggcatgcgct ttggtgcagt cagggttact accagatcga
     8821 tccggtgcag cacctggccg tcgccagggt ctcgcctttc gtatggtcct atcagcccag
     8881 ggccgagacg gtgctgcaaa ctttcatcac tgacatgcac aagccggtgg tgcgttatct
     8941 gcacgattca cacatgacgt gtggcgtgac tgtgcccatt cacatgccca agggcggctt
     9001 tgcgaccctg acaggcttgt gttcggacag cagcgatgtg gcgctggaag atgcccggca
     9061 gagcctggcg gaattcggct tgctggctca tgcgtttcag gaagtcgctt acccactgtt
     9121 tgaccagaag atgcgctcct gcaacgccat caagctgacc cggcgtgaac gcgagtgcct
     9181 gagctggtcg gcagaaggcc tgacggccag agaaatcgcc gatcaactca accgttcagt
     9241 cgcaaccatc acactgcatc tgaattcggc catgcagaaa ctgggcgcca aaaaccgcgt
     9301 tcaggcagtg gtgcgagccg ttcactaccg tttactcgac cactgaccgg tttattggcc
     9361 aaaacctatt actttctata gttataagat gccgcgcaca gcgctatggt gccccgaact
     9421 atccagcagg gaccggcgac atggcagaca tgacgatcaa ggaaggttta gcgccttttg
     9481 gtgactatca aacgtggtat cgcatcactg gcgatctgcg tggcggcggc acgccgctgg
     9541 tcatcctgca cggcggccct ggctgtaccc atgattatgt ggactcgttc aaggacatcg
     9601 ccaacaccgg tcgcgcggtg atccactacg atcaactggg taacggaaaa tccactcatc
     9661 tgccgcatat gggcagcgag ttctggacgg tcgatctgtt cctgagggag ctggacagcc
     9721 tgctcaagta tctggagatc gccgacaact acgcactgct gggtcaatcc tggggtggca
     9781 tgctggcgtc ggagcacgcc gtacttcagc caacaggcct gaaagcgctg atcattgcca
     9841 actcacccgc agacatgcac acgtgggtca gcgaagccaa tcgcctgcgc gaagagctgc
     9901 ccgacgacgt tcaggccacg ttgctcaagc acgaagaggc aggcaccttg actgacccgg
     9961 agtacctgac agcgtctcgg gtattctacg accgccatgt ctgccgcatc acgccctggc
    10021 cagttgaggt agaacgtaca ttccaccaga tcgacgaaga tccgacggtg tatcgcgcga
    10081 tgaacggccc caccgaattt cacgttatcg gcacgatgaa agactggagc attgtcgacc
    10141 gcctgccgaa gatcaacgtc ccgactctgg tgatttcagg attttatgac gaagccactc
    10201 cgcttgtggt taaaccttac gtcgataaca tccctgacgt tcgcgagtcg gttttccagg
    10261 aatccagcca catgccgcat gtagaagagc gtatggcatg catgggctgc gtggcaggct
    10321 ttctcgacaa ggtcgcgacc tccggcaaag cgttgccaga cgtcaaagcc cgttttggat
    10381 gatcaatgtc gcatcgtcgc acagtaagcg ggaatacttt agtttcccgc gatcagcctt
    10441 ttccagcact gttactggaa acgtaaatat ttaatatatc agcttcaacc cattgattag
    10501 aaacaacaaa ctgaaaaatg tcgcccatca tgaaataacc ttcatcgcaa tccgttaaag
    10561 ctctatccac ttcggcagaa aaacaggtac tggaaggcac gtattcacct tctgtctgtt
    10621 tttgccgccg gaggcaacca tgaatcttcg atctttaaac atttcgcgca gggcctcctt
    10681 gtgctttggc atcatcaccg tgctgttgat cggcctggga gggttttcct atgtgcagat
    10741 cgaccacctg cgcacggccg agcagaacat cgaagagaac tcgttgccca gcattcaggt
    10801 cgtcgatgac atccagatcg ccctgcttca cgcccggctg gaaagcatca gaatgctcgc
    10861 cagtaccgat cccgccgtgc acatcatagc ggaagccaaa gctcgggaag cgatcgaggc
    10921 gcttcgctca agcagcgagt tctatcgaaa aaatctgatt tcaggtgcat ccgacctggc
    10981 gcaattcgaa gacgccaaca gcaagatggg ggcctacatc gacggtgtga aacagatcat
    11041 cgccatggac agttccgatc atgaaaaagc cgtttccttt gcgaacgcag agcaggttca
    11101 gcgggccacc gcctaccagg aaaaactcac caccctgcgc aagcaaaatg ccgaggaagc
    11161 cgtaagctcc ggtaacgatg ccacagcggt ttataaccac agcgtcaacg tattactgac
    11221 tgttgtcatt gcagcatcgc tgctgacggt ggtgctggca atagccctga cccgcagcat
    11281 tgtcgatccg atcagcgtct cgctgaagct ggcagaagac atcgccgcag gcgacctgac
    11341 ccggcagttg agcgttgtcg gaagcgacga agcatcacgg ctgatgaacg cactgaacac
    11401 gatgtcggga aacctgcgca gcaccattca cgaaatctcc ggtgcctctg cgcaactaag
    11461 caccgccgct gtcgagatga cctcgatcac tgaaagtgcg gaccgtacct tgcaacaaca
    11521 aaacagcgaa atcgaacagg cggccaccgc agtaaacgaa atgagtgcgg cggttgaaga
    11581 agttgctcgt aacgcgacgt ctacgtccga ggccgccaga cagtcgagcc tttccgccga
    11641 tctgggcaac cagcgcgtcg ctgaaaccct ggccgccatg cagaagctca ccgggctggt
    11701 cgagggctca tcgggtcagg tcacggccct ggccggccag gcgcaggaca tcagcaaagt
    11761 gttgagcgtg attcgtggca ttgccgagca aaccaacctg ctggcgctca acgctgctat
    11821 cgaagcagcc cgtgccggcg aacagggtcg cggctttgcc gtggtggcag acgaggtgcg
    11881 ggcactggcg catcgcacgc agacctccac gcaggaaatc gagcagatga tttcggcgat
    11941 tcaggccggt tcgtccgcga ccgtggagtc catgcaaaag agcacactgg aagttcacag
    12001 cacgcgcaag acggccgaag gtgcgggcga gtcgctgcgt caaatcaccg attcggtgct
    12061 ggagatcaac aaccgcaacc tgcagattgc cacggcatcc gaacagcagg cgcatgtggc
    12121 ccgtgacgtg gaccgcagcc tgatcagcat ccgtgacctg gccgtgcaga gcagtgaagg
    12181 tactcgccag acgctggtgg ccagtaacga actgtcgcag ttggccgtca acctcaatga
    12241 tctggtactg cgcttcaaga cgtgatcact gagcgttgcg gcggggaaaa ggctctttgg
    12301 catgtacggt cttgtcagga gatttaccct gaacaagttc atgaaagttg acagatgcct
    12361 ttaacccatt aaatagttac ccggggataa ccacgataat tcatgtaagc cacgatcagg
    12421 tatggcagga tcagtgcctg tgccagatta gcagcgacag gcgtactgcc aaggctgcat
    12481 cagtgctttt atgaccaggg tgacgcattt tgaacaacaa cctgacttcg gcagagctcg
    12541 cagtcattag tgagatcgaa gccacatcca gccttctcag actggtaacc cggctgaccg
    12601 ggctgagatt tgcggcgatt gcgaaagtaa ccgagagcag ctggaccgcg tgcgctgttt
    12661 atgacgaaat ccagttcgga ctggaggcag gtcatcagct caagctggaa accacgctct
    12721 gcaacgagtt gcgccagcac cggcaaccca ttgtgatcaa cgaactggcc accgatccgg
    12781 tgtatgcaga gcatcccatt ccgaaacttt acgggtttca gagctatttc tcgctgccga
    12841 tcatttttcc caacggcgac ttcttcggca cgctgtgcgg cctggaccag ttgcccaagc
    12901 agctcgacga cgctgacacg ctcgacaccc tgaaagtgtt ctgcacgctg attgccagca
    12961 cgctttacgc gcactaccaa ctgcaggaaa tgcaggaact caccgtttaa cccgcaccac
    13021 atttcggggc gcacatgccg ccccatgact cacctgcgcg cctcgccctt ccgatcctca
    13081 cgtactgcct tcaacccgtc cccgtgccag cctcgttaac tacgcatttc agcgccgcca
    13141 tcgattatga aatatatttt tactacttaa cgacgaatgg caaaacctga aaatcgccgt
    13201 aactaaaggg ccaaagcctc tgtttgtaag ggttgcaaga ctgactgcat taagaaatca
    13261 gcgtctgcgg ccgatcaccc tgtatctcgc ggctgtagtc gaaatctttt cgtctgttaa
    13321 agtgagctta atgatgtcaa agaggcatca ccgtacaccc atcgagaatc tttatgaacg
    13381 ccagtgcccc cattccactg aatgaaacgc aacgtctgct gcgtattcgg gagctgtgcg
    13441 tgcttgaaga cacctccgac gaggtgttcg acgagatcgt cgcgatgacc gccgattttt
    13501 tccagacgcc cattgccctg gtctcgatcg ttgatgaaca tcgccagtgg ttccgcgcca
    13561 gagtgggtct cagtgcgcgg gagacaccgc gcaacgtgtc gttctgcgcc tacacaatcc
    13621 tctccgacac gctgttcgag atccccgatg cgacgctcga tgagcggttc atgaacaaca
    13681 gcctggtgac cggccatccc gacatccgct attacgcagg tgctccgctg atcaccgacg
    13741 acggccttgc cctgggcagc ctgtgcgtga tcgacaccaa gccgcgtgag ccgatgagcg
    13801 agcaccagac gcagatgctc aagcgtttcg cctcgctggt catgaagcgc attgtcagcc
    13861 tgcgactcag ttgcttcatc gaccagccta ccggcctgtt caaccgctcg cgcctgcagg
    13921 aagatattca cgaggcgctg gcatcgagcg ttgattatca actggttgtg atggacatga
    13981 tcacctccgc gttccttaac gacatcgtca aggcgctggg ttacagcttc tcccaggacc
    14041 tggtgacagc gatcaaggaa cgtatggaga gcctgctgcc gcagacctgt ccgctgtaca
    14101 aggtcgggcc gacccgtttc ggctttctgc tggcaggcga ccgtccgcct gagcacctgt
    14161 ttcgcaccat cctcgaagac ttcgagacgc ccgtggagtg ccacggcatt ccggtgcaga
    14221 tgcaggtcgg gctcggggtt gtgaccctga accgcgatcc gaacgaagag caggactgga
    14281 tgcgcatggt cattagcgct gccgacgacg cacgcgaccg cgacctcggc tgggcgatgt
    14341 acgagccgca cttcgatgcc gctcagcaac gcgcattcaa gctgctcagc tcattgacca
    14401 gcgcggtgca ttcgcacgat cagctacgcc tggtctatca accgcgtatc gacctggaaa
    14461 ccggcctatg cacgtcggtg gaagccttgc tgcgctggaa tcacccgacg ctcggcccca
    14521 tcgggcctgc cgagttcgta ccgctggccg agaagaccgc actgatgcgc ccgttgagcc
    14581 tgtgggtatt gacgagcgcc attgagcagg cagctcgctg gcagcaacag ggcttccatt
    14641 tccgtatcgc catcaacgtg acccccgagg acctcaccgg cccggcgttc accgaccgga
    14701 tggtgcggct gttggggcag cacaagatcg accctacgcg ctttgaactg gagttcaccg
    14761 aaggcgcatt gatgcacaac ccggccgaag tgcgtcacca gcttgagcgc atgcggcaga
    14821 tgggcatgga cgtggcgatc gacgacttcg gcaccggcta cagcaactgg aattacctgc
    14881 ggcaactgcc cgcgaccacg gtcaagctcg accagtcgct gattcgtaac ctggcgtccg
    14941 acaagaccga tcagcgtctg gtcaaggcac tgatcgggct ggccaagaag cttggctatt
    15001 gcgtggtggc cgaaggcatc gagacagatg aaattcgtcg gctggtcaaa cagtggggtt
    15061 gtgacgaagg ccagggttac ctgattgcca agcccatgga agccgacgcc gtgctgggct
    15121 ggctcggccc ggaccggcgc ctgcaaagtg tgacagaagc ggccgaagcg gccgtcatcc
    15181 gcgataaacg gttataacct tagatcactt cttcataacc gttttgaaca caagccgtta
    15241 tgctgcccgc cactttttgc ctgatacgtt tgtttgacag ggttggttat ggaagcgggt
    15301 ggacttgggt ttgtagtggc ggggctggta gtcggtttta tcgtgggcat gaccggagtc
    15361 ggtggcggct cattgatgac gcccattctt ttatggttcg gtatcaaccc ggcaacggca
    15421 gtcggcaccg acctgctgta tgcggcaatc accaaatccg gcggggttct ggtacaccgc
    15481 aaaaatgaca acatcgattg gaaagtcacc ggcctgctga ccctgggcag cgtaccggcg
    15541 gtactgctga cgctgtggtt tctgagtacg ctgcataccg cacccgatgc gttgaatgcg
    15601 atcatcaagc aagcgttggg ctatgtgctg ttgctgaccg ctctggccgt gctgttcaag
    15661 aagaagctgc tggccttcgc ccacggtcgg ggcgatgggc aatcgttttt cagcggtacc
    15721 agcctgacgg ttttgactgt tatcaccgga ctgatccttg gcaccatggt cgcgctgacg
    15781 tcgattggtg ccggggcatt gggcaccgtg gcgctgttca ttctctaccc gttgttgccg
    15841 acccgccgcc tggtgggcac ggaaatcgca cacgccgtgc ccctgacgct ggtcgcaggc
    15901 ctgggccacg cgagcatggg caacatgaac tgggaattgc tcggctggct gttgatgggc
    15961 tcgctgccag gtatctatct gggcagccac atggccggcc gtgtctccga tgacctgttg
    16021 cgccccttcc tggccatcat gctgggcatg atcggcttca agctggcgtt ctgatcaccc
    16081 tcccctccat cagcctgtca catttatgcg tcaggcttgg tgcgtgcaca cagtcctgaa
    16141 agcgtcggcc gcaggtgttc tgctgcgcat agatcgcatt catcgggaat tgtaattttt
    16201 tgtagctcaa caccggtttt cggcgcagga tttcgtccgt ctgcttacgc gccgataacc
    16261 cggcacagac ttaccctcgc tgacaggaga tgccaacaat gcttatccga attgaagaag
    16321 gtgtatacgg agctgattgg gttgtaaaac tggatgatta cccggtcaag tgccggagct
    16381 ggcaggaagc ccgcgagttt gcagatcgca tgaaatccag aatcgatgcc cctcattcat
    16441 tgccgcatct ggcacggcgc gcagcccccg aacatagcgc aagtgcgatg gcccgttaag
    16501 cccctcctga atcaataaaa acagcgttgt cacctggctg gcgacgctgt tttatccccg
    16561 catcaagtgt tttcatccat tagaacagtt ctcgtttcca tcacatccct ttcacatcct
    16621 cttcacgtct ggatgggtaa attagcccta ctcctttgat gaatcccatt tggcccaccc
    16681 cgttgtgggc catttttttg cctgcagaaa agtgatgcat tgccgcccgc gaacacaggc
    16741 ctgattattc gctttgcagg tttctggaag tggccacggt caccgccgga ctgctcaata
    16801 cgccagcgct cagctctgcc agacggtcat tgcccgtgcc gctggagacg ttattgctcc
    16861 agctcgcggt cacggttgcc atccagccca gcataaacag cgcaattgcc tgcaacatcc
    16921 actttgtaat gatcgacatg gctctctcct tttgggtctg gatggcgagt atgtaaacac
    16981 ctcaccattg cagaagaatt gcagagattt ttatttttgc cagccgatac tgcatctttg
    17041 tgaacaaaga gtcagtggga cagcaacggg tgatcgacaa gagaaatacc cacgccgtcg
    17101 acggggtatt tctggaaggc gggggtatca gtatttggtg ctttgctgct caggcttggc
    17161 aggcgtgtct acgtgacgcg gtccagcgac gacgagcgcc aatacgccca gcacaggcac
    17221 agcaacgatc acgatgatcc acatcagctt gttgctggac tctgtcttgc tcttgcgaat
    17281 gcgcatgact gcccaaatgt ccgaaagcac gaccagtgca gtcagcaatg cgaaccacca
    17341 caaatgattt tccgatatcc aacccatttg aaatctcctg caccttcaac gaaggcagcc
    17401 agatcagctg ccctacagta gaagaggcca gggagccgcc taaagttcag agaatctttc
    17461 ggagtgtgcg cctgatcgag agaggacgca gagcgtccgg aacggcgtac cgacgcagga
    17521 gcgccggcac gatagtggtg gaactaccgt ttctcattcc gcgcaggagt ccctttcgtg
    17581 acgctccgcg ccacaccctg tcaggtgatc ggtgccgggt tgaacagggt gatgtcgttg
    17641 tgcaaacggt agtgctcggt ccaggtcttt ttcttgccgc tggccacgtc cagatagaag
    17701 tgaaacagct cccagcccag gtcttcgatg ctcgcacgcc cggtggcgat gcgtccggcg
    17761 tcgatatcga tcaggtcagg ccagcgctgg gccagttcgg tgcgggtcga aaccttcacc
    17821 accggcgcca tcgccagacc atacggcgtg ccgcgcccgg tggtgaacac gtgcaggttc
    17881 atcccggcgg ccagttgcag cgtaccgcag acaaagtcac tggcgggcgt tgcacagaag
    17941 atcagaccct tgctgttgac ccgctcgcca gggccaagca cgccattgat ggcgctgcta
    18001 ccggacttga cgatcgaccc cagggacttc tcgacaatgt tcgacaaccc gcccttcttg
    18061 ttgcccggcg tggtgttggc gctgcgatcc gcttcacctt tggccaggta acggtcgtac
    18121 cagtccattt cccgaaccag cgcctgcgcg acgtcctgat cctgcgcacg ggaggtcagc
    18181 aggtagatgg catcgcgcac ttcggtcact tcggaaaaca tcaccgtcgc ccctgcacgc
    18241 aacagcagat ccgaggcgta acccagcgcc gggttggcgg taatgccgga aaacgcatca
    18301 ctgccgccgc actgcatgcc aaggatcagc tcggaagccg gaaccgtttc gcgacgacgc
    18361 atatccagtt tcttcaggcg cgtctcggcc agttccatga tctgctcgat catttcattg
    18421 aaaccgtggc tggaatcctg aagccgatac aaccacggct cgctcaggtc caccgagctg
    18481 tcgtcctcat gcatgacctg cccggcctgc aatttctcgc aacccaggcc aatcaccagc
    18541 gcctcgccac ccaggttcgg gttgcgcgcc agattgcgca cggtacggat cgggatgtag
    18601 gcgtcggtgg cggtaatggc cacgccgcag ccgtagctgt gggtcagggc caccacgtca
    18661 tcgacgttag ggtatttggg cagcagttcg tcacgaatgc gcttgactgc atggtccagc
    18721 acgccggtca cgcactgcac ggtggtggtg atccccagaa tgttgcgggt gcccaccgta
    18781 ccgtcggcgt tgcggtagcc ctcgaaggtg taaccctcca gcggtgcctg tttctcgggc
    18841 accgcatcgg acatcggcaa gctgtcgagc gcaggcgcag acggcatgcg caactggtct
    18901 tccctgaccc aactgccacg cggtattggc tgcagcgcgt aaccgatggt gtgaccataa
    18961 cgaataatgg cctcgcccac ggccaggtca acggtgctga ccttgtggct ctgcggcacg
    19021 ttgtcgaccg tcaccaggcc gttgtcgaat tcggttccgg ccggcacacc ctggtcgttg
    19081 accacgacca cgacgttatc cagcgggtgc agccggatgt agcgcggaga gtcggcatgt
    19141 tgaatcaggt tcatcacggt ttcctcagga ttttgcttcg gaaaggtcgc tgaccgagtc
    19201 gttcagcaat ggccccttgg caggcggctc tttcaattcc acacgcttga tttcacctac
    19261 gatgaaaatg taactgatca ctgccagcag cgcattggcg cccacgaaca ccagtgccca
    19321 tttgaacgag ccggtgctgc tgatgatgta accaatcacg atcggggtgg tgatcgatgc
    19381 aacgttaccg aaggtgttga acaggccgcc actcaaaccg gcaatctgct tgggcgaaac
    19441 atcggacatc acagcccagc ccagtgcgcc tacgcctttg ccgaagaatg ccagggccat
    19501 gaagcccacc accacccatt ccacgtccac atagttgcag gtcacgatcg aggtcgagag
    19561 cagcaggccg ccgatgatcg gtgccttgcg ggcgaaggtc agcgagtggc ctttgcgcag
    19621 caagtagtcg gaaatgatcc cgcccagtac accaccgatg aagccgcaaa tggctggcag
    19681 ggacgcgatg atgccagcct tgaggatggt catgccgcgt tcctgaacca ggtacaccgg
    19741 gaaccaggtc aggaagaagt aggtaatacc gttgatgcag tactggctca ggtagatgcc
    19801 gagcatcatg cggttggtca acaactggcg aatgtagtcc cacttcggcc cgctgctggc
    19861 agctttttcc ttgcctttgc ccttgtcctg atccagatcg accagcgcgc cattgctgga
    19921 gatgtgctcg aactcggcct cgttgatcat cgggtgatta cgcgggccat aaatgacctt
    19981 catccagatc atcgagaata cgatgccgac tgcgcccatg accacgaaca cgtgcttcca
    20041 gccataggtg tagacaatcc agcccatcag cggcgcgaac agcacggtgg cgaagtattg
    20101 cgccgagttg aagatcgccg acgcggtacc gcgttcagcg gtcggaaacc aggcggccac
    20161 aatgcgggcg ttgcccggga aggaaggcgc ttcagccaac ccgaccagaa agcgcagcat
    20221 gaacagcggg acaatggcgg tggaaatgcc gaactcgccc acatagcctt gcagcaaggt
    20281 gaacagcgac caggtgaaaa tgctcatggc gtagactttt ttcgacccga accggtcgag
    20341 cagccagcca ccgggaatct gaccggccac gtaggcccag ccgaatgcag agaagatata
    20401 acccagagtg accgcagtga tgccgaggtc tttctggatg ctggaaccag cgattgcgat
    20461 ggtggcacgg tcggcgtagt tgatcgtggt gaccagaaac agcatcaaca gaatcaaata
    20521 gcggacgtgc gtcggcttgg acttttgcat ggtagagctc ccactgatta tttttttacg
    20581 cgggtaaagc tgttttttgg gtgttgcgtt acaggcccct tggcagcgtc gcggcgacga
    20641 catctgccac ctgtaagggt catgcaatcc aacgacaaag ccgctgatcg ctcagcggct
    20701 ctatcgccag aagtgttact gcttgccttg cttgtccatc agtgcggcga gcatgtcgca
    20761 ctcgtccggg gtcaggtcag tcagtggcgc gcgaaccggg cctgcatcgt agccagcgat
    20821 ttttgcgccg gccttgacga tactcacggc atagccggct ttgcggttgc ggatttccag
    20881 ataaggcagg aagaaatcgt cgatgtactt gccgaccgcc tcatgatcgt cacgggcaat
    20941 ggcgtggtag aagtccatcg ccagtttcgg cacaaagttg aataccgcag acgagtagac
    21001 cggcacgccc agtgccttgt aggcagccgc gtagacttcg gcagtcggca ggccgcccag
    21061 gtacgagaag cgatcaccga ggcggcgacg gatcgaaacc atcagttcga tatcgcccag
    21121 gccatccttg taaccgatca ggttcgggca acgctcagcc agttgttcca gcagggttgg
    21181 cgtcaggcgg caaacgttac ggttgtagac aaccacgccg atcttgaccg atttgcagac
    21241 ggcttcaacg tgggcggcaa cgccgtcctg gctggcttcg gtcaggtagt gtggcagcag
    21301 caacaggcct ttggcaccca ggcgctcggc ttcctgagcg tattcgatgg cctgacgggt
    21361 tgcaccgcct acaccggcca gaatcggcac gctggtggcg caggtatcaa cggcagtctt
    21421 gatgatttcg gagtattcgc tggctgccag ggagaagaac tcacctgtac cgccggcagc
    21481 gaacagagcg cttgcgccat acggggccag ccactcgagg cgtttgatgt agcccgcgcg
    21541 atggaaatcg ccctgagcat tgaaatcggt aaccgggaaa gacagcagac cggaagagag
    21601 gatggacttc agttcttgtg gattcattat tcgaacaccc tggaggacat aattgttaga
    21661 agatcaccgg gtcagtgccg atgtcgtaag tcatcgtaca actgataata gaatcactca
    21721 acagggattt cgggtttttt cagcgggagg gaacggggca ggttttgact cctgcgatgc
    21781 agcgtagatt tgagacgcag agcgtcacga aaggcattac cacgctggag cgtgcgcaac
    21841 gattatctca actatcgtgc gacgctccgc gtcgcatgcc gttctggacg ctttgcgtcc
    21901 tcttttaacc ctcaagcacg ctgcgattcg gcctcttcgt gggcgtggcg caggcgttcg
    21961 cggctgttgg tcaggtgcag gcgcatggca gcgcgggccg catcggagtc ctggcgggca
    22021 atggcttcga agatttcttc gtgctcgcgg ctcaggcggt ccatgtagtg ctgctgatca
    22081 tcatgggcca gacgcgccga attcagccgt gtacgcggaa tgatgctggt gcccagatgg
    22141 gtcatgatgt cggtgaagta gcggttgccg gtcgacagcg caatctgcag gtggaactgg
    22201 aagtccgacg ccaccgcatc agtcgcatgc gcagcgcttt cgttcagtgc gtccagcgcc
    22261 gcgcgcatcg ctgcaagctg ctcatcactg cgacgctgag ctgccagccc cgccgactcg
    22321 acttccaggc tgatacgcaa ttcaagaatc gccagcacat cacgcaaggt gacgattgtc
    22381 gccggatcga tgcgaaagcc gctcgggctc ggcgtgtcca gcacaaaagt gccgatcccg
    22441 tgacgggtct cgaccagacc ggaggcctgc aagcgcgaga tagcctcgcg caccaccgtg
    22501 cggctgacgc cctgctcttc catgatcgcg gattcagtgg gcagtttatc gccacgcttg
    22561 agctgaccgc tgcgaatacg ctcggataac tcagtcacca actcctgcgc gaggctgcgg
    22621 tgttttctac gggcgcgggg tggagcgctt tgattttcca tccaacatcg atctctggac
    22681 tgctaaacaa gggctaatca tagctcagcg gttaggtgat cacaccctca aagcagcgcc
    22741 ggcccgacag aatcagcttc aaaccgctcc agacgccgcc tgttcgatca atttgccgtc
    22801 ctcgacgcgc acatgccggt tatggaagcg cttgagactg ctgcggtgtc cgatgctgag
    22861 caatgtcagg ccgggcagcc cgtcaatgat ggctcggtgc atggcggcct cgtcttcttc
    22921 gtccatggcc gaggtggctt catccatgta cagccagcgc ggcgccacca acaaggctcg
    22981 agcgaacgcc atccgctgct gctcccctgg cgacagaaag cgctgccagt gattgctttc
    23041 atccagacgc ggaatcaaat gctccagccg acactttttc agcgcgtcgg caaagcgctc
    23101 cggcgaatag tgatctgctg actgtggata actcatcgcc tcacgcaacg tgccaatcgg
    23161 tagataaggc cgttgcggca aaaacaatac gggctctgcc ggcaagcgaa tctgccctga
    23221 gccgtgcggc cacaatccgc ccagcgctct cagcaacgag cttttgccac tgcccgaacg
    23281 accgctgagc atgacccgct cacctgcggc gatgtgcaag tcagcctcgc tgagcagttg
    23341 tcgaccgccc gcaatgctca ggcccagatt gcgcaggtcc agcgcatcgt cggcgtgaac
    23401 ccgttcgatg gcgggctgct gcgcttcatg gtcggtcagc gcctggcgga aactcagcag
    23461 acggtcacag gtagcgcgcc acgacgccag cgtgctgtag gcgctgatga accagctgaa
    23521 gttctcctgc acgttgccga atgccgagtt gatctgcatc agatcaccca gctcgatctt
    23581 gcccgcgaaa taccgcggcg cagcgacgat aaagggaaag atcagggcaa tctgcgaata
    23641 gccggaggta aaaaaggtca gccgcttctg gactttcatc gaggcccgaa agttattcca
    23701 gatcatcgaa aaccgcccgc tcaggcgctg gttttcgttg cgctcgccct cggacaaggc
    23761 aatgctttcg gcgttttccc gcacacgtac caaggcaaaa cgcaggtctg cctcgtaacg
    23821 ttcctgctgg ttgttcagcg ggatcagacg cttgccgatc cagtgcgtca acaggctgcc
    23881 gacgatggcg taaagcatgg ccgcccagaa catgtagcca gggatcgtga caccgaacag
    23941 ttcgatgctg cccgacacgc cccagagaat gaccgagaac gaaaccaggc tgacgaccga
    24001 gctcatcagg ccaagcccca ggctcagggt gctggtggtg aactcattga ggtcttcgga
    24061 caaacgctgg tcagggttat cggtgtaacc gccctgctcc agatggtagt aattcttgtg
    24121 ctcgagccag cgggtgaaat gctgctcggt cagccagcgg cgccagcgga tggtcagtaa
    24181 ctgggtcaga tacaggcgat aaaccgccgc cagaatggcg atggcggcaa tgccgctgaa
    24241 gtacagtatc aggtgggtaa acgccgccag atccttgttt tgcagggcgt tgtaaaagtc
    24301 ccggtaccaa ctgttgaaca ggaccgaaac ctgcacgctg aacagcgtca gggcaatcac
    24361 cgagaccagc aacagccagg caacggtctt ttcttcgctg cgccaatacg gcgttatcag
    24421 cttccataca cggggaaaaa acgccccttt cacagtatcg ttgacggcag agtattcagc
    24481 attgcgattc atgtgggtca ggctcgctct ctttgaacgt acgatgcctg agcacaatga
    24541 agcaaaaaaa cgcctacacg aacactatga aaaaaccttc atcaacgcct gaccgggcgc
    24601 ttctgcaact tgcgctgcaa ggtccggcgg tgcatgccga gcgcccgcgc ggtcgctgaa
    24661 atattgcctt cgtgctcggc cagcacgcgc tgaatgtgct cccactgcaa gcggtccacc
    24721 gacatcggat tctcgggcac cagcgtgtcg aggttagcgt gctcggacag caaggccgcc
    24781 agcacgtcgt cggcatccgc cggcttgcac aggtaattgc acgcaccgcg cttgatggcc
    24841 tcgactgccg tggcgatgct cgaataaccg gtgagaatca ccacgcgcat gtccgggtcc
    24901 atttccagca gtttgggcag cagcaccaga ccggaatcgc catccatttt caggtccagc
    24961 gcggcgtact caggaatgtc ctgctgcgcc agtgccaggc cctcttcagc ggaacctgcg
    25021 gtgctcacgc gaaaaccgcg acggctcatg gccctcgcca tcacacgggt gaatgtcgcg
    25081 tcgtcatcga ccagcagcag gtgcggcagc tcttcgcctt cgacctggat gtcatcgtca
    25141 ctcatgcttc ttctcctcgt gtttctcggg gcaggcgcaa ctcggtgagc gtaccgcctt
    25201 cttcatgact gtagagcttt accgagccac ccgcacgggt gacgctggcc ttgctcagga
    25261 acagacccag gccgaaacct ttgcctttgg tagtaaagaa cggtttgccg atctgttcgg
    25321 caatggccag cggcacaccc gcgccgtggt cacgaatgct gatgcagacc tctgcactgt
    25381 cccagttcag gttgacttcc agaccatcgg ggcaggcgtc ggcggcattg ttgagcaggt
    25441 tcagcagtgc ctgggtcagg tctggcggcg gtgccagcat gggcacatcg cccttgccca
    25501 actgatagaa gcggtaactc acttccgggc gcatcaggtg ccaacggtta agcgactcgt
    25561 ccagccagcg ggtggcgggc tgctgctcca cggccatgcg ccgattggct tcggcggcac
    25621 gcaccagttg ctggagggtc tgcttgcact gtttgacctg ctcctgcagc accgacaggt
    25681 cttcctgcaa tgcagggtcg ttgtggtcct ggcgcatttc cttgagcaat acgctcatgg
    25741 tcgccaacgg cgtacccagt tcatgcgccg cgcctgcggc ctgggtggcg acggcgagca
    25801 actgttgatc gcgcaggccc tcctcccgac gctcggcacg cagttgctcc tgacgacgca
    25861 gttcttcggc catctttgct gcaaaaaagg tgatgaccga cgccgccagc gcaaaactca
    25921 gccacatgcc atacacctgc atgttttcac gggcaatcga gtcggtttcc agcgggtatg
    25981 aacgaaccat cagcagggtg tacatggtca gcgcaaagcc ggacaaaatc agcgagtagc
    26041 gccacggcaa ggtcgccgca gcaatggtca gcggcaccag gtaataggaa acgaacgggt
    26101 tggccgagcc gcccgagtag tacagcaatg cactgtggat cagcagatcg agcgccagtt
    26161 gcaaggcgta ttcaagctcg gtgagcggca gcgacgtgcg caggcggatg acggtcagcc
    26221 cgcacagcac cagcgagcag cccagggtga tcgacagctg cagccatggc aggggcagca
    26281 agtcgaacaa ccacgcgatg ccgaccgagc ctgcttgcgc ggccagcacc agaatacgga
    26341 tgaatgtcag gcgccacagg ttttgccgtg tggccgaaag catttgaacg ggggcgagca
    26401 tgagctctcc tgatgagtgc tccaggcgaa tcgcagcgag tataaccaag cgcgaggcaa
    26461 aactggaaaa gtgcgtcaac gcgccacaca cccgagcatt ccgtcatcgc aggaaccggg
    26521 ccaaaccgct acagtcagaa cactttgcgc cgcccgacac ttgtcggctg gccgtttgat
    26581 aacaaggagc cttcatgttc aatcttcgcc ctgctgccac gctcgtcgcg ctggccgctg
    26641 ccctgtccag cctgccggcg ctggctgaag aagcccgcta caaccagatt tccctgcgtg
    26701 ccgaggtcaa tcaggaagtc cagcgcgacc tgatgctcgt caccctttat accgaagcgc
    26761 aggacagcga cccggccaaa ctggcggcgc agatcactga aacgctgaac aaggcgctgg
    26821 gccaggcgcg gcaggtcaag aatgtgaaga tccgtcaggg cagccgcaac agctacccgg
    26881 tttacgacga caaagggcag aagatcaccg gctggcgtga acgcgccgag ctgcgcctcg
    26941 aaagcgcgga ctttgcggtg ctgtccaaac tgaccggcga actgctgaca gacctgaaaa
    27001 tgggcggcat ggacttttcg atctcgccat cgacccgcaa gaccagcgaa gacgcgctgc
    27061 tcaaggacgc cgtgacagcc ttcaaggcac gcgcacagtt ggtgaccgag gcgctgggcg
    27121 gggcgggcta caagctggtc aacctgaacc tcaacacctc gggctacccg cagccgtatc
    27181 tgcgtgcacc ggtcatgatg atggcaaaat cctcgcgtga tgagtcggca ccgacgcccg
    27241 atgtcgaagc cggcaccagc caggtcagcg tcgcagctga tggtgtgatc gaagtcgcca
    27301 ttccttgatt ggcaggcggc agtttcgact gccgcccttt cctgctaccc acttcccaca
    27361 cccctcctct tgatacccct ctgcgcctcg gcaatctcct acgtttgctg gtgtgtcgtc
    27421 tgattggcga cagcctccca gtccgcgaaa ctacccactc acttcgctta ccaccgccct
    27481 gaccgagcga tacggccagc gcgcctttac ccacaaggaa tcaaggatga atccctcgga
    27541 cagcacttcc gaacgctttg ccgctgacac tgaccaggct atgaagacaa acgccgagac
    27601 gctgcccagc cccttacgat ttgaagccgg aaaaggcgac gaacacacac atacgcacgg
    27661 cgctatcgag gcggttctcg aatctgccgg tttcaggcat gaagaaatcc gcgcgatcta
    27721 tttcggcaac tggttgcgcg attattcgca gctgctggac ccgaaaatcg tccgggcgac
    27781 gaccatgccc aagagctttc cggacctgct gtcccgccac gcgctgaccc gcatcgtgga
    27841 tgtgctggcg gtgaaagagt tcaccgatct gatgcagata gaccgctcgc gttttgtcgt
    27901 gacaccggag cgacttggtg tctatcgccc cggtgaacac atcgataacc ccaaggccat
    27961 caaccccaag ccggccagcc ccaaagagcg cgacgccgac ttcgatgact gggtactgcc
    28021 cgacgatccg gcgttacagg tcgatcatga gacctcgatg aagcgctata ttcagcgctc
    28081 ggtggacatc atggtcgccg gcctggagtc ggccgtaaac gcaggtccac aatccactga
    28141 cggtctgcgg gacatgggcg cagcgctgca tattctcgaa gacttcttcg cccactccaa
    28201 cttcgtcgag ctgagcctga tcaagctcgg ccataacagt gtgctgccct ggacgtccaa
    28261 agcagactgc aagcacaagt tgccactggt aaccggcacg ttcggcggca gcgatatcat
    28321 cgccagcctc gcagccccgc tgggcaatat tctgttctcg ccagacgaca agccgttcga
    28381 ggcgttcaaa gccggcgaac gttatgagcg cgaccagatt ctcctgatca tcctcggcga
    28441 gcacccggat cagagtctgc ttgcgggcta cgaggcgttc ctcgaagcac gcgatcaatg
    28501 ggccagcttg ccgttctccg aacaggtcga aaagttctac gcattcatcg gtacgccggg
    28561 gcgattgctt ggcaatgcgt ttggtatcgc catgcaaagt ctggccgtct ggctgggcaa
    28621 cagcgtcgat gatctgcaaa ccctgctcga cgaagacccc aacaccagcg gctcgaccga
    28681 cccgtcacat tcgcaactgg ccaaggatca cgcgcagcac ccgttgcatg tactcgccgc
    28741 aaccctcgcc cgaaaagccg tgctgcaagt gggtcaggcc gtactgggtc aatggcacgg
    28801 caaagagggt gcggagcatc cggctcgcgt tgccgcacgt tttttcactc acccgatgga
    28861 ctgtgactgg caagacgcca tcatcggtga atgggccgag gcaaatccgg cgcaaatcga
    28921 acgtgccgca ctcaagagcg agctggatcg ataccagtcc gacttgcaga gcaacgcaaa
    28981 gcaagacttg cagcgtttca gccaggacag cagcaacttt ctgaacgtat tttttgaaag
    29041 cacctcgttg gcggacttgt gggcgagagt gaccggcaag taagtgtatt gtccgacccc
    29101 gaccaagtac ggcactatcc gttgcctatc tgattgtcga tattcaagca cggttattgc
    29161 cgtaccacgc gagggatcca tgggacacac acttttcaaa ccgctgctgc tgacgaccgc
    29221 gctgctggcc tgcgcaccac tggcacaggc ggcaagcacg ctggtgtatt gctcggaagc
    29281 cagcccggca ggttttgacc ccagccagta caccagcggt acggacttcg atgcctcggc
    29341 cgagaccgtc ttcaaccgcc tgacccagtt caagcgcggc ggcaccgaag tagaacctgg
    29401 cctggcgacg cgctgggatg tttcgccgga cggcctgaca tacaccttcc acctgcgcga
    29461 cggcgtgaag ttccacacca cggactattt caccccgacc cgtacgttca atgccgatga
    29521 cgtgctgttc acgttcaacc gtctgctcga cgccaaccac ccgttccgca aggcctaccc
    29581 gtcggagtcg ccgtacttta ccgacatggg cctgaacacc acgatcaaga gcgtcgataa
    29641 agtcgatgcg cagaccgtca ggttcacgct gaacaacacc gatgccgcgt tcgtacagaa
    29701 cctggccatg agttttgctt ccattcagtc cgccgaatac gcggacaagc tgctcaagga
    29761 aggcaaggcc gatgaactga accagaagcc gatcggcacc gggccgttcg tgttcaagcg
    29821 ctaccagaag gactcgcaga tccggtacac cggcaatacc gagtactgga agcccgagga
    29881 cgtgaaaatc gacaacctga tcttctcgat cagcagcgat gccgccgtgc gcatgcagaa
    29941 gctcaaggcc ggcgagtgcc aggtcagcgg ctacccacgc ccgcaagaca tcgaagagat
    30001 gaaaaaggac cctaaactga aggtcctcag ccaggcaggt ttcaacctgg ggttcctggc
    30061 ctacaacgtt acccatgcgc cactggacca gctcaaggtg cgtcaggcac tggacatggc
    30121 catcgacaag ccggcgatca tcaaggcggt gtaccagagc gccggccagt tggccgaaaa
    30181 cgccctgccg ccgggtcagt ggagctatga cccgaccatc aaggacgcac cttacgaccc
    30241 gaccaaggct aagcagctgc tcaaggaagc aggcgtggca ccgggtacga agattgatct
    30301 gtgggccatg acggtacagc gcgcctccaa ccccaacgca cgcatgtcgg cccagatgat
    30361 ccagtcggat tgggacaaga ttggcatcaa ggccaacatc gtcagttacg agtggggcga
    30421 gtacatcaag cgcgccaaag caggcgagca tgacgcgatg atctacggct ggaccggtga
    30481 caacggcgat cctgacaact ggctcggcgt gctttacagc tgtgcggccg tcaagggcag
    30541 caactacgcc aaatggtgcg accccgccta cgacaagctg gtgcagcagg ccaagctcac
    30601 caccagccgc gatgaacgca tcaagctcta tcaacaggcc cagcacattc tcaagcagca
    30661 agtgccgatt acgcctattg ccaactcgaa ggtgttccag ccaatgcgtc aggaagtgca
    30721 ggatttcaag atcagcccgt tcggcctgac accgttttat ggggtgagcc tgagcaagtg
    30781 aagtaacacc agcgctcaac gcggctccaa ccgggtgcat ttttctcacc cggttgcgcc
    30841 ctaatggtgc gcgatacgtt tcgaaatgcg tcacgcaaac gatcaactgc atggaaaatt
    30901 acactttcgc gacattcttg tacgatcgtg ccactctttg tcgcttcttt ggcgtcactg
    30961 tcttgctttg ggtatggccc ctgcataagt atcggacgga tcggctcacg aggtcgttcc
    31021 ctctaatcaa aaatgacaac aactgaggca accatgctca aacacgcggt cattccgttt
    31081 ctggtcggcg ccagcttgct cgccagcgca cctttcgccc acgcagcatc gaacctggtg
    31141 ttctgctccg agggcagccc tgccggcttc gatccgggtc aatacaccac aggtaccgat
    31201 ttcgacgcct cggccgagac catcttcaac cgtttgagcc aatttgaacg tggcggcacc
    31261 gccgttgtgc caggcctggc aacaaaatgg gacatctcgg aagacggcct gacgtacacc
    31321 ttccatttgc gtgaaggcgt caagttccac accacgtcct atttcaagcc gactcgtgaa
    31381 ttcaatgccg atgacgtgct gttcacgttc aatcgcatga tcgacaagga catgccttac
    31441 cgcaaagcgt atccgaccga attcccgtac ttcactgaca tggcgatgga caccaacatc
    31501 accaagatcg aaaaagtcga cgaccacacc gtcaagttcg tccttggcaa agtggatgcc
    31561 gcgttcatcc agaatatggc catgagcttc gcgtctgttc agtctgctga atatgccgct
    31621 caattgctca aggaaggcaa gccggaactg atcaaccagc agccaatcgg cactggtccg
    31681 ttcgtgttca agagctatca gaaagattcc aacatccgtt acaccggcaa caaggattac
    31741 tggaagcctg aggacgtcaa agtcgacaac ctgatcttcg ccatcaccac cgacgcgtcg
    31801 gtgcgcatac agaagctcaa gaaaaacgaa tgccagatca ccgcttaccc gcgccctgcc
    31861 gacctcgagc ccctcaaggc cgacaagaac ctgaagatgc ctgatcaggc tggcttcaac
    31921 ctgggttaca tcgcctacaa cgtgatggac aagatcaagg gtgatgaccg cccgaacccg
    31981 ctggctcagc tgaaagtgcg tcaggcactg gacatggcag tcaataagca gcagatcatc
    32041 gactcggtct atcagggtgc aggtcaattg gcggtcaacg ccatgccgcc gacccagtgg
    32101 tcttacgaca cgaccatcaa ggacgccaag tacgatcccg agaaggctcg ccaactgctc
    32161 aaggaagcag gcatcaagga aggcaccgaa attaccctct gggcaatgcc ggttcagcgt
    32221 ccttacaacc ccaacgccaa actgatggcc gaaatgctcc aggccgactg gaagaagatc
    32281 ggtatcagcg ccaagatcgt cagctatgaa tggggcgagt acatcaagcg cgccaagaat
    32341 ggtgaaaacg gcgccatgct gattggctgg agcggtgaca atggtgatcc ggacaactgg
    32401 ctcggcaccc tgttcggctg cgacgcactg aacggcaaca actttgccaa gtggtgcgac
    32461 aagcctttcg acacgctgat ccatcaggca aaacaaacgc ctgatcaggc caagcgcacc
    32521 gaactgtaca aacaggcgca acacctcctg aaagacgcag taccgatgac gcctatcgcg
    32581 cactcgactg tctaccaacc catgcgcacc agcgtacagg acttcaagat cagcccgttt
    32641 ggcttgaact ccttctacgg cgtcagcgtg aagtaacagc ggtttgactg cgctgctctt
    32701 gcggcgcagt tcccgctcta cctgagcaag agacctgttg ggtagttgaa aagtgtcctt
    32761 atcggcactc ttcagctatc actcagatat ttcctacgca ctttgcatcc tgcgagccta
    32821 tataccgcgc gctcctgacg aattaccgtc ctgagctggc ggcaactggc aggaagccag
    32881 ccgccccgca accgttgtaa atcaatgtgt gcggacaggc tgttcggaaa tctttttcgg
    32941 gttggcggtt ttgggccagt cagacattcg agccttggct cgtcctttta aggataggga
    33001 tcatcatgcg taaaactctt gcgatgacgt catgcctcgg gcttttggcc ctggcccctt
    33061 ttgcccaggc ggcaagcaat ctggtgttct gctcggaagc gagtcctgcg ggctttgacg
    33121 gcgcgcaata cacctcatct accgataacg acgcatcaga gccgatctac aaccgcctga
    33181 ccgaattcaa gcagggcgac acctcggtgg tgcctgcgct ggcgacctca tgggatgttt
    33241 cagaggacgg tctgacctac acgtttcatc tgcgtgaagg cgtgaagttt cacagcaaca
    33301 agaacttcac ccccagccgt gatttcaatg ccgacgacgt ggtcttcacg ttcaatcgca
    33361 tgctcaagcc cgaccacccg tttcgcattg cttacccgac cgagttcccc tacttcacca
    33421 gtatgggcct gaacaagaag atcaagtccg tcgagaagac cggcccactg accgtcgtgt
    33481 tcaccctcaa cacggtcgat gccgcgttca tccagaatat cgcaatgaac ttcgccggca
    33541 ttctgtccgc cgagtacgcc gaacaactga tggccaaagg tgatgtgcgc gacatcaatc
    33601 aacagcctat cggtaccggg ccgttcgtgt ttcagcgcta ccagaaggac tcgcagattc
    33661 gttacaaggg caacaaggag ttctgggacc cgagccgggt gaagatcgat caactgatct
    33721 tcgccatcgt gaccgatgcc tcggcgcgca tgcagaagct caaggccaac gagtgccagg
    33781 tctcggtcaa cccgcgcccg gcagacctcg ccaagctcaa ggaagacaaa agcctgcaga
    33841 ttatcgagaa gccgggtttc aacctcggtt acatctccta caacgtgcgt cacgagccgt
    33901 tgggcaagct ggaagtgcgt caggcgctgg acatggcagt caacaagaaa gccatcatca
    33961 acgcggttta ccagggcgcg gggcaactgg cggtcaacgc catgccgccg acccagtggt
    34021 cctatgacga cagcatcaag gacgcccctt acgatccgga aaaagccaag gccctgctgc
    34081 gtgccgccgg tatcaaggaa ggcactgaac tgaccctctg ggccatgccg gtgcagcgcc
    34141 cctacaaccc caatgccaaa ctgatggccg aaatgctcca ggccgactgg gccaaggtgg
    34201 gcatcaaggt caagatcgtc agttacgaat ggggtgagta cctcaagcgc accaagaacg
    34261 gcgagcatga tatttcgctg atcggctgga ccggcgacaa cggtgacccg gacaactggc
    34321 tcggcacgct gtacagctgc gcggccattg gcggtaacaa ctactcgatg tggtgtgacg
    34381 aaaaatacga ccaactggtc aaggcggcgg tcgcgaccac tgaccgcgag aaacgcaccg
    34441 acctgtacaa acaggcgcag cgttacctca aggaacaagt gccgattacc ccggttgccc
    34501 actcgacggt caatcagccg ttgcgcgccg aagtcaggga cttccacgtc agcccgtttg
    34561 gccgcaacaa cttttcgggc gtgagcatcg ccgactgatc acaaataacg cttgcccttg
    34621 ccgccttgca cggtggcgag cgccagcacc tgcgcattga taacaacgca gggtctcaag
    34681 ccctgcataa ccaaaagcca gacttcaaag aactggcaac tataaaagtg ataaagggag
    34741 ctgcacatcg tgaaaaaaac aagcactgcg ttattggcct tatctctctc atcgtttggc
    34801 gcgctggttc aggcagagcc cgccagccag acattcatac cgaccgggct gagtaccaag
    34861 aacgcgcagg ccgaagccaa cggcttcttt gaagaccaac acctgaccgg gacaacccgt
    34921 aactggtacg ccaacgaact caagcgtcgc gacgaggttt ttcgctacaa cgataacggc
    34981 atccctgagc agacttcgcg ccgtatcaac tggcagcagg gcactatcgt caattacagc
    35041 tcgggcttca cccagggcgt agtgggcttt tccaccgaac tggcgctgta caacgccatt
    35101 gcgctggacc gtgacaccga tgacttcgct ggcaactcca accgtaccct ggcccacagc
    35161 gacggcgatg ccgttggtca gtggagcaaa atgggtctgg gcaacgtcaa ggctcgtgtt
    35221 tccaacaccg tcctgaccat gggccgccag tcggtgaaca cgccggtcat tgccttcatc
    35281 ggcaaccgcg cactgccgtc cagcttccag ggttttgccg tacagagcga cgagctcaac
    35341 aacctgtccc tgcagggcgg cagttttgat cgcgtatcac cacgtatgga acagagcctg
    35401 gacaagttcc gctccgagta tggtgatcgc agcaagcctg ccgaccgtct ggacatgttt
    35461 ggtggtgact acaagccgac cgacagcctg actgccagct tttatgcgtc gaacctggaa
    35521 gatttctggc accagtacta cttcgcgttc acccacgaac tgggcgacag caaggtcttc
    35581 gcgctgagca ccaacctgaa ctactacaag accaaggatg cgggtcagag caaactgggc
    35641 gcaatcgaca acgataccta tagcctttcc ttcaccggta cgcataacgc gcacagcgtc
    35701 agccttgcct atcaggaagt gaacggtaac gaatatttcg actacgccca cgacaccaac
    35761 gcgattttcc tggccaactc cctgctctcg gacttcaacg gcccgaacga gaaatccctg
    35821 cagatcgctt acgtgctgaa catggccgaa tacggcgtgc cgggccttaa gttcaacatc
    35881 taccaggcgc gtggctggga catcgacggt acgcattaca aaggcaccgg ctacaccgac
    35941 gtgctggcaa tggacggcga aacccactac gagtacggca tcggttcgtc ctactcggtg
    36001 cagtccggcc cgctcaaggc caccgctgtt cgcgcaacct acaccacgca ccgcgccagc
    36061 gagaatcagg ctgatggcaa catcaacgaa ttccgtctgg tgaccaccat cccgttcaac
    36121 attctttaac gtgttgaaac cgctctgacg caaggcagca gcccggcgtc agggcgaccg
    36181 ccatcggcgt caaatctacg gagggttacc catgaaaatg ttatcgctac gcaactcgat
    36241 cgccctggcc ctgctcagcg ttgccgtcag tgtttcggca aaacccctgg tggtctgcac
    36301 cgaagccagc cctgaaggct tcgacatggt gcaatacacg actgcggtca ccgccgatgc
    36361 cgtggctgaa accgtgttca accgcctggc agatttcaaa ccgggcacca ctgaagtgat
    36421 tcccgccctg gctgactcct gggagatcag cgaagacggc ctgacctaca ccttccacct
    36481 gcgtaaaggc gtcaagtttc acaccaccga ctacttcaaa ccgacccgcg acatgaacgc
    36541 cgacgatgtg ctctggagtt ttcagcgtca gctggacccg aaacacccgt ggcacgacaa
    36601 gtcgagtgtc ggcttcccct actttgaaag catgggcttc aaagaactgc tcaaaagcgt
    36661 cgagaaaact gacgactaca ccgtcaagtt caccctgacc cgccgcgaag caccgtttct
    36721 ggccgacgtt gccatggcct tcgcctcgat ctacccggct gaatacgctg accagttgtt
    36781 gaaagccaac aagaccaacg acctgaacag caaaccgatc ggcaccgggc cgttcatctt
    36841 ccagcgctat gcgaaagatg cgcaggtacg cttcaaggcc aacccggagt acttccgtgg
    36901 tacgccgccg tccgaagccc tgattctggc catcgccacc gacaacaacg tgcgcctgca
    36961 gaaactcaag gccaacgaat gtcagatcgc gctgtatccc aagcctgacg atgtcccgag
    37021 catcaagaaa gacccgaatc tgaaaatcga tgaaatggag gcgatgacca ccggctatat
    37081 cgccatcaac accacgcaca agtatttgag cgatgtgcgg gtgcgcaaag ccattgatat
    37141 gacgttcgac aagaacgcgt atgtgaacgc cgtgttcggc aagggcaatg cgctggtggc
    37201 cgtcaatccg tatccgccta ccctgctggg ttacaacaac agcctgaaga acccgccggt
    37261 tgacctggac aaggcacgcg ccttgctgaa ggaagcaggc gtgcctgaag gcactacgtt
    37321 caccctgttc acccgcaacg gcggtggccc gaccaacccc aacccgatgc tcggcgcgca
    37381 gatgatgcag tcggacctgg ccaaaatcgg catcaagatc gacattcgcg tcatggaatg
    37441 gggcgaaatg ctcaaacgcg ccaagaatgg cgaacatgac atggtgtctg ccggctgggc
    37501 gggcgacaat ggcgacccgg acaacttcct gaccccgatg ctgagttgcg aagcggcgaa
    37561 aaacggcgag aactatgcac gctggtgcaa tgccgatttc cagacgctga tcgacaaggc
    37621 tcgtgaaaca gtgaaccccc aggaccgtgc agcgctctat gagcaggctc aggcaatatt
    37681 caacaaggac caaccgtgga tcagcatggc tcacaccaga atgttcacgg ccatgcgcaa
    37741 caacgtagag ggctatcaga tcagcccgct caccattaat aacttcgcca ctacccgggt
    37801 gaagtagaaa aacaatccgg cgggctcata acccgagact cgccggagta tgcctaaccg
    37861 gctgatgagg tacacaccaa gatgtttagt tttatcgccc gccgagtggg gttgctgata
    37921 cccactttct tcggcatcac cttgttgacg ttcgcactga ttcgtctgat tccgggcgac
    37981 ccggtcgaag tcatgatggg tgaacgccgg gtcgatccgg aaatgcacgc tcaggccatg
    38041 gaacgtcttg gcctgaacaa accgctgtat gcccagtaca tcgattacat cggcaagctc
    38101 gcccaaggcg atctcggtga atcgttgcgt acgcgcacca gcgtctggag cgaattcacc
    38161 tcgctgttcc cggcaaccct ggagttgtcg ctggcagcac tgattttcgc atgcatcctc
    38221 ggcttgctgg ctggcgttat cgccgcactc aagcgagggt ccctgttcga tcatggggtc
    38281 atgggtattt ccctggccgg ctattcaatg ccgatcttct ggtggggcct gatcctcatc
    38341 atgttcttct cggtatcact gggctggacc ccggtttccg ggcgcatcga cctgctgtac
    38401 gacatcccgc cggtcaccgg cttcatgctg atcgacaccc tgctcagcga cgagcaaggc
    38461 gcgtttctcg atgccctgca tcacctgatt cttccggcca tcgtgctggg caccatcccg
    38521 ctggcggtaa tcgcccggat gacccgctcc tcgatgcttg aagtgctgcg tgaagactac
    38581 gtgcgtaccg cccgggccaa aggcctgtca cctgctcgtg tagtgtttgt gcacggcctg
    38641 cgcaacgcac tgattccggt gctgaccgtg ttcggcctgc aaatcggtac attgctggcc
    38701 ggtgcggtac tgaccgaaac gatcttctcc tggccgggta tcggcaagtg gctgatcgaa
    38761 gccatcggcg cacgggacta tccggtcgtg caaaacggca ttctgctgat cgcctgtctg
    38821 gtgatcctgg tcaacttcgt ggtggatatc ctctacggct ttgccaaccc acgcattcgt
    38881 caccagcgct gagatcatcg atatgagcac ccctactcct gcggtagcag tcgatcaaag
    38941 cctgctttac ccatccccgt acaaagaatt ctggcaagcg ttctccaaga acaaaggcgc
    39001 ggttgccggc ctgctgttca tgatcctgat cgtgttctgc gccctgtttg ccccttgggt
    39061 tgcgccacat gacccgagcg agcaataccg tgacttcctg ctgacccctc cggtgtggct
    39121 cgaaggcggt caatggcagt tcatcctcgg caccgacgaa ctgggccgcg atctgctgtc
    39181 gcgcctgatt caaggctcgc gcctttcgct gctgatcggt ctggcatcgg tggtcatgtc
    39241 attgatcccc ggtatttttc tggggctgct ggcgggcttc ttcccgcgca tactcggccc
    39301 ttccgtcatg cgccttatgg acatcatgct ggccctgccg tcgctgctgc tggcggtcgc
    39361 catcgtggcc attctcggcc ctggcctgat caacaccgtg atcgcgatcg ccatcgtgtc
    39421 gctgccgtcc tatgttcgtc tgacccgagc tgcggtaatg ggtgagctga accgcgacta
    39481 cgtgaccgct gcgcgtctgg ccggtgcaac cttgccgcgc ctgatgttca tcaccgtgtt
    39541 gcccaactgc atggcaccgc tgatcgttca ggcaaccctg agtttttcct cggccattct
    39601 cgacgccgca gcgctgggct ttctgggact tggcgtacaa ccgccgacgc ctgagtgggg
    39661 caccatgctc gcctcggccc gcgactacat cgaacgtgcc tggtgggtcg tgagcctgcc
    39721 cggtctgacc attttgctca gcgtgctggc aatcaacctg atgggcgacg gtctgcgcga
    39781 tgcgctggac ccgaaactca agaacaccgc ctgaggagat tcgcatgtca cttcttgaaa
    39841 tcaagaatct caacgtccgc ttcggcgacg ccaaggccgt acctgttgta gacggcctgt
    39901 ccctgagcgt agacaggggc gaagtactgg ccatcgttgg cgaatcgggc tccggtaaat
    39961 ccgtgaccat gatggcgctg atggggctga tcgattcccc cggtatcatc accgccgacg
    40021 cgctcaattt cgacggcaat gacctgctca agctcaactc ccggcagcgc cgccgcatca
    40081 tcggcaaaga cctggcgatg gttttccagg acccgatgac cgcgctgaac cccagctaca
    40141 ccgtgggttt ccagatcgag gaagtcctgc gccagcacct gaacatgtca ggcaaggcag
    40201 cacgccagcg tgcgctggag ctgctggaaa aggtcgaaat ccctggcgct gccgcgcgcc
    40261 tgaatgccta cccgcaccaa ttgtcgggtg gcatgagcca gcgtgtggcg attgccatgg
    40321 ccatcgctgg cgagcccaag ctgctgattg ccgacgaacc gaccaccgcg ctggacgtga
    40381 ccattcaggc gcagatcatg gacctgctgc tgagcctgca aaaagagcag gacatggcgc
    40441 tggtgttgat cacgcacgac ctggctgtgg tggctgaaac cgcacagcgc gtctgtgtga
    40501 tgtatgccgg tcaggccgtc gaagtcggtc aggtgcccgg tctgttcgag gtccctgccc
    40561 acccgtacag cgaagccttg ctggccgcta ttcccgagca cagcatgggc gccgaacgcc
    40621 tcgccacgct gccgggcatg gtcccggggc gctacgaccg tccgcaaggc tgcctgctgt
    40681 cgccgcgctg cccgtatgtg cgcgacaact gccgaaccga acgtcccggc ctggacccca
    40741 aggcgcatag cctggcgcgc tgcttttatc ccttgaatca ggaggtggcg taatgagcgt
    40801 cgtacttacc gcccgcgacc ttacccgtca ctatgaagtc tctcgcggcc tgttcaaagg
    40861 caccgcgctg gtgcgcgcgc tcaacggcgt gtccttcgag ctggaagccg gcaagactct
    40921 ggcggtggtc ggcgagtccg gctgcggcaa atcgaccctg gcccgcgccc tgacgctgat
    40981 tgaagagcca tcctccggct cgctgaaaat cgccggccag gaagtgaccg gggccagcaa
    41041 gtccgagcgc aagcaattgc gcaaagacgt gcagatggtt ttccagagcc cttacgcctc
    41101 actcaaccca cgccagaaag ttggtgacca gctcggcgag ccgctgttga tcaacaccaa
    41161 actgtcggca gcggaacgcc gtgagaaggt gcaggcaatg atggctcagg tcggtttgcg
    41221 ccccgagcac taccagcgct acccgcacat gttttccggt ggtcagcgtc agcgtatcgc
    41281 cctggcgcgg gcgatgatgc tgcagcccaa agtgctggtg gcggacgagc ccacctcggc
    41341 actggacgtg tcgattcagg cccaggtgct gaacctgttc atggacctgc agcaggaatt
    41401 caataccgcc tacgtgttca tttcccacaa cctgtcggtg gtgcgtcatg tcgccgatac
    41461 ggtattggtg atgtacctgg ggcgacctgc ggaaatgggt cccaaggaag agatctacaa
    41521 ccgcccgttg cacccttaca cccaggccct gctgtcagcg accccgacca ttcacccgga
    41581 cccgctcaaa ccgaagatca agatcgtcgg cgagctgccc aaccctctca acccgccaag
    41641 cggctgcgcc ttccacaagc gctgccctta cgcgaccgag cgttgcgcaa cagacgtccc
    41701 ggaactgcgt ctggtcgata accgccaggt ggcatgccac tacgccgagc agtttgtggc
    41761 ggcttaagct agaagctaga agactatcgt gcccacgctc tggcgtgggc acgccgctct
    41821 ggacgctctg cgtccgatct tcgccagtca atacacatcc cgccgataac gcccctgctc
    41881 gatcagctcg ttgactctct gcgcgcccag tacctcgtgc aacacctgat ccacccccgc
    41941 cgccatgccc agaagactgc cgcagatgta gatcgctgcg ccgtcgtcca gccatacacg
    42001 cagttcagca gcagcctcgc gcaagcgatc ctgtacgtag atcttttccg cctgatcacg
    42061 ggagaaagcc aggtccaggc gagtcagacc acccgactca agccagccct caagctcggt
    42121 accgcaatga aagtcgtggg cgcggttacg ttcaccgaac agcagccagt tgcgcgtctg
    42181 cccttgagcg atgcgggcct tgagcaagct gcgcaagccg gccagccctg tgccgttgcc
    42241 cagcagaatc agcgggacag gttcagccgg caaatgaaag ctgctgttgc gacgcacgcg
    42301 cagactgacc gtactgtcga ggaccgcatg ttcggtcagc cagccggaac ccaaccccag
    42361 actgccgtca gcatgaacct cctgacgcac aatcagttgc aggcattctt cctcgggaac
    42421 agaagcaatc gagtactcac gagcggatat cggcaccagc gcatcgatca gcgcctgtgc
    42481 atgcaacccc accagatgcg cacggttgtg cggcaactgg cgggttgcca gtgcctgagc
    42541 aagcgtttcc tgcaagccct caacgctgac cgtgctcaaa ggatcaacgc ccagaccgtg
    42601 aaggcattgc tcgatgacct gcgcagcgtt gcgcggcatc acctcgacca gatcacctgc
    42661 ttgccagctc atcaagccgg gtgccgtcag ctcaagcctg aacaccttgg agccactgct
    42721 gcctgggttc aaatgctcgc gacgggccag cgtccagttc tcgaaaaccg gtgcctgcca
    42781 gtgggccaaa ggcaaagagc cggtcagttg ccccagttgt tgctgccaat gctgcaaagc
    42841 ggcaggatcg gcgctgtcca cctcgacagg cgcaaataac gtacgcgcgc cctgctctgc
    42901 cagccagtca tgcaggcgat gggcgaaacc acagaaatgc agatattgcc ggtcgcccag
    42961 cgccagcacg gcataatcga ggtgctccac tgccagccga cggcccagca acttacgctc
    43021 gaacccccgc gcgctgtccg gcgcctctcc ctccccgaac gtgctgacga caaacaacgc
    43081 cttgcggctc tgactgaaat cttcttcggt caactccccc agacgcttca cacgcacggg
    43141 caagcctgac gcctgcaact gggccgcagt ctgccaggcc agttgctcgg cgaagccgct
    43201 ctggctggca aagccaatca gccaggacga cgcatctgcg cacgcatcat cctgcacctc
    43261 gccacgcgca ctcctgacat cgcgcttctt gcgacggcga tccaggtaca acaaccagcc
    43321 agtaataaag aacagcggca tcatcaatga ggcgcccgtc atgatgattc gacccaccag
    43381 gccaaagtag ctgccgacgt gcagcgcata gttgctggcc agcagttgcg cacccaaacc
    43441 acgctctgcg tagcgcaaaa ccgcactgac ctgaccgttg gccggatcaa gcgtaatact
    43501 gttcaaggct ctcggatgcg gggagttctt gagtagatag aacaccgtgg ccggttgccc
    43561 gccagaggca ggcaggcgca gattataggc gcgcagttca ggcccggccg tcttctggat
    43621 actgtcccag acggctgcgt aatcgaccac caacggtgcg gttttgttag ccgtgaccac
    43681 aggggccttg cgctgtactg acggcgcatc ccccatcagc gtattcagac cgttgctcac
    43741 ccagtcatac gaccagttca ggccggtgat ggcgaacagc aggtagaaca acaggcacca
    43801 ggtgccaaag accgaatgca ggtcccagtt gaaactgcgg ccctttttcg cccagtccag
    43861 tgtcagccag acgcgccagt tcaaggcatt gcgaggccag cgcagataga gcccagacag
    43921 gcagaagaac agcagaatca gcgtacaggc cgccgtaacc tgcttgccca cctcacctgc
    43981 ggccagataa cgatgcaact gcaggacaaa atcgaaaaac ccctcaccca ccgcatcgcc
    44041 tttaagctca ccggtataag gatcgaaatt gcgtttgggg ccgcgccttt cgcccggctc
    44101 cggcgtgaaa tacacctgag cggcgcgatt gccgagagtc tcgacacgca agatagccac
    44161 cgtgagcccg gttgcggcct ccagcttgtg gacaagttcg aggggaggca atgcagcagc
    44221 gcgctcttcg acaagcagag tgtcaggatt gagcacgtcg agaatttcgt cctcgaacga
    44281 atacagggcg ccggtgatgc ccatcagggc cagcaccaga cctgccgtga tcccgaagaa
    44341 ccagtgcagt tgaaacagga ctttcttcaa cacgctcgct actctcactc atattgcgcg
    44401 gcgcaattaa tgcactgacg gccatatcgt gtctatctgt aacgtgtctg tctgtgacgt
    44461 gttttttgcc acacgccgaa aaaccccgcc tatgtgaaca agcggggcaa tagcacgtat
    44521 cagctgcgcc agcttcctcg cagatctacc aggtaggtat tcagtgcatt tgcctggcga
    44581 ctgaaatgtt cgacgcgctc ctcgagccct tcggaggcgg gcagtcggca attggccagg
    44641 acctgagtca gcgccgtatg cagtttgccg atttctcgaa cgtagtcgtt cttgtagacc
    44701 tgaaccgatg ccagccccga aatctgatcg cgcttgctca cttcgacatc aagtgccgtg
    44761 cgagcctcac ccaccgcgtc ctgcagttcg agcgactgcg cctgcaatgt atcgcgcagg
    44821 gtaatcagat gatcataatc aacggcagca tccagcaggt ccagaatatt ggacacgcct
    44881 gcgatacctg ccttgatgga cccgatcagc gggtttttgg gatcgatatc cgccagtgtt
    44941 tccagcgacg cgatcaaagg cttcagcttg tcgaaaaagc tgagactctc tagatcggta
    45001 atcaatgcat tgaccacttt ttccttcgtc aacatttctt ccagacgcgt tttttcaatc
    45061 gcgagcctgg cttgcagggt gctgatctcc tgatcaagcg cgggcgtcag atgatccact
    45121 gcgttgacct gcactgcgtt caagttgatc agcgctttat cgagcacctt agcctgtcgg
    45181 gccagagagg caatgcgtgt gtccagaaga atactgatct cttgactgaa ctctgcaatg
    45241 gcagcgccac ttttcgcctc ttcaggctcg ccccttagct ttgcaatagc gtcaacaaac
    45301 ggcaacatct catcgccatt gaaaaaatgc ggaacgagcg tcagcgcatc cagtgcttcc
    45361 ttatcgacat tgcctacttc gtttaccagg ctgcgcagtg tttccttcat cacgggtaaa
    45421 taaatgtcac ctagcgcatc ggcctggtgt ttcagctttt cacgactgcc aatcacaatt
    45481 tccatattgg gttttggcag ttgaacaggc gtatcgagta cataaacgtt cataacggca
    45541 ttctctttgg gtatcaatgg gtcggcgctt aaacagcagg ctcttcaagt gcgttattga
    45601 acgcagtcag cagatcgaag gactgaactt taatctcttt ccagttggcc agcagtgttt
    45661 gaaaacggga aacaaaactg accaggtata aagcattatt ggtattcttg atacgatcat
    45721 gagaagactc gaccaactct tccagtagca cccataaact ctcgatattg ctgacaccac
    45781 tggccgcgcc atcgattctg gttttcaaat cctgaaggct ggtttcgaac gccaacagat
    45841 cgcccaacaa cctgttttgt tttttcagcg tcagttcaac caggcgcttc tctttgatca
    45901 ggtgatcctt ttcactgagc gccgccgtcg ccttgggacc ataaatggaa taggacacca
    45961 ccccgccgat aacgccccac cagaaaccaa tccacttgta ttccgagtac tcttcatatt
    46021 ccgcaagttt ctgattgatg caattgttaa gctgatcgac atcggctgtg agccgagcga
    46081 tttcgtcacc tgcgtttcca gagcgggcca gccttatctt caacgccacg ccgggggcta
    46141 tctcatcctt gaggcaacgt ttgaagtcag tcaccccgac tctggtacgg gtggtgcttg
    46201 cgctgtggtc cttgatgtaa accttgaggt catccaccag ggccagtaag ccgggtatct
    46261 tcttgctgtc ctggtccatc aacgcgacag gaggcatttg atcaatctgc gccggggtca
    46321 ggtcccccac ttgcagggtc tgataagatt gcagcccctt gatgaaatcc acgacattgg
    46381 ttgcgatggt gatcaggttg cccgagaaaa cataaagatc gctgccgacc ttctgcatgt
    46441 tcgtctcaat cgccgaccag cttctggcat gggtctggat acccacataa agttcagcca
    46501 ttgcgtctgg tgccaggccg gcaatgccat tatcactgcc gccgaccaac tggctgactt
    46561 cttccagctt cgttggaagt gacagaccgg tgttgacata acgtctgatg cgtcgaacat
    46621 cttcattggt aatcagaaga cccggcgcac gcgcgacgcc ttcccctttt ccggaaagga
    46681 cattcattaa atcctttccg acgcgaccga cgtcttcgac agtgtgcgct tcgccatctg
    46741 taaattgcgg ttcaactgaa gtaaccatta ttaatttcct tattatgggt atcctgtttg
    46801 cgacagcatt gaattgtcgc ttccaggcca ctgaaaacta acagagggtg tcaaacttaa
    46861 atagcgagcg gcgtggacat tgcctgtagg aataagcaac ggaacgtttc aggcaccgct
    46921 atattggcaa agaaaatata ataaacgacg ccgtagttac cttacacgcg agctattaga
    46981 ggcttacata tttatttttt ccaaaaaaaa acccactttc atgggttttt tatgaagctg
    47041 aaaatttaca ggtagaacga cttcagtggc gggaagccgt tgaattccac tgcgctgtag
    47101 ctggtggtgt aggcaccggt cgacagccag tacatgcggt caccgatggc caggttgagc
    47161 ggcaggccgt acttgtagtt ctcgtacata atgtcggcgc tgtcgcaggt cgggccggcg
    47221 atgaccacct cttccatttc acctttcttc tcggtccaga tcggaaactt gatggcttcg
    47281 tccatggttt cgatcagacc agagaatttg cccacgtcgg tgtagaccca acgctcgacg
    47341 gcggtgcgtg atttgcgcgc aaccagtacc acttcgctaa ccagaatacc ggcgttggag
    47401 atcagcgagc ggcctggctc cagaatgatt tccggcaggt catcaccgaa gtcttccttc
    47461 agaaagcgga tgatctcttc agcgtaggtt tccaggctgt tggtgcgggt gatgtagttg
    47521 gccgggaagc cgccacccat gttgatcagc ttgagaacaa tgccgtcttc ttccttcagg
    47581 cgctcgaaga tcactttgac cttggcgatg gcagcgtccc agacgctgat gtcgcgctgc
    47641 tgcgagccga cgtggaacga gataccgtaa ggcaccaggc ccagatcgcg agcaagaatc
    47701 agcaggtcca tggccatgtc ggtctggcag ccgaatttgc gcgacagcgg ccagtcagcg
    47761 gtggtcgagc cttcagtcag gatacgcaca tagactttcg agcccggtgc tgccttggcg
    47821 atgttgcgca agtcggcttc ggaatcggtt gcaaacagac gcacgccctt ctcgtagaag
    47881 tagcgaatgt ccttggattt cttgatggtg ttgccgtagc tcatgcgctc agggccgaca
    47941 ccacagctca tgaccttgtc cagttcgtag atcgacgcga tgtcgaagct cgaacccttg
    48001 tccttgagca gattgatgac ttcaacggcc gggttggctt tgacggcgta gtaaaccttg
    48061 gcaaactcga agcccgcacg caggtcgtcg taggccttgc tgatgatggc ggtatcaatg
    48121 accacgaacg gcgtttcttg cttgtcagcg aacgccttca ttttcttgaa ggtgtcggct
    48181 gaatagtagt cttcgacatt gatcgacatg ctgctggaac tcctgatggc aagcggtatt
    48241 ggtaaatggg tgcaaatgaa cgccctccgt atccccactt tggttcgcct acttcccaag
    48301 gcatgtcgcc gaaagcaaaa aggccactga agggctgcct tcctggcctt gctgtctcgt
    48361 cgtcagtact tgagccggat ggatcgtttc cagcatggac gttcggcgcg aactttagga
    48421 cctgaagggt tatagatcaa caaaaaatgt cgcatttgca gacgtttctg ccgatacggc
    48481 acgtctgccc cattgtagta accgacctgc atgacagcct gatgttcatt ttggaaagga
    48541 tttgctgatg atctgacgcc ttttcggtcc ctctgtcagc gtacaacctg cgctttccca
    48601 tggaaaatgt tgcagatcac gagccccttt ccggccgaaa tagccgccac ggccgaccat
    48661 caatggatgt aaacagtcgc tgcaaacccc gccaggacaa cctggcgaaa cctgatgccc
    48721 gcgcccgttt caccgcttgc actaataaca gccgctgtag cgccctaacg ttcttaccca
    48781 ctgtcagttc tgccagtggt cgtcccctgg cagacctctt acgctccttg gtgcacgacc
    48841 aacacattta ctgactgctg tttcacagga acgagggctg gggcatggat cgcctaaaga
    48901 caatactcat cgcactttca ttaccagcct tattggctgc gtcttcagta catgcaggtg
    48961 aaggcactga cgttgcctgg ctgatgagct actactacaa ccgaacaccg actgattgcg
    49021 gagcgggaag accgcttgat cagtgctcag ggctcaggct gcgcggcacg gacagcgggc
    49081 aggccttcga gccttgggac ccaagcccga actctgtaaa aagcggtggc gtctcaatgt
    49141 cgttcttgcg taaggacgtg aaatataaag atctgggctt gaaaaagacc aacggcttcg
    49201 ttctgaaacc gaatgatttc attagccaga acgaaaaaaa aataagcacg ttgtgtttct
    49261 ttcccctgga cgcctggacg gactatcgaa ccaatgccgg gtgcagcgaa aacagtaata
    49321 cgacgaacta cgttgaaaag atctgccagg acgctggggt taaaacagca gagcagtggc
    49381 tggctgacta tcgaagggtc aacaacgatc atcaaaaaca atgcgggttc gaaatcaaag
    49441 accgcgctga tgatgccgaa tcattttggc aaggtgtccg tgccaggcaa atggtccaga
    49501 acgacagaga tgccatggaa acccaaagcg aaatacgggt gcctccatgg ggggcagaag
    49561 aggacgcgca gttaccggtc ctggccttca tctacacgcc caaccctggg ctgccgtccg
    49621 ggctggaaaa agccaggggt gaccagaaac ggtactttca gaaaaccggt aaatgggtcc
    49681 ctgttatccg ggccgacctg ccaacagcaa acaatgtcga cgcccgcttc acctacaacg
    49741 agggtgatca acaccgagac gccccaaccc ctaaagtcga caacgaatgc aagagctaca
    49801 ttgccagcgc cacatggctg caacgagacg acccgtttat caaaggccaa ccctggtcgc
    49861 tgcaagttac gcccaccgaa tgcggcagga atatgaccaa acagcagcaa gcggcagcgt
    49921 acgccgagct gttcagcaaa tatggcaagg acaagcaatg gaatcccgat aacggcagca
    49981 tgaaccaaca gttggtatgc catcttgaat ggagcggcga cgataacggc aaaaaggtct
    50041 acacccgcga caaacgcttc tggaacctcg aacctgtccg cccggcggtc tcatgggatg
    50101 acgtgttcaa acagggctgc aatccttact aaaagctgtt ccctgcgcga acgtgttcgc
    50161 aaagaatcag gtaccgaatt agcgatattg tttgcctgaa gtaccgctgt cacgaatcaa
    50221 attcggtcac agggatcggg aattggcctt gaaccctgcg ccttggcggc gcagggttcg
    50281 ctctgccatc agcttgtggc ttcagccgca gccgtttcag caggcgaaac aatactggtc
    50341 ttcatcccac gcgaacggcc cgaactcaga taagccgcaa tcgactcttg cgtcacctca
    50401 cccaggaaca cattctcggc atccagcacc ggcagccagg cgcggttgaa ctcgtacatg
    50461 cgtgacagca ggatgcgcaa gtgttcgtca taggccgctg tagcgttgaa ctcacgcagg
    50521 aactgcgcac acgtgccctg ctgacggtgt agatcacgac gacgcacata acccatcgcc
    50581 ttgttctcgc cgtcggtgac aacgatgtag cgacggtcat tttcgtccat cacctccagc
    50641 gcatcggcca ccggggtttc cgggctgacc gacggcgcgt tgtcggcggc gtcttcggct
    50701 ttgaccagca gcaggcgctt gagcgtgctg tcctgaccca cgaagctgct gacgaagtcg
    50761 tcagccggat gcgcaagcaa ggtgtccggg tggtcgatct gcagcagttt gccgccgtgg
    50821 aagatcgcga tcttgtcgcc cagcttgatg gcttcatcaa tgtcgtggct gaccatgatc
    50881 acggtcttgt tcagtgcccg ttgcatctcg aagaactcgt tctggatcat ctcgcggttg
    50941 atcgggtcga ccgcaccgaa cggttcgtcc atcaacagca agggtgcgtc ggctgcaagg
    51001 gcacggatta caccgatacg ctgttgctga ccaccggaca actcacgcgg atagcgatgc
    51061 aggtactgct tgggctccag cttgatcatg ctcatcagtt cgcgggcacg gtcatggcaa
    51121 cgctgcttgt cccagcctag caatttgggc acgaccacga tgttttcttc gatggtcatg
    51181 ttcgggaaca gaccgatctg ctggatcacg tagccgatgt tgcgacgcag ggtcacttca
    51241 tccaggtcag tagtgtcttc accgttgatc agcactttgc cggaggtcgg catgatcaga
    51301 cggttgatca ttttcagcgt ggtgctcttg ccgcagcccg acgagccgag gaagacgcag
    51361 atttcgcctt cgttgaccgt gaggctgacc gaatcgacag ccttcacttc tttgccgttg
    51421 ctctggaaag tcttggagag gttctggagt tcgatcattt cagtaatcct tttggagtca
    51481 gcgtgcgttg cagccattgc agaagcaggt cggcgatgat ggccagaatg ctgaccaata
    51541 ccgcgccgac gatcagcatc gacatatcgc tgcggctgat tgaagcgaga ataagtacac
    51601 ccagaccacc ggcaccgatg gtggcagcga tggtcatgac accgatgttc atcaccacgg
    51661 cggtgcgtac accggcaaga atgacgggca ccgcgatagg cagttcaacc atgcgcaggc
    51721 gctggccgaa ggtcatgccg atgcctttgg cggcttcgcg aatacccggt tcgacgcctg
    51781 tcagtgccag gtaggtgtta cgcatgatcg gcagcagcga atagagaaac actgcggtga
    51841 tcgccggcat tgggccaagg ccctgaccga acttggagta gaacggcagc aacaggccaa
    51901 acaacgcaat cgacggcacg gtcagcagca cggtggcgct ggcttgcagc gggccggcca
    51961 gtgccggaaa gcgggtcatc agtacgccca gcgggacacc gacgacgatg gccagggtca
    52021 cagcaatgcc gaccaacgtg atgtgctgcg tggtcagatg cagcacctga gcccagtcga
    52081 tctgggagaa aacgttaaaa aaactcatgt cgtctccgtc cttagttaag tggatgctga
    52141 cgcaggaaat ctgcggcaac tttggatgga ctctcgtgac caacatcgat gcgggcgttg
    52201 aggtcgatca tggtctgggt gtccagcaga tcagccaaag gcttgagcaa cggggcaata
    52261 tccgggtgct tgtccaagta atcctgacgg atcaccggcg cggcggtgta gtccgggaag
    52321 taacgtttgt cgtcttccag caccttgagc ttgaaggcgt tcaagcgacc gtcagtggtg
    52381 tacaccaggc ccgcaaacac ctggccgttc cgtagcgcgg tgtaaaccag ccccgcgtcc
    52441 atctggcgag tgttctcacg accgagattc atgtcgtaat gcttgaccat gccgagcaga
    52501 ccgtcggaac ggttggcgaa ctcagtgtcc agcgctacga gatgcccctc tttggcttcg
    52561 tctttgagga ctttggtcag gtcggtcatg gtgttgacct gtgggtactt gtcagcgatt
    52621 ttctgcggca gcgccaaggc ataggtgttg ctgaatttcg acggggaaag ccagaccaag
    52681 ccttttttcg cgtcgagttc tttaacccga gcgtaggttt gttcgctgtc gagcttttca
    52741 tcaacgtggt tgtaattcac cagcgatacg ccggtgtact cccagatcag atccagttga
    52801 gcactttcct gcgcgctacg cgccaggctg ctgcccaggc cgccggtgac ttgaacgtca
    52861 taaccctttg tacgcaggta ttgtgcagtg agttcagaca gaatggtctg ttcggtgaac
    52921 acccgcgctc cgacgcgcaa cagcggcttt tccgcggctt gggcaaatgc cggaaacagc
    52981 aaggcaaagc ctaaaaacaa gcatattctt ttcatgataa ttccttcgct cagcgagcca
    53041 gaccgcgttc cagccagaga cgactggcca gtgtcaccag cccgtcaagc agcagcgcca
    53101 gcagagcggt acacgctgca cccagcacca gttgcggctg gttgttcaag gcgatgccgg
    53161 ggaaaatcag gctgccgagg ctgttcgcac caatgagaaa ggcaagcgga gcagtaccga
    53221 cgttgatcgc cagcgcgacg cgcacgccac cgatgatgat cggcacggcg ttgggcaatt
    53281 cgacacgcca cagcacttga cgcggggtca tgccgatacc gacggcggct tccttgagtg
    53341 aaccctgaac gtttttcagg ccttcatagg tgttacgcac gatgggcaac aacgaggcga
    53401 gaaacagcgc gaagatggcc ggcccgctgc cgatcccgag aatcccgagg gcaatggcca
    53461 gaacggcgag aggcggaacg gtgttaccaa tgttgaatat ctgcatgaag cgttcggcgc
    53521 gacccaccat gctcggtcgg ctgagggcga tgcctgcggg gataccgacc accagggccg
    53581 ccaacattga aaccagaacc agaatcaggt gagcctggag gtagaacagc aggtcatcct
    53641 ggtattgctt gatagtactg atgccgatcc agtggatcag cagggccagg agtgcgatca
    53701 caaccgcacc tcccaatagc cccttgccat agcgattagc cacaggcgga ctccttattt
    53761 cagtcggcga acgcgttgac cagggcgccc aaaaaggacg ccggcaataa cgttcgcgaa
    53821 gagcagcggg tgggtcgccg gtaagggttt aacctcggcg aaaacacaag ccataagcgc
    53881 agcttcgtca agccaacatg ctgatgaatc agccccttgc gttggcttcg ttgcgagcct
    53941 tgacggggga gtggacgtct ccacggcctg aaaggttccc acacgagaca ctatctggcc
    54001 atcgtttatt gtctgaacgg ttcggacatt gccgcgattt gagctataat ctgcgccctt
    54061 ttttcgatcc catcccaggc gatttcccat gacccaacag gccgccgaag tcgcgaaacg
    54121 ccgcactttc gccattattt cccacccgga tgcgggtaaa accaccatca cggaaaaact
    54181 cctgctgatg ggcaaggcca tttccgtcgc cggtacggtc aagtcgcgta aatccgaccg
    54241 ccacgccacc tccgactgga tggaaatgga gaaacagcgt ggtatctcca tcaccacgtc
    54301 ggtgatgcag ttcccgtatc gcgatcacat gatcaacctg ctcgacaccc cgggccacga
    54361 agacttctcc gaagacacct accgcaccct gacggccgtc gactcggcat tgatggtcct
    54421 cgacggcggt aaaggcgtcg agccacgcac catcgccctg atggatgtct gccgtctgcg
    54481 cgacacgccg attgtcagct tcatcaacaa gctggaccgc gacattcgcg acccgatcga
    54541 gctgctcgac gaaatcgaag cggtcctcaa gatcaaggct gcgccgatca cctggccgat
    54601 tggctgctac cgtgacttca agggtgtcta tcacctggct gacgactaca tcattgttta
    54661 caccgcaggc cacggtcacg aacgcaccga caccaaaatc atccagaatc tggactccga
    54721 cgaagcccgc gcccacctgg gtgacgagta cgaccgcttc gtcgagcaac ttgaactggt
    54781 gcagggcgct tgccacgaat tcaatcagca ggagttcatc gacggccaac tgaccccggt
    54841 gttcttcggg acggctttgg gcaacttcgg cgtcgatcac gtacttgatg ctgtagtgaa
    54901 ctgggcgccg atgccgctgg cacgggttgc caacgagcgc actgtcgagc cggaagaaga
    54961 aaagttcgcc ggtttcgtgt tcaagattca ggcgaacatg gaccccaagc accgcgaccg
    55021 tattgcgttc atgcgcattt gctcggggcg ctacgagaaa ggcatgaaaa tgcgccacgt
    55081 gcgcctgggc aaggacgtac ggatcggcga cgcgctgacc ttcttctcct cggaacgtga
    55141 gcaactcgaa gaagcctatg caggcgatat catcggtctg cataaccacg gcaccatcca
    55201 gatcggcgac accttcaccg aaggcgaagc gctgggcttc acgggtattc cgcactttgc
    55261 accggagctg ttccgccgcg tgcgcctgaa agacccgctc aagtccaagc aactgcgcca
    55321 gggcctgcaa cagctcgccg aagaaggcgc cacgcaggtg ttcttcccgc agcgcagcaa
    55381 cgacatcatt ctcggcgccg tcggtgtgct gcagttcgac gtggttgcca gccgcctgaa
    55441 ggaagaatac aaggtcgaat gcgcctacga gccgatcact gtctggtcag cccgctggat
    55501 cgaatgcgct gacaagaaga agcttgaaga gtttgagaac aaggccgtgg aaaacctggc
    55561 agtggacggc ggcggtcacc tgacctacct cgcccctacc cgcgtgaacc tggcgctgat
    55621 ggaagagcgc tggcccgacg tgaaattccg cgccacccgc gagcatcatt gacaggccga
    55681 tggcgccgca atgtgacgcg gagcgtcacg aactgataag tgtccgagag aacacctatc
    55741 gtgccgatgc tccgcgtcgg catgcagttc tggacgctcc acgtcctgtc ccgaacctgc
    55801 ggcgcagcgc aaatctgtga cgcggagcgt cacccacggc attcccacgc tggagcgtga
    55861 ggaacgatgg gcgtgtccaa aaatacgctc tgcgtccgct cccggttgac attcactgac
    55921 ctgaatcaac cattcagcgc aaaatgagaa ttaatctcaa tagtgccttg ctattatccc
    55981 gataagaatt attctcatct gacccacaca ggagatgaga catgacttat ttgatcgatg
    56041 catggctgga ccgaccacac ccttacctga gaattcttca tcgcgagacg ggggaagtgt
    56101 gtgcggttct ggaggaggag gcgcttgagg agttgcgcga tcagggtgat ctggatgtgt
    56161 gcagcctgag ttcgagcgag ccgctggtgc tcaaggagct ggtgagaaac ctgtttctgt
    56221 tctgctatgc gcgggcgttg cgcccgatgg gtgagttgca ctgagcatga agcatcagca
    56281 caaccccgcc gctgaacgag tcagcgcgat tcgttcagcg attttctgta tcgaacgggt
    56341 cgattacaga acgtccagca gttccacgtc gaacaccagc acgctgtgcg gtgcgatgct
    56401 gccgacgccc tgagcaccgt acgccagctc gctcggcacg tgcagacgcc atttgctgcc
    56461 ggcgttcatc aattgcagtg cttcggtcca gcccgcgatc acgccgctga ccggaaactc
    56521 ggcaggttcg ccacgatcgt aagagctgtc gaagacagtg ccgtcgatca gcgtgccgtg
    56581 atagtgcacg cgcacctggt cttcacgggt tggcttggcg ccatcaccgg aagtcagcgc
    56641 ttcaaattga aggccggaag ccagggtggt cacgccttcg cgcttggcgt tttcagccag
    56701 gtaagccttg ccggcgcctg cagcctgttc ggccttggcg gctgcttcgg cctgcatgat
    56761 ttcacggatg accttgaagc tggcggacat ttcttcctga cccacacggc ttggctgacc
    56821 gccaaacgca tcgcgcaagc ctgcaacaat ggcttccaga ttgacgcccg gtggcgggtt
    56881 gtcgcgcaac tggtcgccca actgacggcc gatgccgtag ctgacgcggg tttcgtcggt
    56941 ggacagattg acttcggaca tgacactgct ccgcagaggg gcacgcagtc gataattgcg
    57001 taaaacctga acggtcatca cgctttaccc tgatgcgccc cgaaccaaaa gggcaagcag
    57061 cctagcacaa ttgagccagc acgccctatc gcagcagcca ttggcccttg gcggtcagga
    57121 ccacgacgaa tgaaaggaaa tcggcatgcg catctcggag cggtcgttga ccggcatgcc
    57181 gcacagctca tcgtgcacca cgcaatgcac cagataaaac ggcaccaccg gcacattctt
    57241 cagcagttca cgggcatgct cgaccgaacg aaggtgcaaa gtcttgccgg ccgcatcctt
    57301 gagcatcacc gaagtgccgt tcatgcgcac atcgagcaga tagataccgc cttcgatgga
    57361 gatcaggttc agctcttcga cccgaccggc ctgggcgtgg tcggtaaact cctggtaatt
    57421 catggtcgaa cctcctgcgc aacgtctaat gcatcggaac ggacgtttta caacacactg
    57481 cggcgacacg ccagaaacga aaccacccgc cccttttatc cttcacaggc tcagtgcttg
    57541 gtcagcttgt ccagatagcc catcgcaaac gcggagatca cgaaggtcat gtggatgatc
    57601 acgtaccaca tcaggtattc aggcttgatg ttggtggcat ccatgaacac ccgcagcaga
    57661 tggatggaag aaatcgccac gatggaagcc gcaaccttca tcttcagcga agacgagtcc
    57721 atagtgccca gccagttgag cttttccttg tcctcatcaa tgtccagttg cgacacgaag
    57781 ttctcataac cggaaatcat caccattacc agcaggccgc ccaccagcgc catgtcgatc
    57841 aacgacagca gcaccagaat cagatcggct tctgccaggg aaaagatatt ggggatgacg
    57901 tgaaagattt cctgaaagaa cttgagacac aaagccagca ggcccaggga aagaccgaaa
    57961 tagatcggcg caagcagcca gcgcgatgcg tacatggcat tctcaaaaaa acgttccatt
    58021 gatactcgca aggtgttttg gaaggacggg cgagtatatc agcggtaacg cgctgctctg
    58081 gaactgcgac aaaatatcgc acgaccggcg cacaaggcac cggagaggca ctgggtatcg
    58141 agggattaaa agagtgatga gcgctggcac accgccccgt cactgccgat tcgcctcagc
    58201 tcggcctgca ggtgcagtga ccagatcggc acatcgtcga ggcatcggta gccgtgcaac
    58261 gaaaggtttt cgaggatgct ggacagcacc gactgcgcct ctggcatgcc attgaaaggc
    58321 ccttgagact tgattgccga aggctgctct tcagccatgc ccgccgcaaa cagcaccacc
    58381 cactgcccat tgtcatgggg aagaggccgg atgacacatt cgatgcgggt catcagcccc
    58441 atacattccc gggtaaggca aaggctacgc tgcatgatgc gctcctgatc agcgacagtg
    58501 ttcatccttc tcataagcag aatgcacgcc aaccctctgg ctgctgcggt catgatcaag
    58561 actagaagaa aacccgcgct acgcgaaacc tccctgataa acggaacacc gggcggcgtc
    58621 agcaccgccc ggttcaatga gcaccgttat cagattttca gctcgggttg cagttgcgca
    58681 ggctcttttt ccagctcttc cttgaggtct tcgtcgctga gcatttctgc gatatcgcgc
    58741 aggcgctcca ccacccgcgc attgacgctg ccttccggaa actcaccgtt ctcgtcaggc
    58801 gcaccggcgg gctcgccaac cagcaggctc aaggcctcgt cagcctggcg tacagcgtaa
    58861 atgtggaact gcccgtcacg cacggcctga accacacgtt catcaagcat cagggtggtg
    58921 acgttggcgt gcgggatgat tgcgccctgc tcgccggtca ggccacgcgc ttcgcaaagg
    58981 cggaagaagc cttcgatctt ctcgttgacc ccgcccaccg cctgcacttc accgaactgg
    59041 ttgatggagc cggtaatcgc aaaacactgc ttgagcggcg tgcgcgacag cgccgagatc
    59101 agcgtgcagg cctcgcccag cgacgcactg tcgccgtcca cgtaaccgta ggactgttca
    59161 agcgcgatac tggcggagat cgccagcgga aattcctgtg cgtaacggct acccaggtaa
    59221 ccggtgagga tcatcacgcc cttggagtgg atcggttggc ccagattgac ttcgcgctcg
    59281 atgtcgacga tgccgctgcc acccggatag accgtggcgg aaatacgcgc cggcacacca
    59341 aacgccgaat cgccaacctc cagaaccgta aggccgttgc acttgccgac cgccgcaccg
    59401 tcggtatcga tgaggatcac acccgccatc atgtcatcga gaatccgcgc agaaacccgc
    59461 ccggtacgcg tggccttggc cttgagcgcg cgttcgatgt gccccgcgtc ggtcttgtca
    59521 tcgttggcca gctggcggat gaagtctgct tcgctgacca gttgaaacag gtccccgatg
    59581 cgcgccgaca aacggccctg atgctcggcc agtcgggcgc tgtaggtcgc cagtcgtgcc
    59641 accgcgtcgg cggtcagggg cgccatgccc tcctccgaag tacgggtttt aagcaactgc
    59701 gcgaactgct ccagagtctc gtcgaccatc gggatttctt cgtcgaaatc gaccagcacc
    59761 cgaaacatct cctgaaagtc aggatccagg tcttgcaggg tgtaatacag cgaacgggag
    59821 ccaatgatga tgatcttgac gttccaaggg atcacctgcg gagtcagcgt cacggttgcc
    59881 acgcggccca gttcgcccag cggcgattcc attttcagct tgcgcgattg cagggtgcgc
    59941 ttgagcgcgt cccagacaaa cggctcgctg agcatctttt ccgcttccag aatcaggaag
    60001 ccgccattgg cacggtgcag cgcgccgggg cgcaactgtc ggtaggtggt gtatagcgcg
    60061 ccctgatcgg tgctgtattc aatgcgcccg aacaggttgt cgtacgtggg atgctgctcg
    60121 aaaaccaccg gcgcgccgcc gtcacgggtg tttccgacca ccaggctcgg actgtactgc
    60181 tcttccagca acttgcgcgc ctgggcatcg gtcttggcgt cgtcgaccag ttgctcgacc
    60241 agcgtcttga gcagataaac ctgcatcgct tgcaggtatg cgcagacagc ggcgttttcg
    60301 gcatattttt ccgaaagcgg cgccagcaat ggctgcaagg tcagggtaat ggtttcttcg
    60361 ttaagctgac gcaactggtt attggactcg cgtttccact gcggcaggct ggccagttct
    60421 tcgttgagac gttcctcaag ggaggaaata tcttcgtgaa aacgatcacg gtcggcctcg
    60481 ggcaactgcg agaactcggc ttcgtccagc gccttgccat cggccatcgg tgtgaacgcg
    60541 atgttggaat tgtcgcgata cagcgcaatg tctttctcca gcgacaggcg ctcgatcaca
    60601 tccagtgcgc ggtcgtaacg ctgattgaac gcgcggtcga tcgagctttt cttttgctga
    60661 taggacgggt gctcgaacac tgccgggaag gtcaccaaca ggttgtcgat caggccgccg
    60721 atatcggcca tgaactcatg ggcggtgccc ggcggcaatt ccagggcctt gggctcacgg
    60781 ggttcatcga agttattgac gtaaacccag tccgaaggcg cctgcatgcg cttgccttcg
    60841 gccttgaggt agcgtttgac gaacgagaag cggccagtgc cgggctcgcc catgacaaac
    60901 acgttgtaac cggggcgcgg catggcaacg ccgaactgca aggcttctac ggcacgctcc
    60961 tggccaagta caccgcgaaa gggttcaagc tcgtgggtgg tcgcaaagct gaactgctca
    61021 gcggaaaacg gacgggtcag cgcgtgtggc gccaggcgta ggttggctgc gacagaatcg
    61081 ggcatcagta atccttacat caggcggggc agatgtcggc attctggcgc tcgccgcacg
    61141 cgacttgcaa ggcaggaaag ccccgaaagg cgctcgcgga tgcaaagcct tcaccgttgt
    61201 gcgaaaaaaa atcttttccc ggcaataatc tgcaatagat cgcggaaccc ttggaacccg
    61261 cctacgctcc aaattgcgca ggtggttgct ggttggccgc ctgtcttgat gtgattactc
    61321 aagaaactcg acccttggct gaactaaaaa gagaaaaagc tatgaaacgg attcttcttg
    61381 gaacgctctt cgccgctgta tccatcaacg ctatggctca agcaccaggc ggtcctgact
    61441 gcggttgggg caacatgctg tttgaaggtc agcgcggtac tccagctcac ttcctggcat
    61501 caaccaccaa cggcacttcg ggtaacgcca ccttcggcat gacctccggc accaacggct
    61561 gctcgaccaa cagcgcactc acctacggcg gtaaatcctg gcttgccatg aacggcatga
    61621 tggatgaact ctccaaggac atggcaatgg gtcagggcga agcactgact acctacgccg
    61681 tggtactggg cgttgcgcca gaggatcgcg agcacttcgc ggccgtcact catgaacact
    61741 tctcgcagat tttcagcaag gccgacgcca ctgctgaaga cgttcacacc aacaccgtca
    61801 acgttctgaa aaacgatccg actctggcca agtacgctac tcaggcttaa agtcgttcgc
    61861 ccgccctttc ttcgcgaagg gcgggactct ctttcttgac tagttgccct ctatgctcaa
    61921 acgtcttgta acgctggcgc tgtttgtctg tgcccccttg tctgccgcgc ctcatgccac
    61981 cgcagaccgt ttgcagcaaa tggccaacga gccattctgg atttcactgg gtcactacga
    62041 agccggcaag ctgggtggct ggcgtagcta cgtcacagac ccaaaattct ttctcgccgc
    62101 cgacggtgct catgacccga aggcagagct gagcgccacg ctggaggcga tttacgcccc
    62161 cgtgaccaac gaacagaccc acgcccagtg cgtgtacccg gcacgtaccc gctggctgcg
    62221 cgaccagttg cacctgactg acctgccaac ccctgactgc aaggaattca aggcctggta
    62281 caaggatgtg gccccggaca gcactgtgct gatttttccg gcggcctacc tcaacagccc
    62341 gtcctcgatg tttggccata cgctgttgcg catcgacccg gccagcgcga aaaccaacaa
    62401 caccacactc ttgagctatg cgatcaactt cggtgcctac atcgaaggca tggacaacag
    62461 cattctgtac gcctggaaag gcctggcggg cggctatccg gggctgtttg ccctggtgcc
    62521 ctatcaggaa aagctctcgg aataccgcag cctggaaaac cgtgacctgt gggaataccg
    62581 gctgaacctg accgcagaag aaaccgggcg catggtcgag cacgtctggg aattgaaaca
    62641 gatccgtttc agctactttt tcttcgatga aaactgctcc tatcgcctgc tggaattgtt
    62701 gcaggtcgcc cgaccggggc tgcacctgac cgagcagttc ggcctgaccg caatccccac
    62761 cgacaccgtc aaggccatca aggccgcagg gctggtggag aagatcgact atcgcccttc
    62821 ccgcgagcgt gaattgctca gccgtgccgc cccccttgat gccgacgagc aacaatgggt
    62881 attgaacgtc agcgccgatc agaagcaatt gcaggacagc cagtatctgg cccagccgaa
    62941 agagcgccgc gctctgattc aggatgcggc ctatcgcctc gaacgttatc gcgccaacgg
    63001 ccttgaacgc gacacgcagc gctcgcaacg cagcttcgag ctgttgcagg ccatcaacca
    63061 gaacccgccg ccacaactgg atatcccgcg ccccggtttg cctgaagaag gccatgagtc
    63121 acgcacctgg cagttgggcg cgggcacccg tggcgacaag gcttttgccg aatacggcct
    63181 gcgtatggcc tatcacgacc tgaacgacaa cgcctacggc ttcccgctgg gcgcacagat
    63241 cgagattctg cagctcaagg tgcggcaata cgaaggcaac gactggcaag tgcagcaact
    63301 ggatcttgcc accatccgct ccctgacacc ccgcaccgaa ctgctcaaac cctggtcatg
    63361 gcaagtcact ggcgggctgg agcgtgtgtt aggcaagcat ggcgacgaaa acctcgtcag
    63421 ccatgtgaat ggtggcggtg gcggcacctg gcaactgggt gacgaagtgc tgggctttgc
    63481 gctgggcacg gtgcgtgtcg agcacaacaa cgattttgcc gagttcatct cccccgccgc
    63541 cggcttcaac accggcgtgc tgtggcgcaa cccgctgggc aacctgagcc tggaagccaa
    63601 gggcgactac ttcaccaacg gcgaagtgcg ccgcagcgtc agcctcaatc agcaatggga
    63661 gctgtcgcgc aacctgggcc tgcgcctgag cgcccaacgc gaattcagcc agatgagctc
    63721 gccacagaac gaagtgatgc ttgaggtgaa gtggtatcac tactgatcgg gtaaaaaacg
    63781 caatggcatc gcgcaaagga ctgcgcagga tcctctgcca gccgtttaag gcccttctcc
    63841 atggtttgca cagtcagatg ctcgccatcc agtgagtcga ccaatcgggg atgggcgccc
    63901 ttgcgtttca gcgaaggccg aaacatttcc tctgctggca cgacctcgtc aaaacgctcc
    63961 aggtccagcg ccagtgcctg attgaacagc acgttattga gccgtgtcag cgccggctgg
    64021 cggtgatcaa ccgacaaggc atgcacactg gcggcgacag aataactgcc cggcgatgtt
    64081 tcatacccaa cggctgttgc tgcataaagc gcagccttgt tgggcgcaaa acatcccgtc
    64141 agatgcctgg caagggcact taaaacgccc ttcgacgagc ttcccgtcgc agaggcgaac
    64201 aacgcatagg cttgagttcc agcgccagac tttttcacga ggacctctcc ggctaaagcg
    64261 ccacggcatc tggccgtcgg gctgtgtggg cgcgcattgg cgggcgtccg aattcacttc
    64321 ggaaggtttc gataacctgc ttgatctgct cggcaagtgc ctgggtgctt tcaagcgcgc
    64381 gggacaaact gtctgtgccg tgcccggtga ggtcgtgcgt gtaacgcagg cacaaggtat
    64441 tttgctcgat atccagcgcg atactggcgc ccagggtatg ggctggcgac aagttcaaat
    64501 gcagcgcaag cgccagcagc cgcccgtcct gttcagggtc gatgtagctc agggtgctga
    64561 tgacaaaaag cgcatccccg ccagcagcgg gcaccaacag gctggtgtga ccgtttttcc
    64621 cgtgccacag cagataccct tcatcccgaa gggagtgcaa atctgcggcg tcgtatccaa
    64681 gccgtttcag gctgtgttct agcagtccgg ttgcgaacgc gatcatggca taagtacctt
    64741 gcagtgagtc ctgtcactga gtggcgcact acgcgccgag gttccgggca accaagctaa
    64801 taacgccact atcgtgatat cacacattcc ctacgtcgct tttacaaata accaacacat
    64861 ttgcttctag actcttttta taagaggaaa ccaccatgaa gcagtattgg ctgttgttgt
    64921 cgctggccat cgtgctggcg ggttgtcagt ccacccgtga ccagatgctg gccgagggtt
    64981 atccaccggg gtttgccgag ggttatcagg acggctgcgg cagtggccgg gacgccgcag
    65041 gtgccagcac tggccagttc aagaagaacg tcccccgcta tttgaaggac aagttgtacg
    65101 ccgaaggctg gaccgacggc ttccgtcagt gccaggcgtc gcaggacaac cgtgaccgcc
    65161 tcgaccccgg ccaggtcttc aatgatcgcg accgtgcctg ggaacgggaa aaaacccgca
    65221 gcgcggccaa ggcctatcgt ccgaactgac ggtcggcaca ctgcaagatt gacgaaacca
    65281 atgcccttct cgtgcggccc aaccctaatt agggaggaca cttcatgagt cgcgcattcg
    65341 taaacgaaga caacgctgcc gccgatgccg aacaaccggt agagcggctg gtcagcgcac
    65401 agaccaatta cgtcacagcg tacggcctga cgttactgaa agaacacgtc ggcagcctgc
    65461 aggcacagca cagcgcgcaa aatgcgctgg gcgaggccac cgacaaacaa cgcctcgccg
    65521 acctggaacg tgacctgcgc tacttcaccc aacgcctgca aagcgcgcag gtggtagcgc
    65581 ctgctctgtc caccgaaaag gtgcagattg gcagctggat cacgttcaca gacgaagaag
    65641 acaaccatca gcgggtgcag ttggtcgggg aagatcaggc cgatgcaacc cgagggctga
    65701 tcaattgggg atcaccactg ggcagcgcac tgcttggcgc gcagaaaggc gatgaggtga
    65761 tgtggaagcg cccggcaggg gatcagacga ttgaagtgct gctgatcgaa cccgatcatt
    65821 aaggccgaca acggcagcgc cgctcccgaa cgggaacagc gctgccgggg ctgatcaggc
    65881 cagtttcttg tgacgtacgc ggtgcggctg ggcagcagct tcgcccaggc gtttcctgcg
    65941 atccgcttca tactcggtgt agttgccctc gaagaagatc gcttgcgaat cgtcttcgta
    66001 cgccagaatg tgcgtggcca cgcggtcaag gaaccaccga tcgtgggaga tcacaatggc
    66061 ggcgcccggg aagtccagca gcgcttcctc cagcgaacgc agggtttcga cgtcgaggtc
    66121 gttggacggt tcgtcgagca gcagcacgtt gccgccctct ttcagggtca acgccaggtg
    66181 cagacgaccg cgctcaccac cggacaggtc cttgacgaac ttctgctgat cgccgccctt
    66241 gaagttgaag cggcccacgt aggtgcgcga cgggatttca tagttgccga tacggatcac
    66301 gtcggaacca tcggaaaccg cctggaacac cgacttgctg ccgtccaggt catcacggct
    66361 ctggtctaca caggccagtt gcacggtttc gccaacttcg atgctgcccg aatccggttg
    66421 ctccttgccc atcagcatgc ggaacagggt cgatttaccg gcaccgttac cgccgatcac
    66481 gccaacgatg gcgcctttgg gcatggagaa cgacaggttg tcgatcaaca cacggtcgcc
    66541 gtaacccttg gtgacgtttt tgaactcgat gaccttgtcg cccagacgcg gaccggccgg
    66601 gatgtagatc tcgttggtct cgctgcgctt ctggaattcc tgcgactgca tttcttcaaa
    66661 gcgttgcaga cgcgccttgg atttggactg acgtgccttg gcgcccttgc ggacccattc
    66721 cagctcgtct ttcatggcct tttcatgggc tgtctgctgc ttggattcct gagccagacg
    66781 gtcagatttt gcttccagcc agccagaata gttgccttca taaggaatgc ccgcgccgcg
    66841 gtcgagttcc agaatccagc ccgccacgtt atccaggaag taacggtcgt gcgtgatcgc
    66901 aaccacggtg cccgggaagt cgtgcaggaa gtgctccagc caggcgacgg aatcggcgtc
    66961 caggtggttg gtcggttcgt cgagcagcag catgtcgggg gcggacaaca gcagacggca
    67021 cagcgcgaca cggcgctttt caccgccgga cagtaccgaa accttcgcat cccaggcagg
    67081 caaacgcagc gcatcggcag cgacttcgag ttgacgctcc aggttatgac cgtcgctggc
    67141 ttgcaggatc gactccagct tggcctgctc ggcagccagc ttgtcgaaat cagcgtccgg
    67201 ctcggcatat tcagcgtaaa cctgatcaag acgcgcctgg gcgtccttga tgacgctgac
    67261 cgcctcttca accacttcac ggaccgtctt gttcgggtca agttgtggct cttgcggcag
    67321 ataacccacg ttcagttccg gcatcgggcg cgcttcgcca tcaaattcgg tatcgacgcc
    67381 ggccatgatc ttcaacagcg tcgacttacc cgaaccgttg aggcccagca cgccgatctt
    67441 ggcgccgggg aagaaagaaa gagagatgtt tttcaggatt tcacgcttcg gcggcacaac
    67501 tttgctcagc cgatgcatgg tgtagacgta agagcctgtt tttcccgctt tgtcagtttt
    67561 ggacatggtt tgattcgcct ttaatcctgt attttcagtg ctttgagggt agagacaggc
    67621 gcttaaactc tggagataaa acgttaagtt ttgcgctgac cgtccgatac ccctgactat
    67681 acttagaaaa gttatgtttt atgagggagc tacatgggtt tccaggtcat agagcaggtg
    67741 gtgaatgctg ctcgaagaaa gctgttggtg caagactaca ttcctgtgta ctaccccaac
    67801 ctatacatca ccatggagca ctcgggcaga gccctcgaaa cgaccaagaa gtaccttgag
    67861 cacttggtcg tgcttgagga gtttcttgct ttttcctcca ttgatctcat ttctcacctc
    67921 gaacagcgcc ctcacagcga atacctgaca gacagtgagc tttctaggtt tgtgtcggac
    67981 gcagggttta gcaagcaaac cttggacatg aaatatgcgg ggatgcgttt gcatccgact
    68041 gcctacaaat ccgtaggcaa ggtccatgcg cagcagcgaa tcgaggctgc acgcgactat
    68101 ctggccttcc tttatgacaa gttgggagat cactcaacac gatatgaagc ggttgacgat
    68161 ctgaaaaagc gcatcaaccg caagatcaaa gcggccagac ctgcgtggag aaaaactcga
    68221 acggaagaaa tgaaggggct tacgagtcag gagcgaactc gattgctgga aatcatgcat
    68281 ccggataccg ccgagaaccc cttttcagat gaagccatca ggctgcgcaa ctacatcatt
    68341 ttgctgctgg gtctcgacat ggggctgcga cgctccgaga tgctgctgat caagactagc
    68401 gatattcact ggcacagtcg tcaactagcg gtggtcaacc ttgaggatga gggcctcgat
    68461 ccacggacga tggccccgca attcaaaacc aacgagcgca tgctggtgat gaccgatgac
    68521 ctgtatgacg caataactga gtacgaatcg aaatatcgca acagaaagcc ccgtagcggc
    68581 gcatcgctag cgagaaggca tcctttttta ctggtggcgc acaagcgaaa tgagggcgga
    68641 cctctgacca tcaaggcagt agatggcgtt ctgtccaggg tccgagaaat agcgccggag
    68701 ctggctcatg tgcacccaca tcttctgagg catgacgcgg tctacacgat gctggaaagc
    68761 atgcgtgagg aactggcagt gctcacaccc gaggatcgaa ccgtgcaagt tcaaaagacc
    68821 ctcacatgga tgttcggctg gagtcccgac tcgaacatgc ccggccacta cggcgcgaaa
    68881 ttctggaagg aagaggcaga caaagcaata cagaaacggg ccaagcggtt tacggccagc
    68941 cgtcagaaag cagacacgac acgaggaggc tcatagtgaa cattcccgtc gaagcacttc
    69001 aggcaccaaa ggagagcact ctagatgcgt ggctgaacac gcctcgcctg gcgaaatgtg
    69061 gggaggtgtt cacgcccgct gaccccatgt ggaaaccgga taagtcggct agtgattcag
    69121 ttaactggaa agcggctatt gcctgcgtct cgccggattg gcggccttgg ttgcacgccg
    69181 ccctggtata ccgaatggtc aatgtggcag cgcgcacggt tgctaacact gccagtgtgc
    69241 tgtcgcgggc tgctcaagct gggcttgacc cgctcaacga gggtcaactg atcgcactgc
    69301 gggagcgctt tagcgataaa gagtttagcg tcatggcctc cttcatagcg ttttggcacg
    69361 attgcgaatc cctcgaacag cgcccgtcgc aatccctgat cgatgcctac aagggattgc
    69421 ccaggaaaaa gaattccagc aacgatgtga tccttagcct agaccccgaa gaaggcccgc
    69481 tcacacaggt cgagcaggac gcgctgcatc aatggataca tgagcagttt tgtcacgggc
    69541 agttagattt cgagcagtac atttacctgc gcatgttgat gatttacggt cagcgtggct
    69601 atcaggtgcg aatgatggtt tttggtgatt tcacgaagag cgaggtcaag tttcattggg
    69661 caaagcaaaa aggcgacgag gcgggttggc gaaaaaaatc cgaaacattt aggctggatg
    69721 aggacctcta caacacagtg caggcctaca aggcaatgat tctggcgcaa ctctggcaaa
    69781 cgtatccaag cggtgtcgat tggaatgtag ccatccagaa tgtgccgctc tttcgtaaga
    69841 agctggatca tgatgcagca gaagcttgga aacggcggtg gaatccccct gtgttgctcg
    69901 atagccccct tcaaaaagcc ctcgaagacg cgccgcagcc cctctttcat gtcggatcag
    69961 gcacggtcaa gcaatggctt catcacatcg agcggatgga gagttttcca atttcacctc
    70021 gcacccatca gccgctgaaa gtggcggggc accggttcag gcacaccctc ggcacggacc
    70081 tttccaatgc ggggctgagt gagtttgcga tagcccgcgc gttgatgcat agcgatactc
    70141 gaacagtgcg gaagtaccgc gccgtgtcga cggagttgct ggcgttgatc gacgcgaaga
    70201 tgaacgacca tatggccttg attgtgaatg cgttcaccgg gatcatcgtc acagatctca
    70261 cctcagccat aaacggggat cgagcggatc gcctaatcga ggatgtggca gtgtgcggtg
    70321 ccacgaccgc ctgccttctc gatgcgccat atacctgtta tgcatgcgga aaattccagc
    70381 cccttctgca cgctaatcac cgcgaggtcc ttgagcgatt ggaacgtcgc cgggagcaaa
    70441 ccattgccac ggataaaacg acaggcgtgc tatgggatcg ggccattcta gcttgccgaa
    70501 aggttattct ggattgcgag gccatgcacc gatcatcgga ctcaagggca cagaagaatg
    70561 accgaagcgt ttgattctga accgccgaat aacattgttg attttaagcc caagagccag
    70621 ctggatccgg aggctcacct cgtggcgttt atcgaatggg caaaaaacac tctgcccaaa
    70681 ggcattccca atcgagtgaa cgcgagtatt cgctgggaag acggcagttg gcactcgcat
    70741 ggcctcttag gctgtagctt cacggcgctc ggatcgacct tctctgcccg aaaaacgatg
    70801 caggcaccct tcacggaatt taccaaagcc atactggtgt accgaagagt gtatttgcag
    70861 aaaaagggga tgagtgactg gatgaacgct cttagggggc tggaagtcgc cctgttcgag
    70921 ttgaccggca cgctggatgt gacacgggtg tccgccgctg tctgtaataa tgcgtgcgag
    70981 cacatgaagc gtcactggac gaaaggaaac actgcatacc tttacagtaa gtcacttgag
    71041 gccatcatcg ccctgatgct ggccaaaaaa ctgctcaagt cggatttccg gtggacctct
    71101 ccgctgaagc agagccagag aggcacgctc aagcagcaaa gagaggatcg ggaaaagaag
    71161 ctgcctaacc ctgaagcgat cagagccctc ggggaagtgt tcacaaacga attgacgagc
    71221 cgcctagaca tcgtagtgac atccgcctgt gcgctgttac tgagtgcacc cagtcgcgtg
    71281 ggtgaattgg cggatattcc attggatttc ctgctattca aagaggatgc ccagggcaat
    71341 cggcgcatgt tcctgcgctg gtacgcggaa aagatgaacc aggtgacggc gaagcccgtc
    71401 gttatccctg agatggagcc ggtcgtcgag cgggtcatca cgttactgaa accgatcacc
    71461 gatgaagcgc gggcttacgc cgcctggctg gaagaccatc ccgatgagtt ccccccccac
    71521 gcaggagtgc cactcaaggg agctgatgaa ccgctcacat acggcgaagc ttgtgccgcg
    71581 ctgaaactcg ccgttaacaa gggttatgca cgatcagtat tcaatatcaa cttactgaaa
    71641 agccttgaga agcaaaaggc gttgagcccc gccgcccgag cgctcttgac cgaaatccgt
    71701 gacgggtggg attcaagcag agggaagaga atacatgtta agggaaagat tggggttcag
    71761 ggttgggagt ttgacgaccg atgtgtgatc acgctacgca agctcaatat gctgttgcgg
    71821 gagaagtatc ttccaaagga ttttccatac accacgccgt acacggaggg caaagctcgg
    71881 ttgaagtacc gtgatgcgtt gttcaccatg cgcacgggag tactggctgg agactcaggt
    71941 acatctggtg cgcaactagg gtttggcgtg gagatagcgg cgaatactgg ccgaatgaat
    72001 gcgcagttag gaggtactaa caacccagca gtgaaaagct tgttcgagcg ctatggttac
    72061 cccggcgtca aggtcaacac gcatgcgttt cggcacgaat tgaacacgca gatgcgcaaa
    72121 gccggtctgt cgcagctctt gattgatgct ttctccgggc gctcgtcgat gggatcggtc
    72181 tacaaccatg aaaccgtcga ggaacgcacc caaggggttg cggcttatca ccccaaaacg
    72241 aagctcggca ccgctgccct gcgtctggac aaggttaaaa ccaatcagcc tctgagtctt
    72301 gcagatgtaa gggaactgcg cgagggtgag caggatcgca ttatccatca aacccatctc
    72361 ggcgtttgcg tgcacaactt tgcctccgag ccctgcccga aaatgggcgc ctgcttggac
    72421 tgcgggcggc tcggatgcgt caaaggggat gacgtgaagc ttggcaacct taaggaagaa
    72481 cgcgacgatc ttaaacgacg cctcgataaa gccctggatg cgcagtctcg ggatgtgttc
    72541 ggggcatcgg agtgggccaa gaaactgggt gagaagctct ttaagtgcga ggagctcatc
    72601 caaacgctgg aaaaccccgg actcgaaaag ggtgccattg tgtggaacgc tgataacggt
    72661 tggacgctca ccaagaacgc cgtcgcaatg tcaggtctga tcgcagtcaa agtcattgaa
    72721 gagcacccag cgcaagaggc gttatcatcg ttagatgacg tcttggcttt gctgaatgag
    72781 attgagggtt aaagatgggg catttaacgc caaaggatga gaagcgcatc ataaagctga
    72841 ttgaggaatg gtcagagccg aagctgacct ggcctttgct cgttgaggcc tgcaaagaaa
    72901 aactgggtat cagtcgtgct cgccagtccc tgatgaatct acctgccgtg gatttagcaa
    72961 tgaagaattg caaggcggca ttgaaagctc agaagctgaa accgggctgg attagcgata
    73021 tccaggcagc caacgaacac attgagaaac tgacagcgaa caatcagaag ctgctagctg
    73081 ctgttcgaga tatgcatagc cggtttttga tttggcaagc caatgcggat atgcatgggc
    73141 taacacaatc tatgttggaa cggccggttt cacagcttca aaagaggagc tgatccgttt
    73201 ttcagaacac ttaaaatatg gaaaagactc atcgcctctc cgtcttgata gaatcccagt
    73261 gagcagttaa acacctctgg attagcagga aacggccgat tctgttgaaa ggtcagcaat
    73321 tgcattcaag acacgtggtt gcactcttat gaccagtcat gatgaccagc gattgcgttg
    73381 gacctgagag gtaggctgag gccggcaaaa agcggcccag agcatgtaaa atattggtgc
    73441 cgttgcgatt ttgaacaagt tgccgagaaa tcactgaccc ggggcaggtt tctagcgaac
    73501 cattattttc actggatttt tttgacttga agtggattaa ttctacgcta gcacatgcat
    73561 caattgtaag cgctccataa accccaccta gtcaaagatg ggcagcgcgt tcaggaatgc
    73621 agtcgaggtg cgcagctcca cggcagcaag gcttcgtaat cttcaaccga cgtcgccagt
    73681 ggtaaccgct ctaatgcgtg gcgcagccac gcatagggct cttggccgtt ggctttggcg
    73741 gtctcgacca agctgtaaag ttgagcactg gccgacgcgc ctttgggggt gtcgctaaac
    73801 aaccagttct ttcttccgat gacgaagggc ctgatcgcgc gctcggcagc gttattgtcg
    73861 attggcagat agccttcctc gacataccgt tccagttttt tccagttact tgccagataa
    73921 ccgagggccc tgcccaaggc gttctgagac gtaacttgtg gctgcgtctt ttccatccag
    73981 ttttttaact gagccaacac tggcagactc cgatcatgac gaccggtttt acgatcatcg
    74041 tcacacgcat cgttcagatc acgctctacg ccatagagct tgttgatcaa gttcagcgcg
    74101 atatcagcac gtcccgtctt gcctttcggc tgtactttcc gggcttcaac aaacttgcgt
    74161 cttgcgtgcg cccagcagcc caaacgttcg actccggcct gcgcgcccag cgcgttataa
    74221 ccggcgtaat catcggtcat cagatagccg cgataacctt caagcaggcg cgtcggtagg
    74281 aaaacgaaaa gcactggatc aaagacggcg accttgatgt ccagttcgac caaggccgac
    74341 agaccatcga tagattttcg gaagtcgacg ggcttggggt acagatacac tttttcgact
    74401 ttggcatcgg gtcgcatcat ggcgagctgg ctcctgaggg aatcgggagc acagcatccg
    74461 ggatcagtta agcgctttga atgtggggtt tatggagcgg ttacttttga tcaacagttt
    74521 gtcagcgatg gcttaagtgt agagccgccc cgctgcccgc gttgtaacgg gaagctaaga
    74581 cctggggtag tgtggtttgg ggaggacctg cctattgctg tttggaagcg ggcggttggg
    74641 gcagcgcagg gctgcgatgt gctgttgtct atcggcacgt caggcgtggt attcccagcg
    74701 gcagagatcc cgagaattgc gctcaaatca ggcgcgcgcg tagtgcatat caacacaacg
    74761 gaaacacccc tcgagagccc tcttgaaatg tcccttattg gccgtgcagc ggtttgtgtt
    74821 cccgctatcg tgtcccagat cgcagcacct ggcaaagtgg tttgatagaa tcattggcta
    74881 cacataatcc ggcttcatga aagagagatt cgtcaccggc gttagcgttg acgctggact
    74941 aggcgtctag gacgccacat ctcataacct gttcgtttcc tgccgctcag tctgggctcc
    75001 accacgacga gctcgatgcc tacggaagcg ccgacagccc tgaacaaggc caaatagcat
    75061 ctctgctatc atcccccttt cctaagcggc attccttaca ttgacgtcta tacttgttgc
    75121 aatggagatc ggttatctca agtggtctcc agctatccgg cggttgaacg aatcgtttgc
    75181 gggcatatcc accgagctat gcagttgagt tttggcggca ccctgctctg tacagccccc
    75241 agcaccgtca cagcaatcgc cctgcgcttc gcggtagact caaaagaggc atcctatgtg
    75301 gagccacccg cactcctcct gcatcactgg caaccagaca cgggtctgat aactcattgg
    75361 gttgccatag gtgagttccc cgggccaatg ccgttcgcct aagctcagtc attgaacggc
    75421 accttgacgc tagaaggatg tttatttgta aaaaagcagc atgccgatca acacgcaatc
    75481 aatcaacacc atgatgcatg tagctgcaaa ccacatcagg ttttgataag ccaatttatt
    75541 ggcagttact ccaactaaaa gagtatacca cccaacataa cccaacatca tgcctgctaa
    75601 aatttgccat gactgaaacc ccgctctcgc aaaaaaaaca atcagcaaag ggatgggaaa
    75661 aagagcgtcg aaccaaagac cgtaattttt taaagagctg gcaagtatgt aacgaaagcc
    75721 atgagcctct ccaaattcag gactgacagc tgcccccgca aataccttat agaggtttac
    75781 cgcagcaaag caggtgaaaa acacacatac tagaacttta agccagtcaa gcatgaatgg
    75841 aacaagatag gaatagaatt ccgaaatcac caaggcgacc aggctattga tcagatcaaa
    75901 tgctagatag ctcaatagca aagtgagatg ggacctacct cctacgtaaa gaaggtcgac
    75961 gatggattgc gctcttcccc ctcgcgaggc ggtgagactc aatgtgagga caatgccaat
    76021 ggcgatacct gacacctatt cctccctgaa ggaatttcaa agcttcctca cacctgaatg
    76081 ttaagagtga ttcaaagtgg ttcagaacta tcgatgtaga aaggagtgta cgtaccttta
    76141 tcagtcacga tcagtagccc atcaatttgt cgtctaacgt cttgagccct gccactgacg
    76201 agtgcgatcc agccccaatc atccctaccc ataggatcta ccgatgtaaa gatgtcaagc
    76261 acacgggtgt gattcaatga ccagtcgagc gaaaacttaa tgtcatttat ccgcgcttga
    76321 accggcaatc cgtaaaaaat ggaaatggta tctataggcg atgatacgtt caacgtcgct
    76381 tcgctttgca agcagcccac ctcgatcaca tgtttgaaaa aatatacggg gtcacactga
    76441 taggaaagtg cgatctgctc agaaatagcc gctcccgcca cccgcccgaa attagcatcg
    76501 atcaataccg cagtcttagg gccgatcttg aattcgctgt gaaagtaccc ttgctgcaac
    76561 ccggagcgca gcacaatagc ctcaacagcc aacttcgcgc gttggatgac ctcttcggtg
    76621 aagtatttac tagcgggaaa gtaattaacc gattcggtat tagcgatctt cctgcgcaag
    76681 ctgaccccca gaaaatggca ttggcctgct actgcatacc cctccaaact gatcagttcg
    76741 ccgtcgacat attcttgcat tatgaattcg tgagccccaa gagagagcgc gcaactctgg
    76801 atatgggcaa gtatcttttc gttgaattct gagtccgata atgaaaattc agcgtagcct
    76861 gcagcccccg agccccgtac aggctttaca ataactttct tgcagtgtgc aaacgggcct
    76921 cgaaccaaca tagagaaatt actgaattcg ccaacttcca tgcttatagg actgtattcg
    76981 ggaattaagg aagaaacata ctcctttccg ccaagccggg ccaatgcgca atcgagtcct
    77041 tttaccccta acgtcgaagc gagctccaca gcaataggaa ttctcgtctc aacaagactt
    77101 agaatagcct cgatcgaatc cttaggaaga gcacctatca atttgagcac agcatcgacg
    77161 ttcgttgtat caccgcactc tagataagga aattccatca gttgagtgaa ggtatcacct
    77221 tgataatatc tggcactgcc gatgataaac aatggttcaa accccagctt caataccgcc
    77281 aaagcagagt agcgggttgc tacgtcactg gtttcgatca atattatttt tttcattggc
    77341 acgactccca attcaaatta gctttcattt ttctgataaa agctgacatt agcgctcccc
    77401 gccttataat ccgtcaacac gttaaaacaa tattcccggg attaaaaagc agtaaaacgt
    77461 atcagatatc ctactgcaca tcgcgtaaaa cccgctgata cagccaaaga gtcaggccgg
    77521 ataaaaacgc taccaataag gcaacccacg aagagttgac actattgaca agcactaggc
    77581 tcaaggccga aagcaacgct gccacccgta tatcttgctc actgacggct acatagatat
    77641 tacgatgttc atcgttgcaa aggcgggcaa agattgaaaa atgaattgga acgaacagtg
    77701 tagctcctaa cgagtaaaga aaaacagcga ccagtaacac gaaaatccca ctactcatgg
    77761 aggctatagt gaaccccaag ccgaacagta gcatgcctgc gaccaacaat tgcatctcgc
    77821 tcaactttgg tttcaggtaa tagaccggca acgtcagaac caacacaaaa agactattgg
    77881 cagaacgcat caagttggac aaatcaacac cactcaatga gaattcccga aaaaaaatgg
    77941 tcatcggtat ggatgaaaaa tcaactgcca gcctgactgc gatatagtgg ctgggcatca
    78001 atgcgattgt cgacattatc gtgcttgcca gtaaaaatat gataaaactg cgatcctttg
    78061 atgcgacaga aagagaccca aatagactac cagcattgct tgtttccaca ttgagcgtaa
    78121 cgggaacctt gcaccaaaaa aacaagatac ctgtcaagac gacacttaca agccctacaa
    78181 aacctatata ccctataaac cctgaggggt ataccaacat cacaataagc ggtcctaaga
    78241 tcaacgcaag attacgtacc cagtagatca agctatacaa gacggctcta tcgatgttct
    78301 tcgtcatctc gatcagcagt gactcggaca atgtcgctga tataccgcca agcactgaaa
    78361 cggacaccaa aaaaagcaaa taaacaatgt atgtttttgg gcaataacta attaccaccg
    78421 caaagatcag caaaatggct ccacgaacca cctcagaaac caatacgatg gcccacttat
    78481 ctactttcct tgccaaggca tcaatagcaa ttgatccgac cacagtcagc agcgcggccg
    78541 tgattaatgc ataggtcgca cgctccaccc caaactgtag ggaaatgacg atggtcatca
    78601 tggcgacaat cgacttttca accacccgat caataaaaat caggatcacc cttgccgata
    78661 ctgctggatt tttcaagtag ctgatcatgc gaaaccttca agtgtgtaat aagtgatctc
    78721 ttgggctttg caactaggag cctcagcaaa aactttaccg cgcttgttat aattcatgca
    78781 ccacactggg ccctatgggt tgcggacagc cttcaatcac tatgactttt tgtgctttta
    78841 tagatatcta ttttgaactc cccctgtttc gctcaacctc acttaacagg atttctagac
    78901 aagcctcgat cgataagctg gacgtgtcca gacaaaccga cgggtaaggt ggaggctcat
    78961 agggcgcatc aattccagtg aagtttgcca actcaccctg gcgtgctttt ttataaagcc
    79021 ctttaggatc ccgactttca catatgtgaa gcgggctgct aacgtagacc tcggagaatc
    79081 gatcgtcacc gatgatctct ttagccaatg cacgatccga agagtgaggc gagatgaacg
    79141 ctgctagcac agtgagacca gcatcattca tgaggcgcgc aacttccgaa actcttctta
    79201 tattctcagc ccggctctcg gcatcaaagc ccaaatcttt gcagagtccg tgccttatat
    79261 tgtccccatc cagaacagcg cagaaaattc ccctccgcat taaaagacgt tccaagttga
    79321 acgccagtgt acttttaccg gagccgctca aacctgtaaa ccaaagcgtc attggggcct
    79381 ggttcaggtt acggtgacgc tcgacagggg aaacagtacc cagctgccaa acaacattat
    79441 catttttgct cattcgaatc ctttcctgat atcgcacagg cgtgttagtc gccattactc
    79501 cgtacacggt aggccgatat gacctgccgt gacatgaaca ctcggagggc gctaggtatg
    79561 cctgcggctg cccatttagt atgaaagaga tacacctaaa gcccgttgta tcaactgagt
    79621 tgctgtcttg gctttttgaa cagagtcttg gtacgtcaca cctaccacgt gcaagtaccc
    79681 caaggaggta tcattatcga tcataggtaa aactgcctga ccctcaacta tgttaataga
    79741 gtgctccaac acccatggac agtgctcttc gatgaacaac ttaccaatat ttttttgtgc
    79801 cgttccgctt gctatcggtg ctattctacg agctgtagca aataacgccg aagccggccg
    79861 acattttacc tgactgccga tatatgcatt gaatactatt tcatagatac tcaatgacgt
    79921 tgacttatta tacagagttc ccaaggcccc acccatcaac cgcgggttaa cttcgatgat
    79981 atcgatacct ttatcggaaa cgataatctc gatatgaaac acaccaacat ccaagcttag
    80041 gcatgccaaa actttttcgc aataatcaaa aatttcctgc tcccgtggga agaaccctgc
    80101 aggtgccata atcgagccga tttccagaat atcgttgtgt tccgatctgt gcctctcggt
    80161 caacataaga gggaaaaaac cttgctcgtt cttggcaact tcaactgagt acatcttacc
    80221 gtcaatgtac tgttcaatga caaaatccaa agatacttgt gagagagcaa tatcgtctaa
    80281 cttaccgcgc gcatcattgt aatcagcgat aaacttatca acatcctgtt gatttttaat
    80341 atgagcggta agaaatttgg caaacccttt cgccggcttg ataatacaag gaataccgat
    80401 tttcgcgaca acttcatgta aagcgtctag agatgcacat tttttgtacg tgcaattgct
    80461 caaaccattt ctatgcaaaa gtgcacgggc gcgaggtttg ttctttgcat ttttaacacc
    80521 ctcgattgaa gttgcccgta ttcccagatt tgcagcaatc gtggaaacgg actcgacaat
    80581 atcctccagc ggcgtaaaca tgacgctcaa tggatgcgcc tcatttatct cccgcacctt
    80641 ctcctcaaac gccacaagat cgaggcagct atcaatgctg taaagtttat acgtattctc
    80701 aattaagaac tcttcactca acgacgaaaa aagacgcgtc atctccgtgc gtaaaaaaat
    80761 caaattataa ccaatctgcc tggcggtgat aatagccctt gacgaaacgt ccgtgcagtc
    80821 gaccattaat atattcgtca tgaactgcct ctcgtaaatt caatattcaa aaataaccag
    80881 atctgtgttc ttgaaactga tcaaaccaaa tagctttcga gttttcctcg gcggcggatg
    80941 tcaacggtgg cgcaatgaaa ggagccgccg aaactattga agttacggaa atcacataga
    81001 atcggctcaa accctgcgcc tttcatggcc tttatcatgg gctcgtcttg tcgttctaca
    81061 acaacacgcc gttcatccag catcaggatg ttcatgttta tccatttgct ggtcatgtac
    81121 aggggatggc tgtctggcat gatgggtttg ggtgcatgaa tggcatccca gccccgaaat
    81181 atttccggca tcttctggac acgctcggga ttgatcaaca acttgcccgg cgctaacggc
    81241 accaacgtcg catcaatatg cattggatgc atatcattga attcgaggac atggatctta
    81301 taatcgtcac ccaggtgccg ctgtaaccag ttgatcccga actcattagt aacattactt
    81361 ttttgagcaa tgatgtcttt cccaagcctg gtgaagtctg cagcgtcaaa ggtcggttca
    81421 aactcagtga tcaccagatt ggccgaggtc gcggcttcat cttcaaccca accatccacg
    81481 tactgctcat ccgacagttc gggtttcggc ccggaactcc atttggcacc accatgaaaa
    81541 tattccttga ggagtttctt gtaggcagcc gtttcaaaat aacgagaacg ccaagccaaa
    81601 gggcattcaa tgatgtcagt gccgaccacc agcaaaacat cccgtggcat cgccgcatac
    81661 attccagtac ttgaccagcc cggcgcaccg tacacgaggg attgattctt tggctccggg
    81721 cgccggacct tgacgccttc gcattcaagg attcgtgcga attcatcgag ctcttttctg
    81781 gccaggtcga ttctttcctg aggaaaaggt ttgccggcgt tatccctaaa aaactgatgc
    81841 tgctgagtcg gcaggcaagg ttccatggcg gcgtgccaag gtgggatgca cgcaccgtcc
    81901 accaccccga cgatgatttc ttccagcaag tcccattcag tgtaggaaca cacgggcgag
    81961 gtttgaatga cgtttgaatc tttttcattg agttgcattg aacggatctc tttcagcgta
    82021 aatattcagt ttgaattcat ctgggaacaa cagcaccggt cgtttctttc acagggcgac
    82081 acttgaactg gagaacccac atcaatcggt gttatgtccc gactgagcta aaaatcgaga
    82141 cagttcggcg atgctcggcc acagtctttc cgggcgcggt acatcgcttt cggtatagga
    82201 ggctcccttt ccggttagaa ccaaggcatg tgctacttcc aaatgttggg ctgcagctat
    82261 atcggtgagc aggtcgtcgc caatgatcat ggtttgcgat ggtttgactc ccaggctgtc
    82321 catgaccgag gtaaaaaaga caggggatgg cttgcctgtc accaacgcct gtttaccact
    82381 cgccgcctct agcccgagga tgaaagcgcc gcaatcgagt ctcacgcccc tggggtcaaa
    82441 ccagaacagg ttcttatgcg gtacaaccag acgcgcgcct ttgtgcaagt aaccgaaggc
    82501 ttgattgagg caggcataat cgaacgactc gcctatatcg ccaatgacca cgacatcagg
    82561 gctcacgtga tcacgagcga tgccctcgaa catgctgttc actgactcag gcatgagaaa
    82621 gaaacagctg acgtccccaa gtgacttcaa atagcgcgca caggacgttg acgcggtatg
    82681 aatctcttcg gcccggacat taatgccatg gcgctgtaaa tcttcggcaa tggtcgaagg
    82741 tagctggcct gtgatgttgg tcaaaaaacg aagttgaagt ccggccatcc gtgccgcctc
    82801 gatggcctcg gcagcgccgg gaatggcgtg ccccttgaag accattgtgc cgtcgatatc
    82861 cagcaggagc gcttttattt tcatgagatt cccggggcag ttaagggatt ggaaatgaac
    82921 aagtcgttta acagccgggg caacagttgc tccagacaca gaggctgcgg ccacggcctg
    82981 gacggggctg cgcccaattc aagcaacact cctttcaacg acgcggcatc ggaccacaca
    83041 ctgtgatccc cccctttgcg gctcgactca atcaatgcac cggtgtgatc ggcgcgcact
    83101 cgcacgccgg gagggggctg caggtaaaga tcgctgcgcc agcccgaacc taatgtcgcc
    83161 gcagcccctt gcagcaatgt aaaaccaccc tcgccgagtt ccgcgaaagc ggtttgcaag
    83221 gcatctaaaa cctggggcgc gccgagcatg ccaatacctg caggctcgag ccgcagcacc
    83281 aacaggccat tctctgccgg gtggaaaaag acgttcgaac gctgggcatc gaggttccct
    83341 tgggcatcga gggccagcca gccaagctcc agaaacaagc gattgggtct gatatcccac
    83401 cagatcggct gcattccgtg atcggaatgg gcgatgaagc gtgtctcttt ccccgatgcc
    83461 gtttggcacg cggcgaacaa ctcgtccaac cagcgtgcga gtcgctgttc aatggcttcg
    83521 aacaacaatt ggggagtgct tgcatcttcc aggtagcgca acaactgatg acacaccaag
    83581 tcgatgacgg ggtagtaggc gactgtcagg tcggagtcgc ccgcctccag cgccaaaaca
    83641 acatcggcga caaagctctg atggacgctg tcgagcaaat ccagcagaag cagctccgca
    83701 gctccggatc caccttcatt caggcgcccc cccaactcac cggcggcgta gagcttgccg
    83761 gggttaccgg cgacataggc acgatccatg agctggcgtc tacgttcgcc ggccaggctt
    83821 ccatggactc ggattggttg aaaccccaac acgcaaagac acaattgctg atcaatgatg
    83881 actgcccgta ccgcaaaagc ccgatggctc tccccccctg cgcccaccgg tatcgccggg
    83941 gaaagaggta gatgccgagt ctcgtccagg gcaatgcgag cctgcttgcc ttgctcgtcg
    84001 accaagacca tcgccacctc atcggcatgc accctgaaac tcaatcccaa ggcttcgcac
    84061 cgcaaacatt cacctgcccg cacgatgctt aggggtagca ccgggttcag gtacacctca
    84121 gtgtgactga gcaactgcgc gcccaagcgt tcaggctgga caaacgggac accgcaggtg
    84181 cgtatggcgc ggccggcttg ggcgaaatag tcccacgcca tcaagctttc gcgcggccag
    84241 acctgaaaag cgtcccgcca gtgagcaggg ttgcccgcta ccgcttccgg gatctcatac
    84301 ccggtcaggc cgtggcgtgc gactggttct gcactccaga tgctgaacaa cgaaggcggc
    84361 gtctggcaat tggggaacag cggttccagc gtcgccgcat gattcgcttg gatgcccatg
    84421 cggtttcgca gccgctggta gagatctcgc gaaaggccgt ctaccaaaag ccagagcaac
    84481 gactgcctgc tcatgcctgt agccctgctg gcaatgaact catcagatga ttggcaagtt
    84541 cctgaatctg atgacggaag gcatcgggag tgctgtcatt ggcgagcgta aaatcggcat
    84601 ggatgcgttc tatctgaaag tccagagcac tgttatgaat gacactgatg tccttcctcg
    84661 actcaagtcg tcgctgacgc gaaagtggat cggtgacaat tttgatcact ttgaatccgt
    84721 tttccctgag gtaaggccag tcggtttgat cgtcacgtaa atcatcgttg atcacgacat
    84781 cggcttcggt tttttccagc tcttgcgcga acgccttgac cagcgcgaac gggttgataa
    84841 aacgtagttg tccagccact tgctcaagca gtttctgatc ttgggcccca ggactgagcg
    84901 ctgtgcaagc ttccgagtaa aatcgcgcct gcagtcgata aaggggagcc gccaacttca
    84961 acacctggac tttgagcccc aagtgagtga agtactcata gaggtaattg gcggccgtac
    85021 tctttcccga accactcggt gcaacaatgc tgagcctaat ggctccccca cgagttgact
    85081 gactgaaaga cattgagcag acctctcagg cggttgtggc ttggttatcg tgggtcgacg
    85141 tggagctgcg accggggctg tacgtccaac gaacccggga caacgcctcg cgtaatgcgt
    85201 ctgacagggc acaaggaatg tccgtcctcg ccggcgggat tccatgccag gtcgacgttg
    85261 taaactgcgc aggccattcg aatacgctgt ccccgtcgat caaggccagg atctcgaccg
    85321 tcgacaggga ctgccgggac cgctcggcag actgcatgac ctcgggtaaa accacttcgt
    85381 ccagccagga acttcccgtc ggcgcccggc cgaacacttg ggcgaaacgc tcgggcgcta
    85441 tcagcacctt gtgtcggtct gcgcaggccg ggtcattgat caggccggcg agttcgggga
    85501 actcctcgat caaacatgga tgctggcgca ggctgcccag gccgatatgc ggataatccg
    85561 gccagccacg tgcccgtacc cgaccgtcct ggacatccaa tagcagcttg tcgcccgagt
    85621 aatagtcgtg ctcccccgcc aacacatact ccagcatcgt ggtggtcttg ccagccccct
    85681 tgaccccggc aaaagcggtc acggccttgt gcgaacggga caccaccgca gagctgtgaa
    85741 gaaccgccga acctttcgcc gactccacca gcagaccgta atagcgcacc agttcgatga
    85801 gatgaatgaa ggcgtcctcc gcaccgtaaa agtccacttt gcgggtagac atgcggtagc
    85861 ggtaaccgac ctgtttttcc ggatcccagg ccaacgactc gccgtttggc agatcgcccc
    85921 gccagacctt cagggtgaag ccgacggcat aggtttcgcg aatgagatga ggtatctggc
    85981 aacgcgtttt ccagggggtc tcgaacgctt gcggagcgtg caggcagacc gtgagatccg
    86041 ccggtgcgtc ggagttatcc accatcagat agggcgtgaa gaacgccatg aggcgcggga
    86101 ccagccctgc cggatcggct tcgacctgaa gcgataaccg gaacacacca ttactcagta
    86161 agtagcccat ataacttcct tgaattaagg cgttaaacac ctgcaaagct gatctgaaag
    86221 gcatcggcga aacacttttc agcccggtat tgtttccaac ggacgctgat tcgcctggac
    86281 gagtacgttg cccggtgtcg acagtgccgc gcgatagagg gccggagagg ccagggcagg
    86341 aacgccgctt tcgcgcagca gaatcgccaa atgacacagc agcgatgaag attcgaaaat
    86401 aaagcccgag acataaggga taagcgccgc caatgccgca taaggccgtg gcgataccat
    86461 gacgatcggc gccttcgcct gttcgatgcg ctgcatcagt cgcatgatcg ccgggccaag
    86521 ggtttctgga gacggcaagt tattgatgga aacagtcgcg gcaatactga tttcttcaat
    86581 ctgggcacac tcatcgacca ccaaggacaa acctcgggcg aaaccgggag agatggttct
    86641 ttcgccggcg cggtcatcca ccagaaactg gcttttcaac ggcgaaaaat ccaccaggct
    86701 cagttggccg cgatcaacta cccactccag ctgaacttca ccgagcccgg cgatggcagc
    86761 ctcggtcacg atgaccagtt ggcgccgttg atgggggttc aaaggaaggt ccagggtgcc
    86821 ggtagacaaa ccatggcctg gcgccagtcc atcggcatcg atacgccagg tggacgtcga
    86881 agcactgccg cggttgatag ccagcaaacc gtcaggcgaa tactcgcaaa gcacttggcc
    86941 ggcgtaggac gtactgccca gggattgggt aatgagcccg gcgtcgccgc ggataaagtc
    87001 acgcacgaca aacacctggg tctgagcgcc caacaactca cgcaaacgcg ctggtaattg
    87061 tgcccgtggc aagatttgct ggcgtatgcc cgccgaaaaa tccagcacca cctgatcgct
    87121 gtgcaactgg gccagcaatg catcgctatg cgcttgtgtc attccaccag cgttggcggc
    87181 gatcaacaat gcgctgcctg cctcgacccc gtgatcgagg gccagcaacg ccagcggacg
    87241 gcgcttgctg cgaaagtatt gggcgaagtc cggccatgga cgaaagggtt ccagctccgg
    87301 gtcggcggcc gtataaagat ccacccaatg gcaaagtggc gcactggact ccagattcct
    87361 cagtgaggcg ataacccgcg cctgcaacaa ccagacttgc tggccatccc aggcccactc
    87421 gatgtccgca ggggcgtgca aatgctgtct tgccaacgac aacagctctg caatcgagct
    87481 caacatcgcc ggctctgcca gcaattgggg ggcgccggtg aaatcaccat tggccagcaa
    87541 cctgacggac aatgcctgac tggcgccgga caccaaggca tcccccgcac cggctactgc
    87601 ttcgataaga ggcactgcgc tgccatcgag ggggtcgtga ctgaaggcaa cacccgccca
    87661 gcgcgcagcc accatatgtt gcacaatgac ggtcattccg acagatgcat ccagcagctc
    87721 acaccgcagt cgttcaacaa tcgcccggtg agaaaagcca gaacgccaaa ccccttcgat
    87781 agcgtcaaac aacgcgtccc agccactcac atccagccat gaatcgaaga taccggcaaa
    87841 actgtgggag gcgccgtctt caatggcgca gctggaacgt accgccaagg gctggtgaat
    87901 attgatatcc gcctcggtga gacgagactc gagataatca cgggcatccg ggcgccactg
    87961 taccggcgcg agcaactgca actgttcgag atgtttgtcg aggaacgccc ccgccgtcag
    88021 ttgaataacc tgaagtacgt cacgtaactg cttttgcagt tcctcgtaat tatgccaaag
    88081 tcgtttgaag tcgctttctt gcagccccac taatgtcggg acagaagtac gctgcgcaag
    88141 cgttttcagg gtcagatatt ttccagacac cggttaattt cctttaaatt ggcggcacaa
    88201 gaacccattg gcgttttcga cgtacattcg ataacccact gtctacagcg ctagatttcc
    88261 tggctttcca gcactgaact ttccttgagt gtcgttgcat aatccataaa caggcgtgag
    88321 gccttggctt ctttagctcc ctggtacttg ccgttataca gctcgatctc gccttgaaca
    88381 tgccagaaca tcatttgccc aatatccatg ccagggtata cccgaattct attgacggcc
    88441 aaaagttgaa tggtccaacg gcctataaat cctatatcac caagcggtgc cgacaggttg
    88501 ataaacatgc cgagtcgagc aatggaagaa cgcgccgcat aagtcggtac aaaacgagta
    88561 ctgcccatgg tctcgattga actggcaagg tacagccgca tcggttcgag aacaaaccct
    88621 tcagagccga tataaatatc acgggttggc tgctccgact tcacgtcgat aatgccgtcc
    88681 tcatagactt tcatatgatt atgcaggcga aaattatagc tatttggatt gatgctattc
    88741 tttgagaaag gagagatcac gatatcccct gcaataacgc gattggttat ttcattaccc
    88801 gtcaatatca tggttggtcc attataattc ttgaaggaac gacactttgc gagcctgcat
    88861 aacgcccttc ataggcgcga acggcaccaa aatttttcca gaaacacact ttggcaatct
    88921 tcgtccctgc atagatacgc agcggttgag tgaccacaat ttccagcgtc cagcagatcg
    88981 ttgcccctgt gtgccccagt ggcgcgctgg tttgaatgaa catgccacat agcgctgtcg
    89041 atagattggc gtagagttca ctcgcaaaat ccagcccgcc gatacattcg acggtagagc
    89101 ccaggtaaaa acgcctcggc tgcaggacca gcccctcttc cgggatagtg tgctgaatag
    89161 ttcccaggcc ctcatgagga tcgatctgtt cggcgtcata ctcgataatc tcgctcccca
    89221 aatggcaggc atatgaattc tgctctatca aacggggatc gaatggttcg atcacaatgc
    89281 gtttcaattc acgcattcgt tgaatttcac tacccgtcag catcatgaaa gcttctcctc
    89341 aaaacacctg ccattcgctg gcttactcga acatcaatct gccagccatg ggggagtggt
    89401 gttggggtac aactccgaca ccagcgaccg agcactaaaa aagtaacctt gagtacgttg
    89461 tgccgctgac gactggggaa aaaagctagc cagtcgtgca gtaagcagcg ataagttata
    89521 cgtgggcact gccggacaga gatgatgttc ccagtgtcga ttgatatgac agggcgccca
    89581 gagaaaccgc tcgataatac ccacatcgat acttcgggca ttactggcat tcggatggtc
    89641 taaccttccc ccgtgttcgg caatactgcg tacacgcagg atcaacggaa gtatcgtaaa
    89701 cgccggaaca acccaaagcc ataacacgtc ccacccgcca cctacccaag ttatcccccc
    89761 gcccacggca ataataaaag ccattgccag acgccgatca agccgcgagg catgactgcc
    89821 tctggcgaac aaccccaaca gcccaaagtt gttgaccgat ctaagtgtca tcagtgtcga
    89881 aacacccagt gcatcgcgca gcaacagccc ataaaacctg atacgtgtct tcggcagttg
    89941 tgaatctttt atatcgggat caagctcggt attgagatgg cgatgatgga gcaaatggtg
    90001 ccggcgataa cgggatacac aaacgctcaa tggaaaagcc aggaacagat tacccaccgt
    90061 atcattgagc cagcgccgac gactgatcaa ataatgcgaa gcatcatgca tcagtaccaa
    90121 taacgcatgt tgacgtgtag cgatccatac aatggaaata ctataggcca gccaactgct
    90181 ggcccactta gcgaaaaaaa cggcgaacac aatcaataac cattgcatgc ctatctgtat
    90241 gaaacattta cctggacgca acttcatcaa gtcgtggact acgtgaggat cgacacgcag
    90301 tttttcatgt cgacatcgtt cttttctttc gcaaactacc gcggttgcca gactcatccc
    90361 tcttactcct cgaccaatcc tgtggcagcg ccttgaacct cggaagacgt caatgagcgg
    90421 gagcggaatg cccgtggatg ttgttgaagc cagaacttga tgacctgtgg cagaaactcg
    90481 acgggatccg gtgatgggcg agaaacattc aacggcgccc gaaccctgtc gctgctggca
    90541 tacaccccgt agacttgtaa caaccgttcg aagtaacgaa actcattttt ggagatgcct
    90601 tcaggactcc aggccgatag cgaacgcttc aagaaatccc actggcggct tttgagaatg
    90661 ggcacgggat cctgggctcc caggccggcc gtttcgcgtg cctcgcccag ttgattttcg
    90721 accaggcgaa ccaagtgttc gtagccgata cgcttgtctc cggcagacgc caccacctgt
    90781 tcggcaacac cgctggcggc aaaccgtatg atcatcgccc gcaactcacc gaccacccaa
    90841 tcaagtggca cgatgtcgag cagaccggtt ttgtttccca ccaagaaggg agggctgaac
    90901 ccggccatga acctgatcag cggatagagc ccgttgaatc ggctgatggc tccggtcttg
    90961 ctgtcaccca ctacaaggct gcaactaaag gtcgaaatgc tgatgcgctc accgaaattt
    91021 gcacgcagcg agcgctcggc catggccttg ctctcttcgt agccattgcg gtactcccag
    91081 tcttcgactt gggtataagc agtggaaaca tagatcagtg cgggccggtc ggcctggcgc
    91141 agcaggaaac gacaaaagtt ttccgacccg ccgacattca gcgccgtcat gtcttcgcag
    91201 cttttatccc aggacacgtc ggctgccagg tggataccca gggcacattc gagtttgggt
    91261 cggctgtcgg cggcagcagc catcgccccg gcgtcgcaaa tgtccaccac caggaactcg
    91321 acacgagccc gctcgaccgc agacaaggtc gccgctaatt catcacatga cgtttgagtg
    91381 cgtaacaggc agagcagttg aagctgcagg ctctgctgga gtaacgaacg aaccaatgga
    91441 atgccgaggg tgccgttggc gccagtcagt atcaattgca aaggggtctg cgcagacatc
    91501 gtttatgcct cgaccgcaac tgtcgatagt tgcgatagca ggattcgatc acgaataccc
    91561 tccagcatct gccggctatt ggcgcggatc gctcgctccc cgatcggatg aagaacgtcg
    91621 gccagggacg gaatgccaag atcgaacaag acatccagtt gcacactaag gtcgtccccc
    91681 gcctgctgga tggaccactc ccctgaccag acttccaggt ccccgtcgat ttgctgaaac
    91741 acgatacggt ggtcgggcag caatagatcg cgctcggtcc aggtcaactc acttccgttt
    91801 agcaatacac gccaggtgct gatgatttcg tttccggtac gttgctcgat agtgacgtca
    91861 agtacgtcct tcatgaattc cggataacgc tgaaactcac aaagggtcga ccagactcgc
    91921 tccagctcaa gagacccaag attcagtgat gtatttactg ctggcataac gggatttcct
    91981 tatcgaattc tgttcgagtg atcgcttcaa cactctggca aaagtgctcc agccctgttt
    92041 cgagatctgc gtcgctgatg acggctggcg ggtagagacg caaaactttc ggatcggtga
    92101 gacagaaagc gagcaacaag tgccgtttgg cggcctcgat gatcatctcc ccgacatgat
    92161 cgagacgctt gaactcaacg ccgatcatca agccctggcc acggatgtcg gtaatcaagg
    92221 gattatctgc aaggcgctgg cgcagatagc tcaagacccg atcgcctaag cgctgcaccc
    92281 tgagggtgaa atcgggagcg gacacaacat ccagcaccgc gttgacgacg gcaccggcca
    92341 gggcactacc ggcaaaagac gaagcgtgga ctaccggatc ccgggcagcc gcatcaaaac
    92401 gcttcgacgt aaacaaggct gccgagatcg ggaaaacacc accgcccaga accttgccca
    92461 acagcaggat gtcgcaagga acgtcgacac gcaggctacc gatacgcccc aggcccgttt
    92521 ggatctcgtc aaatatcaag cggcagtcaa aagcctgggc caggtcgcca agacctcgaa
    92581 gaaattcatt ctccacaggg cgtatcccgc cctcgccctg tatgggctca ataatgatcg
    92641 ccgcgatgtc gcctgcctcc agcgcgttgg cgacagcatc gagatcgtcg attggacaaa
    92701 aaaccacgtc accttcagtc agaagaccgg catgccgcat gtagccatga ctgacactca
    92761 aggcagccgc ggtgcgcccg tggtaagcct gctcgaaggc aatgaccctc cgccgtccag
    92821 tgacgatcct ggcaagtttc aatgccgctt cgacgacttc ggaaccggta ttgccgaaaa
    92881 tcaccttatc cttctcaggt cccgccatga ccaatagccg ctcggccgcc agtacgatgg
    92941 gttcgttcga caggattttc gtggaaagcc caaaacgctg gatctgttcc accagggcag
    93001 ataccacgcc tgaatgacta tggccgagta ggtgcacacc gaacgaaccg aagtccagcc
    93061 agcgtccacc ctgagtatct tcgacccagg caccgtcgcc acgcgcttcg gatgcggaca
    93121 accccgacat cttcaacatc aggccctgtt gacgaccgaa gacagcacca tagcgatcaa
    93181 cgaaggcgct tttacgctcg gattgcttcg gcaccgggac agaccgtcca gtcagttcag
    93241 tgttcatagg gatttcatca gtggcaccag aaaactggca tcgcaaccca acgcggtaca
    93301 cgccttgtcg gaagaccgaa gaaaacgcag aacgcggccc tggttgtgcg cttgcagcga
    93361 atcgaccaac tcgcccggga atgccgcaat caaatcacgt atcagctggc ttactcgacg
    93421 gatttcagtt gcgtcattcg ctgcgaacag acccagcaag cgcgccatgt cagccccggg
    93481 taaattgatc acctcgcaca agccgtactc aagtaaccac ggcaatctgt gctcttcgtc
    93541 gagcaccgcc gtgcgcccca acgtgcagtc gatttgcacc agcagttcag caatcttcac
    93601 tttaatcaac accgatgcat ccggagcatc catggcgcct tccagatctt cgaggtaggc
    93661 atacagttcg gacatcacca gccatgccgc gctgacgatg gcgcgggcca tgctattgcc
    93721 ctccaccccc acgcctccgg tcagccgagg aaaccaacgc aaggttgagt cttgtcgtgc
    93781 ttcaaacatg ctgtgctcct tagctggcgc tggccccgga ctggcgttgc aatgatggac
    93841 tccaggtccc tgcgcggatc gcttgcaggt gttcgagggc agagagcggc ggcaactggc
    93901 acagatcggc gaaacactgc gccagcgtta cgccggccgg cacgttctcg gccagtcgta
    93961 cataaccgtt gccagcgcag accagagcgg cttggccgtg caacggatac cgcgcaacat
    94021 ttccctgcaa cccggtaaat ggttcatcac gaaggagttc cggagccagc ctgcctgtca
    94081 tttgctgcaa taacgtctcg atgcgtgaca gggcttcgtc caacaccgct ggacctttcg
    94141 caaggtctgc ccagagcgct gaaacctccg tccaggtggt agggcaaaga tccaagaaaa
    94201 ccaggtcgcg gcttttattc cagcgacgca gcgtccactt cttgttggac aacacccaac
    94261 ccgacatcga aagcagcgag ttcatggctg cggtcagtgc attcatcaaa tagccgatcg
    94321 ccgcaaaagg ctcgtcagac cgttgcgcca gccgtgagca ggcgacattc actctgaaaa
    94381 catccaggtc tttgcgagac accacgacac acaggtcgcc aagtgccgag agataaggag
    94441 tggtgagatc attggtcacg ccatagacca agcgctcgac atatttgcgc ggaaccttgt
    94501 tgcgcttatc ccatcttgaa taattttgca ggcagatcag cgctgggctt tgcgccaggc
    94561 tggtgagttc gccaagggcc agatgaacat cggcagcatt gaacagcaac agttcgagat
    94621 gcagaccttc ctgatgaatc tgggttgcca tttgctcggt gctgacaggc tcgtcaacca
    94681 cgcacaacat atcaatatcg ctggccatgg tggcaatacc atggaccgcc gaactggtga
    94741 gtagaagtgt tccaggatcg cactgacggg aagcaacttc attgaggaag ttgaagccta
    94801 tatttcgagc cccgagaaag tcttgtgcat tctttttaac gaaatcttgc acagcggaag
    94861 acaattccat ttcaatgtcc ttatcatttt acttcccggc acacgggcgc cgaaaacttc
    94921 cagaccacat aagtgcatcg cacctgaggg ggaatatcag caataacaat taaatctgga
    94981 ttgcacgccg cttatcgagc ggagccactt aaacctaaca gcagaacaaa catcatgcaa
    95041 caatttatct gaaaaataaa atcaaacagc tctatgcgat atcaaaatga ttccacgtcc
    95101 agctagggag ctccgaaagt tcacgagtgg aagaatcgag atccagcgta ttaaccaggc
    95161 aacttgaaag ggcactcata tccgactgga cacagtccat atcaaagggt ttacgccccc
    95221 cgacatatcg aataacgaca cttctggcgg tgcactcttc acgactatta ctctgctgcg
    95281 cacccgcgga ctgaaagaag cagaagtcca actcgtaaat cccacccgat attgctgatt
    95341 cgacaccaac tcttgagccg ctcacataca ggtcatggct atgcttgaat agtttgtctg
    95401 gatcgctatc gcctcgaaat tgcaaaagtt ccttatccac gtcgtcattg agcgactcga
    95461 taacgtcaga ccggacccaa ccattaccgg catgactgaa tacctcaata cgtagaccag
    95521 tggaattgat gctcttcttt cgacgacaac cacgttcaac cgtcagccac tcgcttgatg
    95581 acggacatcg ataaacagcc ttccgacttc gtatagatga aagttcgctc cccagatgca
    95641 gataaaactg cggccattgc aaggtgtcca gatgctcaat gaccatatcg gcagcatggc
    95701 tcgcagggag atcaatttca aaatgacagg cgaatgccat gcctggaggc gcttcaaaaa
    95761 aacaacattc aaagttgttc aatgtgaggt gccatttctg aaacgcctca gccaggacat
    95821 cggatacccg atctttattg caagacggca gtgtcatcgg cgaatagaaa tgacaaacat
    95881 gcatttcctg ccgcataagc aacgccttca agtacagcgt gtcaccgtcg aaataagcca
    95941 acgccagtgg cacatcacga tgcgccaagt tattcaggcc gtagggacgc aaatcgacaa
    96001 gtgtcatcgg cctgtcaaaa tcaatagggg catccacagg acaaacattc agctcaaccc
    96061 caacttcggg ctctccaact cgcaggcgcc acgaccccgt tataacgaca cgttgcatga
    96121 ggactactcc ggaatattat ttttcgatct tgattgcctg gagaaatcaa gctttgaaaa
    96181 aaggtcctct ttgtaggcta cttttttctc tgacagcaat cgctcaacat atttcgccag
    96241 aaagttgaat tcttcaaaga tatcgtcgag caaaaacgcc gttcggcttc ggcaatactc
    96301 gacctcaacc tgcccgaatg aatgttccgc aggcgaatcc acggttctgc aaatatcaaa
    96361 atagacgccg tatacatgcc cggtcttcag tgactcgaag tttacgtcaa agcgtttccg
    96421 tcgaaacacc ggcagcggga gtatatcggc atttacacga ctccttgctt ctgcggccag
    96481 atcggacacc cctatattct gatcccacca caggctctct cgacgaagtt cagcattttc
    96541 ctgaaaccac tttcgcttta cagtcacatt actgttgacc tgcggaataa aggagatata
    96601 ccccaactcc tctggctcac caacgatatc gaatatgtga ttttcatagt cgaaaacctg
    96661 gaagccttta tggcactcag ggaaaaaacc aggcaaggcc ccgccgtata atcgagcata
    96721 caaatcggtg acaaggttcc aggtgtcagg gagatcctga aatgtgaatt ttctttcaaa
    96781 ctccatctcc ggtcgccatt gaaaataacc aaaacggcta tttaacaacg gcagtcgctc
    96841 gataagcgac gcccgcgagc gagcaacaat ggcctggaca gcctggtagt cgtgctcacc
    96901 aggtgggtac gcaacggtgc aaaagcgcaa tgccagcaga tgcctggccg ttgcttcgac
    96961 tgccatatag cagcggactt catcgcccgc ctcgacgcaa tagatgacag gcttgaggcc
    97021 cgaacgggcg ataccaggta cgacacgatc gagctccagg ttcactcgat cattaacctt
    97081 gcgctgagcg ctggtcagtc tttgtggttc aaaatccagg tgttcagaaa aagtgtgtgt
    97141 gcattgcccg gtaaggacct ggtcgaccca cacgctattc gcctcgacaa gcaggctgtt
    97201 caccccatgc ttcgattgcg agacacgccc cgttagaaca aggggtggat ataaaaagga
    97261 ttcttcttcg gacagagtct cttcgtcgaa gtacagcacc caaagtcgat cgaagttttc
    97321 ggttgcatac tcgtggtcga acattccatg gctctctatg ctaagcgtca agtaccatta
    97381 cagatacgaa caacactact gggttggcgg gttcagatcc aatcgcttag cttttccact
    97441 tcatagcctt gcgctcgcgc taagtctatt atttgagtcg actggagtag cggcattagc
    97501 acctcgctgc gcttttgcca acggctaggt ttatgaggtt cagtcacatt taccgaaggc
    97561 gccacaaact gttcgacgat gaaataatcc cccgttccga acagaaactc tgccgcattc
    97621 ttcaacatgt cgatttgact attctcagaa cgcacaaaat cttcaaactt aaaatcacgc
    97681 cactcctcat tcgctgcttt tgagcgtacg gcctgcgcaa tcaacttgtt aggttccagc
    97741 cattgagcgg aacacacttc cactaggctc atactgcccg cagtctgctt ccaatcctca
    97801 aacaagtcga aacaccaccc tgacaatgga tgatcctctc ccaattcggt actaagatca
    97861 tgctgccaaa aacagtgatg aagccaacca tccatcaatc catttataga cgacaacgga
    97921 ttgcgagaga gacggactac tctaacttca tgctcggcaa ataagcttct catcgcgctg
    97981 atccggaaag gatcactgga agctttgagc agtaatgact ttacattgac tgaagcagtc
    98041 tttaactgac gcggtcttgg aatgacataa ggactgatct cgataatcgg accattattt
    98101 ttctccttgt atgtcgacca gtgcgaggcg cttgcggagc tttttccagg cagatcataa
    98161 tatgcacaat ctatcgttgg ataaacagtg gtcagcttgt ccaataccaa cccgtcgaga
    98221 accgacaaat ctcgagtgcc gccctccaga tatatatcgg ttgcttgttg cactgcactc
    98281 acaacaacag cagggtcgaa atcagtagtc gtccactgta atggcagacg ataagcccat
    98341 tcccatgcgt agcgaagtac ttctcgggag tcaggttcca ccaacgcatc accgcaggaa
    98401 gccagcagca acatcatttg ctttatatcg tctttgctct tcctgtccaa agtagacaaa
    98461 ctgctctcgc gattagcttt ggtatgggga taattgagct cattcaaagt aaagaacatt
    98521 cgatgctcac cggccaatgc tagacactct ggatgcttgg cgagggcagc cttgaatgca
    98581 cttgtgccac agcgcggacc gcttaatacc cagccaacgg gcaacctgtt agctgtccag
    98641 cccgcaatgg cgacagcctc ttccggaaac agggaaagta ttgtggcacg aagttttttt
    98701 tcattggctt tcaaaagtaa aagcctggtg ttttcgtttt tgcgcaccaa tagacgccct
    98761 gtcatactta ttacttcctt tttcgtacag cactcgaaga taatcggtta actgtcattc
    98821 gtgctaaatc cagagctcaa aaagcatacc gcagagcatg tcaaaatact cacagacaaa
    98881 aaaacatctg tcaagaaaaa aattaaatga actcatctgt gatgcaacct gatcatatcg
    98941 caccaaaata gagcgtgacg ctcgatgcaa aaacgccctg cctacactaa tgttttgcaa
    99001 cggtccgccg actactttga gcctgcacaa gggcaatccg cccttgacac gcgatccctt
    99061 gctaggataa aacatttgtc ccgtaattta tgaagccctg aattcagccg ttaatacaca
    99121 gtaaagtctt gacggtgtcg acctttattt tatggctttg ttttgcacgg aagcagtttt
    99181 ccatcagtcc aaactattac cctgatgagc tcgataattc aatgaagatt acaagcctga
    99241 aaaaccgcaa tttgctgaca atgaacgagt tcaatcaaag tgagttatcc cacctcattg
    99301 atcgcgccat agaatgcaag cgattaaaaa aagatcgaat atttaacctc ggcttaaatc
    99361 atttgaatat ttgtggcatt ttcctaaagc cttcaggtcg taccagcacc tcatttgtcg
    99421 ttgcctcgta tgatgaagga gcgcactttc aatttttccc ggcagacaat attcgcttcg
    99481 ggcacaagga aagcatcaag gattttgccc gtgttgtagg ccgcctcttc gatggcatcg
    99541 cctttcgtgg tttcgagcat gaagtggcgg aagaactggc caaacattcg ggaattcccg
    99601 tctggaacgc gttaactgat acccatcacc caactcaagt actggcagac gtcatgaccg
    99661 tcaaggaaga attcgggcgc attgagggtg tgacgatcgc ctatgttggt gacggccgaa
    99721 acaacatggt aacgtccttg gccatcgggg cgctcaagtt cggttacaac ctgagaatca
    99781 ttgcccccaa tgccttgcac ccgaccgatg cggtacttgc tggcatttat gagcagactc
    99841 ccgagcgaaa cggctccatc gaaatcttca ccgaagttgc cgctggcgtt caccaggccg
    99901 atgttattta taccgatgtg tggatttcta tgggtgaatc agtctcggta gaagaacgca
    99961 tcgccctgct caagccttat aaagttactg aaaaaatgat ggcgttgact ggcaaggccg
   100021 acaccatatt catgcattgc ctgccagcat tccatgatct ggataccgaa gttgcaaggg
   100081 agaccccaga ccttgtcgaa gtagaagact ccgtattcga agggccgcaa agtcgcgtgt
   100141 tcgatcaagg ggaaaaccgc atgcatacca tcaaagcact gatgctggag acagtcgtcc
   100201 cctgatagcg agcttaaatc caagttcgcg ctcagaagcc ttatcgcata gccactcttg
   100261 ttgacctccg ggaggtcaac aaggtcgatc atccccaccg cctgatcttc agatgctcta
   100321 tattcgctgt ttatctgtgc ccgagactct gggttatctt ctagtgtgct gttcgcaaaa
   100381 tagcttttcg ttagtctcgg ctacacttca gatgtcattc cagccttgga gagcttatcg
   100441 tgagcgctct ggacatcacg cttagccatg aagaaacgat cgaactcaaa cggcgcgttc
   100501 gctctgccac catccctcag cgagagggtc ggcgagcacg cataatcctg ctggctgccg
   100561 aaggcgaaac ccgagacaac attgcgcggt tgacgggttt ttcctgccca acgatcactc
   100621 tctggtgcca gcgtttccgg gcacgtcgac tggacggatt ggtcgaccaa cctgggcgtg
   100681 gacgcaagtc gtctttgcct gaggaaacgg ttcgccgggt cttggaacaa gtcacccgac
   100741 cccgcatcgg agagccgcgc tggagctgtc ggagcatggc aagggcagcg ggaacttcct
   100801 cgaccaccgt ccataaactg tgggctgcca acgatttaaa gcctcacctg acacgcacat
   100861 tcaagctgtc caacgatccg cagtttgacg agaaattctg ggatgtgatc gggctttatc
   100921 tggccccacc ggataaggct ttggtgttgt gctgtgatga gaaaagccag gttcaggcgt
   100981 tggagcgaac acagccgggc ttacctttgg gcatcggtca tatccagact aaatcccatg
   101041 attacacccg tcatggcacg gtcacgttat tcgccgcact ggattacctc caagggaaat
   101101 tgatcagcag catcgagcgt cagcaccggc atcaagagtg gctggccttt ctcaagaaga
   101161 tcaataaaga aacgcccaag cacctccagc ttcatctgat cgtcgataac tatgcgaccc
   101221 acaagcatgc tgcggtgaaa gcctggctgg cgaagcatcc gcgttttcat attcatttca
   101281 ccccaacctc cagctcctgg atgaacatgg ttgagcgctt ctttcgagac atcaccgtgt
   101341 acttgcgcga cggcagcttc gcctccgtgc gagagttaga aagctccatc acaacgttta
   101401 tggcgttacg aaatgctcgg ccgacccggt gcgtttggaa cgcaaaggga gaggagattt
   101461 tgaacaaaat tcaacgtgcg cgtgaggcgc ttgaaaccgc acaagaaaat taagttattt
   101521 cgaaaacagc acactaggca tgccgggtcg ttcgcagtag ccctgtagtg ctacgatgat
   101581 agctgtctgc accacgtttt ccttaccagc catttttacc tccttacgaa aagttatatt
   101641 gatcttcatc aacgggcgag caaatatgtt ttttgaactt tcgacttaat atatagaagg
   101701 cttgctcagt ttgggccaaa acacataggt tttttagaga gaccatttaa cggcttctaa
   101761 gtatctactc gcgactcata ctgtatcgaa gctcactcag catctgtcgt cgcacttatc
   101821 ctacaccacg gcttggcact tggtaagccg ctcgtgtttg agataaccac ggcttcaaag
   101881 aagcgggcct aacatagctg tagttcacac tgctagccgt agtgctgtgt tccataccgc
   101941 cgggtgcttt gaggatagca aattgaaggc cgacgctcct caatttggta gcgtcattgg
   102001 cagacgtcgc acatgatatc tgcgttggct tcaggtccgc cctacgtcaa tttttaatcg
   102061 gcatgagtca gttttcaatc accgccaacc agtccgcatc cccaccgaat cagtttcggt
   102121 cagcggcaac accgccgggc ctaagtcgta tcagcgccga caccaaattt tgcttaagag
   102181 tatgttgtga cgaacgcaat gatggatttc gtcgaagaca gcgaacacat ggtaatcgtc
   102241 caatagcttc caaaaagcct catcacggta ttccatacct gataggtgca tccagcgcgg
   102301 accgaaacaa ccagcccaac gagccttctc gacagcagct ccgaaagagt gcgccgtaag
   102361 ccttcatgcg ttgccgagcc cgatctgcga ggcgttgcgg cagcggccgg ggagaatgcg
   102421 gattccacgc acactggaca gtgaccgtcg caagtaagag gcttatcaga agactccgtg
   102481 ctcaaggcgg aaaagagtgt ccatgaccag agtgaattcg tggaggttgc tcatgaatgt
   102541 gcagggctgc tgcctatcta ggctacggat gcgactctca aaccagttgc gggcgcttgt
   102601 tggtgacccc aacaccacag tggcgcggga gagaaccagc gttcgagctg atttaaagct
   102661 gcggtgttca atgctccaac agcccatgcc tgcgggcgca gccagcccca atatctgaaa
   102721 gctggccgcg acaataccgc cctctgggcg agggttggat tgcagcgcgg ttgagccaag
   102781 catagccgat ggagcactcg cctgaggggc atggtgaatt gcagtgtcgc agaagaaagg
   102841 atcaagaaga ggccaggtcg caagtgctgg atgcattgct tttggaatgc cagagagctt
   102901 tgaaacttca acctgcctga tcgcttcgca tcgtccagcc agtcttacag cttctgccgt
   102961 gggatagtga cgcagcaact gcctagcttg ctcgcggacg cggtcgggca aggttttatc
   103021 tcgggaaatc ctcgccagaa atccgcctgt ttcaattacg ctgcgtgtcc gctcataggc
   103081 agtggtcata gagcttgctc tccactcggc aggagggcgc atagcttctt gaagacttca
   103141 gtcgctttcc ctatcagcat gagctcattc tgcgcgccgg tgctgacatc ctccgtattg
   103201 acgtgaatca ccgtcgcacc atacgacagg gcaatcctag ggatgtcagc tgcgggcgta
   103261 acgattccag atgtacccac ggagatcaga acgtcgcagc tcttcaccaa ggcgattgcc
   103321 gacttccaaa cgtctgaggg caagtcctcg ccgtaccaaa ctaaaccagg gcgtaacttc
   103381 ccgttgcacc tgacacaccg tggcggttcg acttcgccac cgatatgaga agtcacctgc
   103441 gatggaggta tttctgccgg tcgatggcac gcaaagcact ttggcgtaga aaggctacca
   103501 tggagatgca gtacatccac ggatcccgct cgctcatgca agtcatcaat gttttgagtg
   103561 atcacggaga cgctataccc cgatttagcg agtcggctca ccgcaagatg tgcagcattg
   103621 ggagcggctt tagagacctg ttggcgccgc cacaggtacc atccccatac caaaggagga
   103681 tttccacgaa aggccttggc tgtttccata ttgcgcggat cgtatgaagc ccaaataccg
   103741 gtcaatggat cgccgtacgt ggagatgcca ctttcagcag agattcccgc acccgtgaag
   103801 acgacaatct cgggggcgtc caacagggcc ttcgcggcgt ttctaaattc aggcacagaa
   103861 tactctcaat actgaggccg gtaaggtcag gcgaatctgg cgagagtcat tgactattcg
   103921 ccctaagagc tggtgccggc ttcaggtata ggggagcgta catctggtga gatttagact
   103981 tatgggctgg ctccgacatt ctgggttggt gattttctag cctcttttta gaaaaccata
   104041 cccgtgatgt ttttttcttg cgaaggtcta gatcccccat tttgtaaacg ccttgtgagg
   104101 tgcgatacac cacagcactt tcctcagtta cgacaccttg gaaacaagtg attcgatcta
   104161 gatcttcgag gctccatttg ccagagcggc tgatcgctgg tggacaaagc atttggacgt
   104221 gactgatttc cacattcgag gcggcagtca tgtagtgctg aagctcatac gcgcaactga
   104281 ccattgctgc gcgatcacac atcccagtct gagtggaggt gatagtcaag agaaaaacca
   104341 tgccatccaa ctcacagtgt gtcctggtga agacagtccg ttctgcaggg tcaagtacgt
   104401 atatcaattg ctaaaccact cccaattcag tcggcgccgc ctgtataccc ttcgtggaaa
   104461 aactatgggt agcgcagcac atcggtgata cgaagactca tgccatccag acgcttggcg
   104521 taagcatccc gcaatttacg agtcgcgaat cgtgtacgcc tttcctcctg aagcagctca
   104581 tacagacgcc tgtcaaagat ggaacgaggc tgatttcatt gaggtaccaa cggagtggat
   104641 ttccaaaaat acggattata gtccgtggct cgtgtgtccg caaacgcatg atagtcccgc
   104701 ctcaagtgga attgagacgg tcatggacaa gttggcgaaa gcgttaggga gacgcatccg
   104761 aacgcagagg aaagcctgcc agatttctca ggatgcactg gcgctggcat gcaatatcga
   104821 ccgcagctat atgggccgga tcgagcgtgg cgaagtaaat attaccgtcg agaaacttta
   104881 tcgcatcgca ggtgtgcttg catgcgaccc atccggccta ttgcctcagg tttcagagct
   104941 gcaacccgcc tgatcgacca tggcgcttaa gctggcttca gattactagt gctgctagct
   105001 ccggccgaat cgcccagtac tcccagcttg agcttcatcg catgttttgt cttgtgatac
   105061 tgccgagcct ggcgcgactt attctggcgc ttagctagct tcagctctct cacgcgcccc
   105121 atagctgaag gttctgcgtg agcactcgat aactggtacg aactgaccat cgctcacgct
   105181 ttttctaaaa agcgcaacgt cttctcagtg atggggtatt acgccttgct cgtggtatct
   105241 ccagttcgta gcgacggtgt cgctcatgag cgggtacaca aaaattcgga cacctcacac
   105301 cttgacaaga tgcgatcaca ggaacacttc caaaaagtta agttttggag cctagatttg
   105361 acccaaaatc agtaaaaact aaccaaaacc tcctcccttc cccaggattg agaagaaaaa
   105421 aatgatgtac acgctggaag aaccagcagc cgtcagggat cgactgcaga tcgtaaaacg
   105481 tgactaaaac ttaataaggc agatatccgt attgagccat ggaatgaaaa cctagcgtct
   105541 gtgatgagga ccgatttgaa gcgcgagctt aaagctccgg ccggaaaaaa gcttttattt
   105601 gtccgtaaga cttgccgcga gaccgttccg agccttgaat aaaaccaggt agaagcagat
   105661 cgggcagtgc tggcaactat aaagcctggt cggtattgca aagagtggag tcactcgtgc
   105721 aggagtcggt agataccgcg cgttgcgcaa agctacccga atgcagcctg cagggcaaac
   105781 gatccggccc aatggggctg gcactctgcc acaagtaaag gcatgctagc cgccctttaa
   105841 gcgatgggca tttttgcact aagcattacg gcttccagtc cagcagtcag ggaacaacga
   105901 tttgcccact tcaacgcctt tgccgtcacc ccatgttgct gcagacagtg cgacaaggcc
   105961 tctgcgtggg tcagtaaaag gtgtactggc ggcgctggtc ctggtgatgc ttgccatgtt
   106021 gctctggcaa ttgatcgagc agtttcacca gactctggaa cgccagcgtc agcgcagcct
   106081 ggaatacagc atccagcttt ccgaccggat gagcctgaac atggcgctca aggcgcagat
   106141 cgccatgaac ctgctggacg aggcgcaatc gtccggggaa cgcctggagc agcccgtcat
   106201 gctggcaagc ctgcgcactg ccctgcccgc gctgcgcagc gttgctcgcc tgaacccggc
   106261 cggtgacatc gtcagcgaca gcgccgaagt gccccgcgac ggcgacttcc tcaggcgtgc
   106321 catgaggcag gcgctgggcc gcccttattt ctacaccagt accaacgacg gcaaccagct
   106381 ctacgtgctg attcgccagg gcggcggcat taccggtgac tactgggcac tgcgcatggc
   106441 accggacgcg ctgaaagacc tggccagcca gccggctcag gactttcagc acttgtggcg
   106501 tctggagcaa cgcaagacgc aacgggtcat cctccgcgag ccgctgccct ccaatgatgc
   106561 agacagcggt ctgtccgaaa ccattcttct gcaaccgctc agcaacagtg actggcagtt
   106621 gcgcggcctg ttcgatacct acaaggcgcg cagcgaactg ctcacgccac tgatcggcaa
   106681 atgcgtgatc ggcctgctgc tctcgatcct gccattgatc gcactgatca gcctgcgccg
   106741 acgtcagcgc cagatgctgc aaagtcgacg ccgctatcgg gacatcttcg aaggcgcggg
   106801 cgtggcgatc tgcgtgatgg acatgtctgg cctgcaggag caactcgacg cccttcagat
   106861 caacaacggc gaagagtttg atcggctgct caagagccag cctgcctcgc tgaaaaggct
   106921 gctgcagcaa ctgcgcatca acgagctcaa cgaagttgcg cttggcctgc tggaaatcga
   106981 gtgcaacgaa caggcctggc agcagttgat cgagggcgaa tcgcgaacgc gcccaggcat
   107041 cggcattcag gtgattcacg ccgtgcttgc caggcagaca cgattggaac tggaaatctg
   107101 cctgacccgt gcacgtggcc aggaccagca tctgtggctg gtcatgcgcc tgcccgaggc
   107161 gcgtagcgac ttcgatgccg tgattctcag catcggcgac atcaccagcc gcaaacagac
   107221 cgagctgtca ctgctggacc gcgaaagctt ctggtccgat gtgatccgca ccgtgccgga
   107281 ccacctgtat gtgcaggacg tgctcagcca gcgcatgatc tacagcaacc accattttgg
   107341 ccatacgctg ggctacaaca agttcgaact gcacgcgatg ggcgagttct tctgggaaat
   107401 actgctgcac ccggaagatg ccaagagcta tcaggacatg cgcctgcgcc agcgccacca
   107461 cgggcacaac gagttgctgc aatgcgtgct gcgctttcgc gatcacgaga acaactggcg
   107521 ttgtttcgac gtgcgcgagc aggcactggc ctgggacaca gaacacctgg tcacgcgtat
   107581 catcggcatt gccaaggaca tcaccgagca ggttgcgtcc agccagtcgc tgcgcgacag
   107641 cgaacagcgc taccgtatgc tcgccgaaag catcagcgac gtgatctttt ccactgacac
   107701 ccatctgacc gtcaattacg tcagcccctc ggtcgagcgc gcactgggct acagcgctga
   107761 ctggattacc cggaacggct ggtctgccgc cattgccaac ccccagcaac tgaccggttt
   107821 tgatgcgctc atcagccgta tcagcaaggt actcaacaag ccgcaggagc tggcgcggtt
   107881 gcgcgacgaa gtcaccaccc ggatgtttct gttcgactgc ctgcgtgcag acggccgcaa
   107941 gatcccggtg gaactgcgcg tggtactggt atgggatgaa cacggcaatt tcgagggtat
   108001 tttcggcgtt ggccgggaca tcagccagca gcgccgcgcc gaaaaagacc tgcgcatggc
   108061 tgccacggtt tttgagcact ccacctcggc gatcctcatt accgaccccg caggctatat
   108121 cgtgcaggcc aacgaggcct tcacgcgcgt cagcggctac gaagttgctc aggtgctcga
   108181 ccagttgccg ggcatgctca ccgttgaaag cgaacaggaa gcgcacttgc gctacatcct
   108241 caggcagttg aacgggcaag gcacctggga aggtgaaatc cggctcaagc gccgcaacgg
   108301 cgaacactat ccggcctggg tcggcatcac tgccgtggtc gatgacgaag gcgacctggc
   108361 cagttacgtg tgcttcttca gcgacatcag tgagcgcaag gctagcgagg accgcatcca
   108421 ccgcctggct tattacgacg cgctgacgca cctgcccaac cgcacgctgt ttcaggatcg
   108481 cctgcattcg gcgttgcagc aggccgaacg gcagcaggcc tgggtggtgc tgatgttcct
   108541 cgacctggac cgtttcaaac cgatcaatga ctctctgggc catgccgctg gcgaccggat
   108601 gctgcaggaa atggccacgc gcctgctggc ctgtgtatcg gccgacgaca ccgtggcacg
   108661 catgggcggc gatgaattca cgctgttgct gcaaccggac atcacgcgcg aagcggcact
   108721 gacgcgcgcc attcacgtgg ctgagcggat cctgaccagt ctggtaacgc cgtttgtgct
   108781 tgaaggccgt gagttctttg tcaccgcaag tatcggcatc gcgctcagcc cgcaggacgg
   108841 cagcgaactg agcaagttga tgaagaacgc cgacacggcg atgtatcacg ccaaagagtg
   108901 cggcaaaaat aacttccagt tctaccagac cgacatgaac gccacggcgc tggagcgtct
   108961 ggagctggag agcgatctgc gtcacgccct ggaacagcag gagttcaccc tctattacca
   109021 gccgcagttc agtggtgacg gcaaacgcct gacgggcgcg ggggccctgc tgcgctggcg
   109081 ccatccacgt cgcgggctgg tgccgccgaa cgacttcatc ccggtgctcg aagagctcgg
   109141 gctggtggtg gaagtcggcg actgggtgct caccgaagcc tgtcgccagc tcaagcactg
   109201 gcatcaggcg aaagttcgcg tacccaaagt gtcggtgaac atctcggcgc ggcaattctc
   109261 ggacggccag ttgggtaaac gcatcgccca catactggag cagacgggcc tgtcgcctgc
   109321 ctgtcttgag ctggaactga ccgaaagcat tctgatgcgc gaggtcaacg aggccatgca
   109381 gatcctcgac ggcctgaaaa accttggttt gagcatcgcc gtggatgact tcggcaccgg
   109441 ttactcgtcg ctgaactacc tcaaacagtt cccgatcgac gtgctgaaga tcgaccgcac
   109501 cttcgttgat ggcctgccct caggcgaaca ggacgcccag atcgcccgcg ccatcatcgc
   109561 catggcccac agcctgaacc tctcggtcat cgccgagggc gtggaaaccc acgaacaact
   109621 ggaattcctg cgcgagcatg gctgtgacga agtccagggc tttctcttcg gccgcccgat
   109681 gccacccagc cagttcgaag cgcaattcag caacgatgcc ctgttcatgc tggattaagg
   109741 gagcggcgag tttttagcgg caagcggagc tacaaagtca cgaaaagccc aaatcgtggc
   109801 ttctgccgca gtcgcgatgt gaatgaagat ccctgtggga gtgaccgggg cgatagacag
   109861 caaagcggcc ctgaaaccgg gtacctcggt tgcgcctggt gtaccgtatg taccgtttta
   109921 ctgccggttc ccggcagatc gcgagcaagc tcgctcccac ggccgtaggc cagaatcaaa
   109981 agcggggctg gctctcccag gcacctatcg ttcctcacgc tccgcgtagg aatgcagttc
   110041 gggacgctct gcgtcccatt gcggccgtga tcgtaactca agccggaaat ccaaagcact
   110101 gccacgagag tcaccttcca gcatgaagcc tgaaactcgc cgcctgaacc tatttgctgc
   110161 tcaagatgat tccctttcat atgccagata aaacctgatg gggtagaata gccgcctttt
   110221 ccgccatgcc ctgttgagga ctgccatgtt cagccgtgat ttgactatcg ccaagtacga
   110281 cgccgatctg tttgccgcca tggagcaaga agctctgcgt caggaagaac acatcgagct
   110341 gatcgcctcg gaaaactaca ccagtccggc cgtcatggaa gctcaaggct cggtactgac
   110401 caacaagtac gctgaaggct acccaggcaa gcgttattac ggtggctgcg agtacgtcga
   110461 cgttgtcgag caactggcca tcgaccgtgc caaggagctg ttcggcgccg attacgccaa
   110521 cgtccagcca cacgccggtt cgcaagccaa ctcggcggtc tacctggctc tgctgcaagg
   110581 cggcgacacc attctgggca tgagcctggc ccacggcggt cacttgaccc acggtgccag
   110641 cgtttcgtcc tcgggcaagc tgtacaacgc tgttcagtac ggcatcgacg gcaatggcat
   110701 gatcgactac gacgaagtcg agcgcctggc tgttgaacac aagccaaaaa tgatcgttgc
   110761 cgggttctct gcctactcgc agatcctcga cttcccgcgc tttcgcgcta tcgccgacaa
   110821 ggtcggtgcc tacctgttcg tcgatatggc gcacgtagcc ggtctggttg ccgcaggtgt
   110881 ctacccgaac ccggtgccgt tcgccgacgt cgtcaccacc accacgcaca agaccctgcg
   110941 cggtccacgt ggcggcctga tcctggcgcg cgccaacgcc gacatcgaga aaaagctgaa
   111001 ctccgccgta ttccctggct cccagggcgg cccgctggag cacgtcatcg cagccaaggc
   111061 catctgcttc aaggaagcgc tgcagcctga gttcaagacc taccagcaac aagtggtcaa
   111121 gaacgccaag gcaatggccg gtgtgttcat cgagcgcggt ttcgacgtag tgtccggagg
   111181 tactgaaaac cacctgttcc tgctctcgct gatcaagcag gacatctccg gtaaagacgc
   111241 cgacgccgct ctgggtcgcg ccttcatcac cgtcaacaaa aactcggtac ccaacgaccc
   111301 acgctccccg ttcgtcacct ccggcctgcg cttcggcacc ccggcggtga ccactcgcgg
   111361 cttcaaggaa gcagagtgca aggaactggc cggctggatc tgcgacatcc tggcagacct
   111421 gaacaacgaa gccgtgattg acgctgtgcg cgagaaggtc aaagccatct gcgcgaagct
   111481 gccggtttac ggcgcttgat gagtttggtt taaacgcagt aacgaaaagc cccggttcgt
   111541 gagagccggg gctttttgct gcgtgcgtca taactgtgag caaacgctca cgcgcagcag
   111601 aacatctcag gcacagacct tttcaaaccc cgcccgtatc ttctcctccg gcaactcatc
   111661 ggcaatgaac acgatcacgc tttcgcgcgg ctcgccctcg gcccactcgg tatcccagtc
   111721 aaagccgtac agtttgagca cgccctgaaa caccattttg cgcggttcat cctcgatgtt
   111781 gagcacgccc ttgtaacgca gcagttgctt gccgtggtct tccagcagtt cgttcatgaa
   111841 ctcgctaagg cggtccaggt tcaggggttt gtcgctgcgc aggacgaggc tggtgatgcg
   111901 gtcgctggat tttccggccg gggctagtgg gcgcagggtc atgccgccgc ccagatctgc
   111961 gttgaggttg aagccgcgca catcaagcag ttcggcgagg tcgatcttgc cgtgttcgac
   112021 gatgcggatc ggggcgcggc ggttgatgcg ggtcaggcgt gcgctgaggg catcgaaggc
   112081 tgcgtcgtcg accagatcgc gtttgctgac cagcagccgg tcggcaaagc cgatttgcgc
   112141 ctgggcgatg gtttgcgcca ggtgcgtgtc ggcgtgggca gcgtcgacca acgtgatgat
   112201 gccgtcgagt atgtagcgct cgcgcagttc ttcatcgatg aagaaggtct gggcgacagg
   112261 cgctgggtca gccagcccgg tgcattcgat caccagtcgg tcgaaggcga tttcgccgct
   112321 gtccaggcgc tccagcaaca ggtaaagcgc tttggtcagg tcggtgtgaa tggtgcagca
   112381 cacgcagccg ttggacaggg tcatgatctg caccgggtcg gtgcccagca actggctgtc
   112441 gataccggca tcgctgaatt cgttttcgat cacggcgatt ttcaggccgt gttcggcctt
   112501 gagcaggtgg cgcagcaagg tggttttgcc ggcgcccaga aaaccggtca gcacggtcac
   112561 ggggataggt tgcaactcgg tcataaggct cctggcgtga tgctttcagc gggaatgaaa
   112621 acgcgccaca ggtgatggcc tgtggcgcgt cgggtcagac aataacgcag ttcagaggat
   112681 cagcagcact tcggaccgcc cttgccgccg taacgcgcct cttgccgctc tcgaaagaac
   112741 tgctcgtagg tcatcatcgg cttgtccggg tgcgtgttct gcatgtgctc gacgtaggtg
   112801 tcgtagtcgg gcatgcccac catcaggcgg gcggcctgac cgaggtattt cccgaggcga
   112861 ctcaggtcat tgaacatggg caaatcctct gtgggtaacc atcatcacac ctgcgacgcg
   112921 ggcggcatgg cctggtaagg agcttccttg tcggtacgcg ccttggtcgt ccaggccgca
   112981 cggcccacct tgatggcgta gaacagaatg ctgaacacca caaacaggaa cagtatggtc
   113041 aacccggagt tggtgtaagc gttgaaaatc acatgctgca tctgatccat ggtttttgcc
   113101 ggtgccagaa tctggccggc atctgccgct gcgctgtatt tcttggccag ggccaggaag
   113161 ccgaccgcag ggttggcatc gaacagtttg atcaggcccg ccgtcacggt gcagatcagc
   113221 agccagacgg caggcagcat ggtgacccac acatagcgct ggcgcttcat tttgatcagc
   113281 acgacgctgg ccagcatcaa cgcgataccg gcgagcatct ggttggagat accgaacaac
   113341 ggccacaggg tgttgatgcc gcccagcggg tcgatgacgc cttgataaag cagataaccc
   113401 cacagcgcca cgcaaccacc tgtgccgata gcgttggccg tccaggattc tgtgcgtttg
   113461 agggccggaa cgaagctgcc cagcaggtct tgaagcatga agcgcccagc acgtgtaccg
   113521 gcgtcaaccg ccgtcaggat aaacagcgcc tcgaacagaa tcgcgaagtg ataccagaac
   113581 gccatggtgt tttcacccgg cagtacctga tggaggatct gtgcgatacc tacagcgagc
   113641 gtcggcgcac caccggcacg ggccagaatg gtgttttcac cgatgtcctt ggccacggcg
   113701 gtcagttgct ccggcgtgat ggcaaagccc cagctggaaa ctgtctgcgc gaccgttacc
   113761 acatcgctac cgaccacggc ggccgggcta ttcatggcga agtaaacgcc tggctcgatc
   113821 accgaagcgg cgaccattgc catgatggcc acgaacgact ccatcaacat gccgccataa
   113881 ccgatgtaac gagcgttttt ctcgttatcg agcagcttgg gcgtggtgcc cgaggagatc
   113941 agtgcgtgga aacccgatac cgcgccgcag gcaatggtga tgaacaggaa cgggaacaga
   114001 gcgcccttcc agaccggacc ggtgccgttg gtgaactggg tcagtgccgg cattttcagc
   114061 tcgggtgcca ggatcaggat gccgattgcc agcgccagaa tggtgccgat tttcaggaac
   114121 gtcgacaggt agtcacgcgg tgccagcagc agccagaccg gcagcatcgc tgcgacaaag
   114181 ccgtaaccca caagcatcca ggtgatctgg atgccggtga acgtaaacat cggcccccag
   114241 gtcgggtcgg ccgcaaccat gccgccgacc cagatcgaac cgagcaacag cagcacgccc
   114301 accagggata tttcaccgat acggcccggg cggatgtagc gcatataaat gcccatgaac
   114361 atcgcaatcg ggatcgtcgc catgaccgtg aacatgcccc acgggctttc ggccagggct
   114421 ttgaccacga tcagcgccag caccgcgagg atgatgatca tgatcaggaa gcagccgaac
   114481 aaggcgatgg tgccgggtat acggcccatt tcctcgcgaa ccatatcgcc cagcgagcga
   114541 ccgtcacggc gcgtggatag gaacaggatc atgaagtcct gcaccgcacc ggccagcacc
   114601 accccggcaa tcagccacag cgtaccgggc agatacccca tctgcgcagc caggacaggg
   114661 ccgaccagcg ggcctgcgcc agcgatggcg gcaaagtggt gaccgaacag gatgtgtttg
   114721 ttggttggca cgtagtccag accatcgttg ttgaccaccg ccggtgtcgc acgcagcgga
   114781 tcaagctgca tgacgtgtgt ggcgatgaaa agactgtagt aacgataagc aaccagataa
   114841 atggctaccg cagcgaccac tatccacaag gcgttgatcg cctctccgcg gcgcaaggcc
   114901 acgaccccaa gggcacatgc cccgacaatt gcgacgatga gccagggaac gtggcgcatc
   114961 aggctattat tatttttcat tttttttatt ccagcagagt tgactagaag gcaagcagag
   115021 cgagtttagc gccggatcag cgaaaggcca cccccaacca tggtctagac cgaaaattga
   115081 tcaattgcgg cagatacccg gcatagaggg ctggaatggc gtaggcagat ggtggctcga
   115141 tcacaaaacc gtcatgcgga actgttctgt aatggctttc agggctatcg tgcataaaca
   115201 agagaatcga tcagaaaaca acctgcccgc tgacccccgg tggctgtcaa caagagagct
   115261 cattcgatga ccgactcaca tgcagagcgc cgtcgtttca aacgtattgc cttcgacgca
   115321 aagaccgacg tgaagcaggg cgacaacagt tggaaagtgc aattggtcga tctttccctg
   115381 aaaggtttgc tgatcgagaa gcctgaacgg tggagcgcag atccggcgca gccttttgaa
   115441 gtggatatcc gcctcagcag tgacgtgcac gtgaaaatgg atgtcgagat gacccacgat
   115501 cacaaccagc aattgggatt cgtctgccgg cacatcgggc tggagtcgat cagccatctg
   115561 cggcggctga tcgaacttaa tctgggggac ccggcagagc tcgacaggga actggcggca
   115621 ctgatcgaac tttaggcttc agattccagg gccggttact cgaacaaagc atccagcgcc
   115681 tgttccagac gcgttacggc aatgatctgc agaccgggag gcgcttcttt cggcgcgttg
   115741 cctttcggca cgatggcccg tttgaagccg tgcttggcgg cctctttcaa gcgctcctgc
   115801 ccgctgggca ccggcctgac ctcacccgac agccccacct cgccaaacac cagcaagtca
   115861 tgcggcagcg ggcgattgcg caggctggac atgacagcgg ccatcagggc caggtccgac
   115921 gcggtttcca gcactttgac cccgcccacc acgttgagga acacgtcctg gtcgtgggtc
   115981 ggaatgccgc catgccggtg cagcaccgcc agcagcatcg ccagacggtt ctgatccagg
   116041 cccagggtta cacgacgcgg attggacata tggctgtcat ccaccagcgc ctgaacttcg
   116101 accagcatcg gtcgggtgcc ttcccatgtg gccatgacca cgctgccggg cacttcttcc
   116161 tgcgcacggg tcagaaaaat cgccgacgga ttggacactt ctttcaggcc cttgtcggtc
   116221 atgccgaaca cgcccagttc gtttaccgcg ccgaaacggt tctttacggc gcgcagcaaa
   116281 cgcagacgac cgtccgactc gccttcgaaa tacagcacgg tatcgaccat gtgctcaagc
   116341 acacgcggcc ccgccagtgc gccttccttg gtgacatgcc ccaccaggaa aatcgcggtg
   116401 ccactctgct tggcgtagcg caccagcaag gcggcgcttt cgcgcacttg cgacacgcca
   116461 ccgggtgcgg actgcaattg ctcggtgaag atcgtctgga tcgagtcgat caccattacc
   116521 ttgggcttct cgaccttggc ggtggcaata atggtttcga tgcaggtttc ggtcatgacc
   116581 cgcagtttgt cctgcggcag gcccagacgg cgagcgcgca tggccacctg ctgttgggat
   116641 tcctcgccgg tgacatacag cgcaggcatg cgctgggcga tgttacacag cgtttgcaac
   116701 agaattgtcg acttgccgat gccagggtcg ccgccgatca gcaccacaga accatccacc
   116761 aaaccgccac cgagcactct gtcgagttcg gcggagttgg tggaaaaccg cgggatctct
   116821 tcaacgctga cttcagccag ggttctgatc tgcgcctgtg agccggtcca gccggtgcgc
   116881 ccgctgggag gcgctgcggc accgctttct atcatggttt cgaccagtgt gttccaggcg
   116941 ccgcaatcag cacactggcc cgcccacttg ggaaatgtcg cgccgcactc ggtgcagccg
   117001 tacaagcgtt tggccttggc catgacaacc ccagtcgtaa aaaacgccca tgataacgca
   117061 ggttgcagcg cctgttaccc gtgcagcgga gcacgacttt caaaacctta taaaacttac
   117121 acagaccgcc tcggtcgatt aaacgtagac cgggcggcaa gagcacggct gggctacact
   117181 caactggatc aaatttatct gttacaagga attacccatg agcgtgctta cagaattcaa
   117241 ggcattcgca gtcaaaggta acgtggtcga tatggccgtc ggtatcatca ttggcgcggc
   117301 attcggcaaa atcgtttcat cgttcgtcgg cgacgtgatc atgccaccac tgggcctgct
   117361 gatcggcggc gtggacttca gcgacctggc agtcaccctg cgccctgcgc aaggcacagc
   117421 gcctgcggtg ttgctggcgt acggcaagtt catccagacc gtcatcgact ttatcatcgt
   117481 cgcgttcgcg atcttcatgg gcgtcaaggc catcaaccgc ctcaagcgcg aagaagccaa
   117541 ggccccaacc ctgccgccaa cgccttccaa gcaggaagtg ttgctgagcg agattcgcga
   117601 cctgctcaag gaacagaacc aaccggcagc gcctgttact gtggaccctg ctcgtccgct
   117661 gtgattggaa gcctgaaaaa caggcttctg cccggtgggc gtagggggcg gaccgggcga
   117721 cgcttcgctc tggattctgg ctgaaggccg tgggacttgt ccgcgaagag gctttacatc
   117781 cgcagaatat ttatcgcctg cagtgcagca ttcgcggaca agcaggcatc acccggtctg
   117841 cgtctaccct accaatacgt ctccaccgcc acttgccccg gtttgcggga caggctcagg
   117901 cgcatgtcgc gctgcttgag caatgcacgt gtgtcgtcga tcatctgtgg gttgccgcat
   117961 agcatcaccc gcgaatgctc aggcgtcagg tcgatacctg tggcgcgttc aagtgctccg
   118021 ttttcgatca gttgcgtgat acggccactc agtgcaccgg gatgctgctc gcgggtgacg
   118081 gtgggcagaa acataaactt gtgtgcgtac tcggccaggt agtcacgctg catcaactcg
   118141 ctgatcagcg gctgataggc caactcactg gactcacgaa cgctgtacac cagaatcacc
   118201 cgttcgaatt tctcccagac ctcgaagtcc tgaagaatcg aaagaaacgg cgcgacgccc
   118261 gtgccagtgg acagcagcca caggtcgcga ccatcgacga agcggtccag ggtcaggtaa
   118321 ccaaacgcct gcttctccac catcaggctg tcgccctcgc gcaggcggct taactcgctg
   118381 gtgaattccc catcgggcac cacgatggag aaaaactcca gaaactcgtc gtgcggagaa
   118441 gaaaccatcg agtacgcacg ccacaccgtc gtgccgtcag tcttggtcac acccagccgc
   118501 gcgaattgcc ctgcgcgaaa gcgaaagccg gggtcgcggg tcgtacgcag ggtaaacaga
   118561 ttcgtggtca gcggtgtaac acgctgcagc gtctggcggg tgaacttgtc ctcactgacg
   118621 gtcatggcgc gcttttaact cctgaacaat ggcaagcaag acccagtgtc ccgcaaagca
   118681 ggctcgataa acaccggtgg tttgtagtgg attgcctgaa atagttgtag ccgcttagag
   118741 tatttggttc ttgacgcccg ccaatgctgg attgaacgtc tacatggcca atcacctcgg
   118801 ccgctcttgc tcggggcttt cagcttaaac gccaagaata gacggccaag tgccatcacc
   118861 ccatccgtca gaccagattc gcagcgtgcc gattgccggg tatttgttcc tagactggac
   118921 aaacacacag caaggtttgg ctgcgtgctg caaggaggct acatgagcac tatggacatc
   118981 aattttatac agccctcacc cacaaaaaat ctgacgcaga gagaaatcga agtcctcaag
   119041 tggtccgcgg aaggtaaaac agctggcgac atcgccatga ttctctgttt gaaggagcgc
   119101 acgattcact tccacatcgc cagcgccatt cagaaaatgg gggtctgcaa caagaccgcc
   119161 gcagccgtac aggccgcatt gagcgggatg ttctgataaa gcagtagcag aacaacaatc
   119221 aggcgggtat cagagcgaaa aaatacgtaa aatcgtctgc ttcagcgagc ccacgtgtcg
   119281 tcgggttcgc tggcacactt tcgattgcac agagttttcc cgccaatgcc cctgctcatc
   119341 agccgtttcg ccgaacttga tctcattcgc caacccgagc aacaggatga gccgttgcag
   119401 gcattcgatg ctgctgacga gtacctgctc agccatgtcg cagaaaccgg gctgagcctg
   119461 gagagccgcg tactggtgct caatgacagt ttcggcgcac tggcggcgag tctggcgcgc
   119521 cacgccaatg tggtcagcag taccgattcg tttctggcag cgcaggggct ggaaaagaac
   119581 ctggcgcgca acggcatggc ctacgacgcc gtgccgttga tcccggccag tgagccattg
   119641 agcggccctt tcgactgggt gctgatccgc atccccaaga cactggccct gcttgaagag
   119701 cagttgatcc gcctgcaagg ccaactggcc cccggtgctc gcgttg
//