LOCUS       AB209319                5245 bp    mRNA    linear   HUM 17-NOV-2007
DEFINITION  Homo sapiens mRNA for LAMP1 protein variant protein.
ACCESSION   AB209319
VERSION     AB209319.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 5245)
  AUTHORS   Totoki,Y., Toyoda,A., Takeda,T., Sakaki,Y., Tanaka,A.,
            Yokoyama,S., Ohara,O., Nagase,T. and Kikuno,R.F.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-MAR-2005) to the DDBJ/EMBL/GenBank databases.
            Contact:Osamu Ohara
            Kazusa DNA Research Institute, Department of Human Gene Research;
            2-6-7   Kazusa-kamatari, Kisarazu, Chiba 292-0818, Japan
            URL    :http://protein.gsc.riken.go.jp/
REFERENCE   2
  AUTHORS   Totoki,Y., Toyoda,A., Takeda,T., Sakaki,Y., Tanaka,A.,
            Yokoyama,S., Ohara,O., Nagase,T. and Kikuno,R.F.
  TITLE     Homo sapiens protein coding cDNA
  JOURNAL   Published Only in Database(2005)
COMMENT     This work was supported in part by the National Project on Protein
            Structural and Functional Analysis , Ministry of Education,
            Culture , Sports, Science and Technology of Japan.
            Totoki Y, Toyoda A, Takeda T, Sakaki Y, Tanaka A, Yokoyama S.
            RIKEN Genomic Sciences Center, 1-7-22 Suehiro-cho, Tsurumi,
            Yokohama 230-0045, Japan. 
            URL: http://protein.gsc.riken.go.jp/
FEATURES             Location/Qualifiers
     source          1..5245
                     /clone="fh08237"
                     /db_xref="H-InvDB:HIT000329254"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="this clone is also named as hsk003001224"
                     /note="vector:pBluescriptII SK plus"
                     /organism="Homo sapiens"
                     /tissue_type="brain"
     CDS             <1528..2706
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Start codon is not identified."
                     /product="LAMP1 protein variant"
                     /protein_id="BAD92556.1"
                     /translation="WSPSSLELTGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYD
                     TKSGPKNMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSV
                     QLMSFVYNLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLH
                     DATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNG
                     TCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVLL
                     FQFGMVRLGRHLSGGAHCVSTTSFCALGLLMGGSVRKEAASLFFCLPFILGFLVPWFP
                     SPLSIPFIDAADDVGGAAVPTVGVAAGEGMQAVRPSGFRCCCPVVPWWHFCLGGLLCS
                     "
BASE COUNT         1219 a         1240 c         1447 g         1339 t
ORIGIN      
        1 acaggcgtga gccactgtgc ccggcagcac cttttcttta tggacataga ttttggtatt
       61 tcctttacca aagggaagat aggtgggact acttctggtt atatgcttcg ctttaggctt
      121 gaagaacagt tgctgtaaag attttatttt gtgaaagacc caaggttgaa atgagtcgga
      181 ttcattggaa tccattactt ttccagggaa taggatttta aatgaaaagc taagcatcct
      241 ctctttcaat atctgccctc acagtgtgcc tgagttgcat ttacacttag agtgacagat
      301 gagactcggg tgtgtgtgtg gttggaaggc tgtgctcacg cagtgtgaga tcagcccctg
      361 ggtggtgagt gctcactgga ctggcatgca cgaacttgta gtggcagaga caagtgaaag
      421 catgtcattt ctgcacggat tccagtggtg gcagataggt gtttggcgtt agaacaggca
      481 gaaacacctg ttttccaatc tgtaatgaaa gaactgtgta ataacgtgca atttgtacaa
      541 ttaccagtgt ctctaccata gtgatcagat tacatttgtt gccaaacatc ttgatcaggg
      601 aagtggagta tgagtaagtc agagaggaaa tatttagcag tgaccactgt ccagctggaa
      661 agacctatag agcttccatt ctgtcccttt gcttcaggat ggggaaggga agccactcca
      721 ccgatgtgta gtgctgtgag gacctttctg aaattgggca aagagctcag cactttgagt
      781 ccatgagaaa taaaactgac cagacgttaa gtagcaggtg aggaccacag tgaaagatcc
      841 tgcagcctct cccatggatt tctgcagatg ggtgagttgt gccttcaagg caccacgtct
      901 tacagagatc ctctgagaaa ggcggaacag cgtatgccta ggatgatgca gaaattgaca
      961 tgtgccttcc tgataagtgt tctggaataa agcactaaat agcaatagac taggttggca
     1021 aactcaatca gatgggctta gagataacaa ttccagaata gtatccgaaa gggacagggc
     1081 accaggtgaa ctggctgcgt aatccatgtg tctggttgtt cattgaattt aagaaacaca
     1141 gtggaggctg ggtgcagtgg ctgacaccta taatcccagc accttgggag gccaaggtgg
     1201 gtggatcacc tgaggtcagg agttcaagac cagcctggcc aaagtggcaa aaccccgtcg
     1261 ctactaaaag cagaaattag ctgggtttgg tggcacgtgc ctgcggttcc agctgcttgg
     1321 gaggctgagg caggagaatt gcttgaacct gggaggtgga ggttgcagtg agctgagatc
     1381 gcgccactgc accccagcct ggcgacagtg agactccgtc tcaaaaaaaa aaaaaaagag
     1441 aaacagtgga atcttgtaat aaaagccatc actgctacag ctgtggaaaa tggaaatact
     1501 cggtcgtatt ttctggacag tttttgatgg tctccgtctt ccctggaatt gacaggcctc
     1561 atgcattgtg cgtcagcagc aatgtttatg gtgaaaaatg gcaacgggac cgcgtgcata
     1621 atggccaact tctctgctgc cttctcagtg aactacgaca ccaagagtgg ccctaagaac
     1681 atgacctttg acctgccatc agatgccaca gtggtgctca accgcagctc ctgtggaaaa
     1741 gagaacactt ctgaccccag tctcgtgatt gcttttggaa gaggacatac actcactctc
     1801 aatttcacga gaaatgcaac acgttacagc gtccagctca tgagttttgt ttataacttg
     1861 tcagacacac accttttccc caatgcgagc tccaaagaaa tcaagactgt ggaatctata
     1921 actgacatca gggcagatat agataaaaaa tacagatgtg ttagtggcac ccaggtccac
     1981 atgaacaacg tgaccgtaac gctccatgat gccaccatcc aggcgtacct ttccaacagc
     2041 agcttcagca ggggagagac acgctgtgaa caagacaggc cttccccaac cacagcgccc
     2101 cctgcgccac ccagcccctc gccctcaccc gtgcccaaga gcccctctgt ggacaagtac
     2161 aacgtgagcg gcaccaacgg gacctgcctg ctggccagca tggggctgca gctgaacctc
     2221 acctatgaga ggaaggacaa cacgacggtg acaaggcttc tcaacatcaa ccccaacaag
     2281 acctcggcca gcgggagctg cggcgcccac ctggtgactc tggagctgca cagcgagggc
     2341 accaccgtcc tgctcttcca gttcgggatg gtgaggctgg ggcggcacct ctctgggggc
     2401 gcccactgtg tctccaccac atctttttgt gccctgggtc tgctcatggg aggcagcgtt
     2461 aggaaggagg cggcctcact ttttttctgc cttcccttta tcctgggctt tttagttcct
     2521 tggttcccct cccccctttc cattccattc atagatgcag cagatgatgt gggcggggct
     2581 gctgtgccca cagttggagt ggctgcaggg gagggcatgc aggccgtgcg gccttctggc
     2641 ttcagatgct gctgccctgt ggttccgtgg tggcatttct gcctgggagg actcctgtgc
     2701 agttagcaac ataagacatg aagcatataa ttgtcacttg tcagtctttt taaatcgctg
     2761 tgcaaatgaa ttaacagttc agtttcttat aattttagct ttccaaatca tgctttcctg
     2821 tgctgtgata gctcctgcag tccccgtttt ccagagactg actctcaaga ggtctggaag
     2881 gaccagcctg ggcagcacag ggaggctcca tttctgcaaa taataaaacg agttagctgg
     2941 gcgtagtggc gcacacctgt ggtcccagct acttgggagg ctgaggtggg aggatcactt
     3001 gagcccagga gttaaggttg cgatgagccg tgatcactcc actgcactcc agcctgggtg
     3061 acagagcaag actctcagag aagggtctgg aaggaactaa ccaaaatttt cattccccag
     3121 agatacacaa cgccttttat agacaagatc ttttgcagtt ttgttctaat actagaaatg
     3181 taggaagtca ggtttattac ccaatgacca ttcacgtttg atgataaatg tgtgaatcta
     3241 ctggggttaa agatcatctt tctatgaatc tgctccgtga ttaaagatca tttttctttt
     3301 taagaatgca agttctagcc ggtttttcct acaaggaatc cagttgaata caattcttcc
     3361 tgacgccaga gaccctgcct ttaaagctgc caacggctcc ctgcgagcgc tgcaggccac
     3421 agtcggcaat tcctacaagt gcaacgcgga ggagcacgtc cgtgtcacga aggcgttttc
     3481 agtcaatata ttcaaagtgt gggtccaggc tttcaaggtg gaaggtggcc agtttggctc
     3541 tggtgagtgt caccgagggc agctgtcgcg gggtgtggag gacgtgcttc agactccgcc
     3601 tgtggacgtt tagtcgcttc cgtgtgggct ggggcgacgc ccctgttcct ctgcaaggag
     3661 ctgtttcttc ttgccggtct gagattctag aggtaactcc ccctgcttta gagaggccca
     3721 gcgtgtctct cagctgggag cccctggtac catttgagag taagggaatc attttaagaa
     3781 acagtggtgg cgcttctccc atgaacgttg aatacaacac tgtcatctga tgtgcacaga
     3841 ggccctggac gcagcacagc tgtccggcca cagcccctga ttccagacgg gggagagacg
     3901 tgtgtggttt cctcgccgtg cagagagcac cagtctctgc agcggcttcc ccaagtgaca
     3961 attccagcta gagctggaac cttccgccag ggttcctctt tgccttttgg ctgatgtggg
     4021 ggagtggtgg ggagagaggc ctgtttgcag gcccctgtgt gagcagagcc ctgacaccat
     4081 ccgtctgtct tggcagtgga ggagtgtctg ctggacgaga acagcatgct gatccccatc
     4141 gctgtgggtg gtgccctggc ggggctggtc ctcatcgtcc tcatcgccta cctcgtcggc
     4201 aggaagagga gtcacgcagg ctaccagact atctagcctg gtgcacgcag gcacagcagc
     4261 tgcaggggcc tctgttcctt tctctgggct tagggtcctg tcgaagggga ggcacacttt
     4321 ctggcaaacg tttctcaaat ctgcttcatc caatgtgaag ttcatcttgc agcatttact
     4381 atgcacaaca gagtaactat cgaaatgacg gtgttaattt tgctaactgg gttaaatatt
     4441 ttgctaactg gttaaacatt aatatttacc aaagtaggat tttgagggtg ggggtgctct
     4501 ctctgagggg gtgggggtgc cgctgtctct gaggggtggg ggtgccgctg tctctgaggg
     4561 gtgggggtgc cgctctctct gagggggtgg gggtgccgct ttctctgagg gggtgggggt
     4621 gccgctctct ctgagggggt gggggtgctg ctctctccga ggggtggaat gccgctgtct
     4681 ctgaggggtg ggggtgccgc tctaaattgg ctccatatca tttgagttta gggttctggt
     4741 gtttggtttc ttcattcttt actgcactca gatttaagcc ttacaaaggg aaagcctctg
     4801 gccgtcacac gtaggacgca tgaaggtcac tcgtggtgag gctgacatgc tcacacatta
     4861 caacagtaga gagggaaaat cctaagacag aggaactcca gagatgagtg tctggagcgc
     4921 ttcagttcag ctttaaaggc caggacgggc cacacgtggc tggcggcctc gttccagtgg
     4981 cggcacgtcc ttgggcgtct ctaatgtctg cagctcaagg gctggcactt ttttaaatat
     5041 aaaaatgggt gttattttta tttttttttg taaagtgatt tttggtcttc tgttgacatt
     5101 cggggtgatc ctgttctgcg ctgtgtacaa tgtgagatcg gtgcgttctc ctgatgtttt
     5161 gccgtggctt ggggattgta cacgggacca gctcacgtaa tgcattgcct gtaacaatgt
     5221 aataaaaagc ctctttcttt ttggg
//