LOCUS       AB208823                3163 bp    mRNA    linear   HUM 17-NOV-2007
DEFINITION  Homo sapiens mRNA for distal-less homeo box 2 variant protein.
ACCESSION   AB208823
VERSION     AB208823.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3163)
  AUTHORS   Totoki,Y., Toyoda,A., Takeda,T., Sakaki,Y., Tanaka,A.,
            Yokoyama,S., Ohara,O., Nagase,T. and Kikuno,R.F.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-MAR-2005) to the DDBJ/EMBL/GenBank databases.
            Contact:Osamu Ohara
            Kazusa DNA Research Institute, Department of Human Gene Research;
            2-6-7   Kazusa-kamatari, Kisarazu, Chiba 292-0818, Japan
            URL    :http://protein.gsc.riken.go.jp/
REFERENCE   2
  AUTHORS   Totoki,Y., Toyoda,A., Takeda,T., Sakaki,Y., Tanaka,A.,
            Yokoyama,S., Ohara,O., Nagase,T. and Kikuno,R.F.
  TITLE     Homo sapiens protein coding cDNA
  JOURNAL   Published Only in Database(2005)
COMMENT     This work was supported in part by the National Project on Protein
            Structural and Functional Analysis , Ministry of Education,
            Culture , Sports, Science and Technology of Japan.
            Totoki Y, Toyoda A, Takeda T, Sakaki Y, Tanaka A, Yokoyama S.
            RIKEN Genomic Sciences Center, 1-7-22 Suehiro-cho, Tsurumi,
            Yokohama 230-0045, Japan. 
            URL: http://protein.gsc.riken.go.jp/
FEATURES             Location/Qualifiers
     source          1..3163
                     /clone="fk06205"
                     /db_xref="H-InvDB:HIT000328758"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="this clone is also named as hsk003000102"
                     /note="vector:pBluescriptII SK plus"
                     /organism="Homo sapiens"
                     /tissue_type="brain"
     CDS             <510..1214
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Start codon is not identified."
                     /product="distal-less homeo box 2 variant"
                     /protein_id="BAD92060.1"
                     /translation="LMGWMGKRVWGGGPSKALDFHAACSPPACALYPPQPPICRRSPV
                     TSLSPLVGPGGLKSQVGVLCLPHKGISLPPASFSWVCTCLPLPWRVQLPGSVAAPIAR
                     CEVAPARGATVQCTHLFAQAKSPPPGPLGGRELQDPWVALFLRFFIVAEKEDLEPEIR
                     IVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVGLAPC
                     RGEESAGLRWLGSRRV"
BASE COUNT          590 a         1045 c          817 g          711 t
ORIGIN      
        1 gagacagagg aggcgcctgg cttcccccgc acgcccgcca cctctgctct ttcccgtctc
       61 gggccaggat gactggagtc tttgacagtc tagtggctga tatgcactcg acccagatcg
      121 ccgcctccag cacgtaccac cagcaccagc agcccccgag cggcggcggc gccggcccgg
      181 gtggcaacag cagcagcagc agcagcctcc acaagcccca ggagtcgccc acccttccgg
      241 tgtccaccgc caccgacagc agctactaca ccaaccagca gcacccggcg ggcggcggcg
      301 gcggcggggg ctcgccctac gcgcacatgg gttcctacca gtaccaagcc agcggcctca
      361 acaacgtccc ttactccgcc aagagcagct atgacctggg ctacaccgcc gcctacacct
      421 cctacgctcc ctatggaacc agttcgtccc cagccaacaa cgagcctggt atgcataacg
      481 ctgaagtcaa gagtgccgag tcggtctagt taatgggatg gatgggtaaa cgtgtttggg
      541 gcggggggcc ttcgaaagct ctggattttc acgctgcctg ctcaccgccc gcttgtgccc
      601 tttaccctcc ccagcctcca atctgccgca ggtcgccggt tacgtccctc tctcctttgg
      661 taggacctgg tggcctcaag agccaagtgg gcgtgctctg cctgcctcat aagggcatct
      721 ccttgccacc agcttctttc tcttgggtgt gcacttgtct cccccttccc tggagggtac
      781 agctcccggg gtcggtggcg gctccgatcg cacgctgcga agttgcgcct gcccgtggcg
      841 ccacagttca gtgcacccac ctctttgctc aagccaagtc ccccccgccg ggccctctag
      901 gagggcggga actccaggac ccctgggttg cgctgttctt acgattcttt atcgttgcag
      961 agaaggagga ccttgagcct gaaattcgga tagtgaacgg gaagccaaag aaagtccgga
     1021 aaccccgcac catctactcc agtttccagc tggcggctct tcagcggcgt ttccaaaaga
     1081 ctcagtactt ggccttgccg gagcgagccg agctggcggc ctctctgggc ctcacccaga
     1141 ctcaggtggg gctcgcgccc tgcaggggcg aggagagcgc gggcctgaga tggctgggaa
     1201 gcaggcgggt ttaggacaat gctttttaaa gttcatttta agtactttta aggatttcca
     1261 ggcctgcgcc tcgagcggcc ctaagtaagc ttctaggccc aaagctggaa acccccaagg
     1321 ggccgccgtg ggagggaagg aaagggaccg ggtggacaga aatcccgtac ctctcgctac
     1381 tgattaagcg ggtgaaataa ctggccctcc tcaccctccc gctgtcacca tcatcacagt
     1441 gcacgtacac cagcagtcct ggccttttgg caattacctc cccagggagc aggaaccggc
     1501 agagcctcga aggccgccgc ccgtgatcct cttatctccc cagggcgctc gctgcccacc
     1561 gctagccagc ggtttttctc tgccttcttt tttctcctct tcgaacccct actgccccaa
     1621 gactaggttc ctccactaat gctcaggtct ttttcctcaa aggtcaaaat ctggttccag
     1681 aaccgccggt ccaagttcaa gaagatgtgg aaaagtggtg agatcccctc ggagcagcac
     1741 cctggggcca gcgcttctcc accttgtgct tcgccgccag tctcagcgcc ggcctcctgg
     1801 gactttggtg tgccgcagcg gatggcgggc ggcggtggtc cgggcagtgg cggcagcggc
     1861 gccggcagct cgggctccag cccgagcagc gcggcctcgg cttttctggg caactacccc
     1921 tggtaccacc agacctcggg atccgcctca cacctgcagg ccacggcgcc gctgctgcac
     1981 cccactcaga ccccgcagcc gcatcaccac caccaccatc acggcggcgg gggcgccccg
     2041 gtgagcgcgg ggacgatttt ctaaccccag ggagaactcg ccagagactg agagcagaga
     2101 ccacttatcc tcattgctta ccccgagccg gggttccctc ctcccggccc gctgccgcca
     2161 cccacctctc ctgcaggctg cgacctgcag tggcccgtct caggccctgc tcactcccgg
     2221 ggccaccaaa cgggcccctc tctcggggga accggacagc agcttggcaa aggcctccct
     2281 aaaaggccgc atttctgacc tgagccccgg gtctcggctg tttcgagccc cgcctcggac
     2341 ttgccttccc tcccctccgg gtgagcctgt ctggcgcctt cctcgccccg ggctgagagc
     2401 tgggtcccgg gagatggaag cctcccaggc gcgcgaggct tcccgggcgc tctgaggctt
     2461 ctttctcctc gcccgctccc ctgggctcag ctcggacgct gcagttattg acctcccggt
     2521 cccgcctgcc cgccctcccc cacgtggccc cttgacccgg gcggccccgc cgcttctttc
     2581 cttcctgcag ttcccagccc tcggagcccc catcccttat cttaccccca ccgcgctccc
     2641 ccaggagcgc tccctcagct ctctcctcat ccatcaccag tggagttttt ttatttttta
     2701 tttttttaaa agtttaggtg cctttgcgga tgacctcatt ttgacgttga aaaaatgatt
     2761 ttttaatatg tgaacactgc aaaaatgtgt ttaaattatc ttttttaaaa cctattcagg
     2821 attattagcc tggacttgga cacagagttt gtaaataaag gtgtctgtgc agattttccc
     2881 actgatttat ttgtataaaa atactcatct tttcagactt ttttgtaaac ccccagttgt
     2941 gaaaactgca gtttagcagt gacctcagca acccctcctt tttatttttt cctttaaaaa
     3001 catttcagtt aaattaagct actgatttgg atttgtttta tcgtatccta aagtctttgt
     3061 tgttgaaatg aaaggtattt tggggttatt tattatgaaa acaacatgct cttaatgttg
     3121 attttacaat atgaagagat tatttaaata aattattgtt ttc
//