LOCUS       AB116621                 738 bp    DNA     linear   PLN 09-DEC-2003
DEFINITION  Cistanche deserticola chloroplast rps2 gene for ribosomal protein
            subunit 2, complete cds.
ACCESSION   AB116621
VERSION     AB116621.1
KEYWORDS    .
SOURCE      chloroplast Cistanche deserticola
  ORGANISM  Cistanche deserticola
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; lamiids; Lamiales; Orobanchaceae;
            Orobancheae; Cistanche.
REFERENCE   1  (bases 1 to 738)
  AUTHORS   Tomari,N., Ishizuka,Y., Moriya,A., Kojima,S., Deyama,T.,
            Maksut,C., Tu,P. and Mizukami,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-AUG-2003) to the DDBJ/EMBL/GenBank databases.
            Contact:Nobuyoshi Tomari
            Yomeishu Seizo Co., Ltd., Central Research Laboratories; 2132-37
            Nakaminowa, Minowa-machi, Kamiina-gun, Nagano 399-4601, Japan
REFERENCE   2
  AUTHORS   Tomari,N., Ishizuka,Y., Moriya,A., Kojima,S., Deyama,T.,
            Maksut,C., Tu,P. and Mizukami,H.
  TITLE     Pharmacognostical Studies of Cistanche Herba (4) Phylogenetic
            Relationship of the Cistanche Plants Based on Plastid rps2 Gene
            and rpl16-rpl14 Intergenetic Spacer Region Sequence
  JOURNAL   Unpublished (2003)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..738
                     /country="Kazakhstan"
                     /db_xref="taxon:161395"
                     /mol_type="genomic DNA"
                     /note="Cistanche deserticola Y. C. Ma"
                     /organelle="plastid:chloroplast"
                     /organism="Cistanche deserticola"
     CDS             1..738
                     /codon_start=1
                     /gene="rps2"
                     /product="ribosomal protein subunit 2"
                     /protein_id="BAD04076.1"
                     /transl_table=11
                     /translation="MTIRYWNIDLEEMLEAGVHFGHGTRKWNPKMAPYISAKRKGIHI
                     TNLTRTARFLSEACNLVFDAASRGKQFLIVGTKNKAADSVAWAAIKARCHFVNKKWLG
                     GMLTNWSTTEMRLHKFRDLRMEQKMGRFNRLPKRDAAVVKRQLSRLQTYFGGIKYMTG
                     LPDIVIIVDQHEEYTALRECITLGIPTICLIDTNCDPDLADISIPANDDAISSIRLIL
                     NKLVFAICEGRSSYSSSYIRNPGLIIR"
BASE COUNT          240 a          118 c          162 g          218 t
ORIGIN      
        1 atgaccataa gatattggaa catcgacttg gaagaaatgc tggaggcagg agttcatttt
       61 gggcatggta ctaggaaatg gaatcctaaa atggcacctt atatctctgc aaagcgtaaa
      121 ggtattcata ttacaaatct tacgagaact gctcgttttt tatccgaagc ctgcaatttg
      181 gtttttgatg cagcaagtag gggaaaacaa ttcttgattg ttggtacaaa aaataaagca
      241 gctgattcag tagcatgggc tgcaataaag gcccggtgtc attttgttaa taaaaaatgg
      301 cttggcggga tgttaacgaa ttggtccact acagaaatga gacttcataa attcagggac
      361 ttgagaatgg aacaaaaaat gggaagattc aaccgccttc cgaaaagaga tgcagctgtg
      421 gtgaaaaggc aattatctcg cctgcaaaca tattttggcg ggattaaata tatgacaggg
      481 ttacccgata ttgtaatcat tgttgatcag catgaagaat atacggctct acgagagtgt
      541 attaccctgg gaattccaac aatttgttta atcgatacaa attgtgatcc cgatcttgca
      601 gatatttcga ttccggcgaa tgatgatgct atatcttcaa ttcgtttaat tcttaacaaa
      661 ttagtattcg caatttgtga gggtcgttct agctatagtt ctagctatat aagaaatcct
      721 ggattaataa taagataa
//